Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54570.1

JCVISYN3A_0002

DNA polymerase III subunit beta.
M. mycoides homolog: Q6MUM6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 58
Unique PROST Go: 13
Unique BLAST Go: 1
Unique Foldseek Go: 27

Total Homologs: 152
Unique PROST Homologs: 13
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 49

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: dnaN; DNA polymerase III subunit beta
Zhang et al. [4]: GO:0003887|DNA-directed DNA polymerase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O84078 (Beta sliding clamp) with a FATCAT P-Value: 0 and RMSD of 1.94 angstrom. The sequence alignment identity is 21.2%.
Structural alignment shown in left. Query protein AVX54570.1 colored as red in alignment, homolog O84078 colored as blue. Query protein AVX54570.1 is also shown in right top, homolog O84078 showed in right bottom. They are colored based on secondary structures.

  AVX54570.1 --------------------------------------------------MNFSINRMVLLDNLSKAAKV--IDPKNVN-PSLAGIYLNVLSDQVNIIAT 47
      O84078 MNFRLHGAFSNPSFVKIFFTKASPERRLTCFHVTKHGYSFQTDLHDYRKIMKFVISRNE-LGNLIK--KVQNVVPQSTPIPVLTHVLIESCNDELVFTAT 97

  AVX54570.1 SGILSFKSILNNQNSDLEVKQEGKVLLKP--KFVLEMLRRLDDEFVVFSMVEDNELIIKTDNSD-F---SIGVLNSEDYPLIGFREKGIEFNLNPKEVK- 140
      O84078 DLTVSTRCVVK-----AKVYESGSVTI-PSRRF-FQLIRELTEANIEVA-AHSGEMATITSGSSCFRLLSMG---KEDFPMLPDMQNALRFTLDSERLKD 186

  AVX54570.1 ---KTIYQVFVSMNENNKKLILTGLNLKLNNNKAIFSTTDSFRISQKI-LEIQSDNNEDIDITIPFKTALELPKLLD-NAENLK-IIIVEGYITFI-ID- 232
      O84078 MFQRTSF--AVSREES--RYVLTGVLLSIANGTMTVVGTDGKRLA-KIDTEISLDPSFSGDYIIPIK-AVE--EIIRMSSEDVQSTIFLDQ--TKIAVEC 276

  AVX54570.1 -NVIFQSNLIDGRFPNVQIAFPTKFETIITVKQKSILKVLSRFDLVADD---GL-----PAIVNIKVNEDKIEFKSFISEVGKYEEDFDDFVIE--GNKS 321
      O84078 GNTLLVTKLLSGEFPDFSPVISTHSSVQLDLHREELISLLKQVALFTNESSHSVKFSFSPGELTLTANCTK------VGE-GKV-----SMAVNYTG-ET 363

  AVX54570.1 LSISFNTRFLIDAIK-TLDEDRIELKLINSTKPIVINNVYD--EHLKQVILPTFLSN- 375
      O84078 LEIAFNPFFFLDILKHSRDE-LVQLGISDSYNPGIIT---DSTRSL-FVIMPMRLHDD 416

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0003677	DNA binding
1. PBF	GO:0006260	DNA replication
1. PBF	GO:0008408	3'-5' exonuclease activity
1. PBF	GO:0003887	DNA-directed DNA polymerase activity
1. PBF	GO:0006271	DNA strand elongation involved in DNA replication
1. PBF	GO:0009360	DNA polymerase III complex
2. PF	GO:0019985	translesion synthesis
2. PF	GO:0006272	leading strand elongation
2. PF	GO:0070182	DNA polymerase binding
2. PF	GO:0030337	DNA polymerase processivity factor activity
2. PF	GO:0030896	checkpoint clamp complex
2. PF	GO:0006275	regulation of DNA replication
2. PF	GO:0043626	PCNA complex
2. PF	GO:0051598	meiotic recombination checkpoint signaling
4. PB	GO:0042276	error-prone translesion synthesis
4. PB	GO:0005737	cytoplasm
4. PB	GO:0044787	bacterial-type DNA replication
5. P	GO:0039695	DNA-templated viral transcription
5. P	GO:0031573	mitotic intra-S DNA damage checkpoint signaling
5. P	GO:0035861	site of double-strand break
5. P	GO:0000077	DNA damage checkpoint signaling
5. P	GO:0044778	meiotic DNA integrity checkpoint signaling
5. P	GO:0000724	double-strand break repair via homologous recombination
5. P	GO:0140445	chromosome, telomeric repeat region
5. P	GO:0005694	chromosome
5. P	GO:0033314	mitotic DNA replication checkpoint signaling
5. P	GO:0071479	cellular response to ionizing radiation
5. P	GO:0021762	substantia nigra development
5. P	GO:0000723	telomere maintenance
5. P	GO:0008853	exodeoxyribonuclease III activity
6. F	GO:0005652	nuclear lamina
6. F	GO:0003682	chromatin binding
6. F	GO:1900264	positive regulation of DNA-directed DNA polymerase activity
6. F	GO:0043596	nuclear replication fork
6. F	GO:0032139	dinucleotide insertion or deletion binding
6. F	GO:0006298	mismatch repair
6. F	GO:0031297	replication fork processing
6. F	GO:0070557	PCNA-p21 complex
6. F	GO:0035035	histone acetyltransferase binding
6. F	GO:0032077	positive regulation of deoxyribonuclease activity
6. F	GO:0016604	nuclear body
6. F	GO:1902990	mitotic telomere maintenance via semi-conservative replication
6. F	GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity
6. F	GO:0000307	cyclin-dependent protein kinase holoenzyme complex
6. F	GO:0032405	MutLalpha complex binding
6. F	GO:0045739	positive regulation of DNA repair
6. F	GO:0071466	cellular response to xenobiotic stimulus
6. F	GO:0045740	positive regulation of DNA replication
6. F	GO:0005813	centrosome
6. F	GO:0008022	protein C-terminus binding
6. F	GO:0006287	base-excision repair, gap-filling
6. F	GO:0030855	epithelial cell differentiation
6. F	GO:0030971	receptor tyrosine kinase binding
6. F	GO:0034644	cellular response to UV
6. F	GO:0003684	damaged DNA binding
6. F	GO:0031571	mitotic G1 DNA damage checkpoint signaling
6. F	GO:0000785	chromatin
7. B	GO:0046677	response to antibiotic

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0016779	nucleotidyltransferase activity
GO:0003677	DNA binding
GO:0006260	DNA replication
GO:0090305	nucleic acid phosphodiester bond hydrolysis
GO:0005737	cytoplasm
GO:0008408	3'-5' exonuclease activity
GO:0003887	DNA-directed DNA polymerase activity
GO:0009360	DNA polymerase III complex
GO:0071897	DNA biosynthetic process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q4ULS3	Beta sliding clamp	0.00e+00	6.65e-38	2.29e-15	0.9132
1. PBF	P52851	Beta sliding clamp	0.00e+00	1.46e-23	2.71e-21	0.9023
1. PBF	Q5HK00	Beta sliding clamp	0.00e+00	6.17e-35	8.11e-43	0.9092
1. PBF	Q8CQK6	Beta sliding clamp	0.00e+00	6.17e-35	8.11e-43	0.9084
1. PBF	P43744	Beta sliding clamp	0.00e+00	9.83e-29	5.11e-21	0.913
1. PBF	P34029	Beta sliding clamp	0.00e+00	7.36e-47	5.62e-61	0.9107
1. PBF	Q9EVE4	Beta sliding clamp	0.00e+00	1.68e-33	2.51e-12	0.9107
1. PBF	Q6GKU3	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9064
1. PBF	O25242	Beta sliding clamp	0.00e+00	8.39e-38	7.31e-10	0.874
1. PBF	P46387	Beta sliding clamp	0.00e+00	1.01e-25	5.65e-19	0.9003
1. PBF	O84078	Beta sliding clamp	0.00e+00	2.26e-07	8.71e-13	0.9156
1. PBF	Q5HJZ4	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9247
1. PBF	Q9KVX5	Beta sliding clamp	0.00e+00	3.43e-31	2.63e-23	0.928
1. PBF	A0QND6	Beta sliding clamp	0.00e+00	1.46e-23	2.71e-21	0.9015
1. PBF	P05649	Beta sliding clamp	0.00e+00	3.73e-36	2.90e-39	0.9426
1. PBF	Q9ZDB3	Beta sliding clamp	0.00e+00	4.31e-37	1.11e-15	0.9251
1. PBF	P0A023	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9104
1. PBF	P27903	Beta sliding clamp	0.00e+00	1.13e-35	5.53e-23	0.9175
1. PBF	Q9L7L6	Beta sliding clamp	0.00e+00	9.18e-24	3.72e-21	0.9068
1. PBF	B8GXP6	Beta sliding clamp	0.00e+00	1.09e-30	1.93e-14	0.9247
1. PBF	P0CAU5	Beta sliding clamp	0.00e+00	1.09e-30	1.93e-14	0.9259
1. PBF	P72856	Beta sliding clamp	0.00e+00	5.40e-36	1.73e-19	0.9043
1. PBF	Q9CJJ1	Beta sliding clamp	0.00e+00	7.26e-41	6.76e-24	0.9334
1. PBF	Q68WW0	Beta sliding clamp	0.00e+00	2.62e-36	6.93e-14	0.9256
1. PBF	P9WNU0	Beta sliding clamp	0.00e+00	2.16e-21	1.07e-21	0.9065
1. PBF	Q9PKW4	Beta sliding clamp	0.00e+00	3.79e-40	1.01e-12	0.9397
1. PBF	Q89B36	Beta sliding clamp	0.00e+00	3.38e-29	2.72e-10	0.9174
1. PBF	O83048	Beta sliding clamp	0.00e+00	8.89e-35	1.43e-07	0.9115
1. PBF	P29439	Beta sliding clamp	0.00e+00	4.81e-33	8.78e-11	0.9051
1. PBF	O54376	Beta sliding clamp	0.00e+00	5.24e-40	8.48e-24	0.9349
1. PBF	Q50313	Beta sliding clamp	0.00e+00	1.62e-44	3.09e-12	0.8876
1. PBF	Q1RIS7	Beta sliding clamp	0.00e+00	2.26e-38	2.64e-16	0.9224
1. PBF	A0A0E3URH8	Beta sliding clamp homolog GriR	0.00e+00	1.54e-30	4.76e-12	0.8926
1. PBF	P0A022	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9118
1. PBF	P26464	Beta sliding clamp	0.00e+00	3.63e-30	3.51e-20	0.9281
1. PBF	P22838	Beta sliding clamp	0.00e+00	8.01e-31	1.02e-15	0.9237
1. PBF	P57127	Beta sliding clamp	0.00e+00	7.41e-35	2.46e-05	0.8975
1. PBF	Q9Z8K0	Beta sliding clamp	0.00e+00	4.30e-41	6.87e-13	0.9335
1. PBF	P24117	Beta sliding clamp	0.00e+00	2.80e-75	0.0	0.9981
1. PBF	P99103	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9083
1. PBF	Q98RK6	Beta sliding clamp	0.00e+00	6.80e-41	3.85e-06	0.9155
1. PBF	P0A989	Beta sliding clamp	0.00e+00	1.18e-29	1.21e-18	0.9293
1. PBF	P0A990	Beta sliding clamp	0.00e+00	1.18e-29	1.21e-18	0.9304
1. PBF	Q9ZLX4	Beta sliding clamp	0.00e+00	5.52e-36	1.16e-11	0.8673
1. PBF	Q6GD88	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9102
1. PBF	O67725	Beta sliding clamp	0.00e+00	4.91e-40	3.09e-07	0.9189
1. PBF	P21174	Beta sliding clamp (Fragment)	0.00e+00	4.58e-09	8.01e-16	0.9275
1. PBF	P0A121	Beta sliding clamp	0.00e+00	1.69e-30	5.46e-23	0.9504
1. PBF	P0A120	Beta sliding clamp	0.00e+00	1.69e-30	5.46e-23	0.9502
1. PBF	P59651	Beta sliding clamp	0.00e+00	5.45e-42	5.24e-39	0.9327
1. PBF	O33914	Beta sliding clamp	0.00e+00	5.41e-21	6.29e-22	0.9037
1. PBF	O06672	Beta sliding clamp	0.00e+00	3.54e-43	2.64e-39	0.9318
1. PBF	Q9I7C4	Beta sliding clamp	0.00e+00	4.32e-29	3.03e-21	0.9516
1. PBF	P47247	Beta sliding clamp	0.00e+00	6.95e-42	1.39e-16	0.8818
1. PBF	P0A024	Beta sliding clamp	0.00e+00	5.08e-36	7.95e-45	0.9085
1. PBF	P52023	Beta sliding clamp	0.00e+00	2.28e-29	2.27e-16	0.9281
1. PBF	Q9RCA1	Beta sliding clamp	0.00e+00	1.08e-37	2.07e-38	0.935
1. PBF	Q92I37	Beta sliding clamp	0.00e+00	4.75e-38	4.83e-15	0.9267
2. PF	O29912	DNA polymerase sliding clamp	1.80e-13	2.13e-03	NA	0.717
2. PF	Q9UWR9	DNA polymerase sliding clamp	2.53e-12	5.43e-03	NA	0.4358
2. PF	O58398	DNA polymerase sliding clamp	1.62e-12	1.85e-02	NA	0.4362
2. PF	P31008	Proliferating cell nuclear antigen	1.54e-12	1.73e-02	NA	0.6482
2. PF	Q975M2	DNA polymerase sliding clamp 2	2.60e-12	2.89e-02	NA	0.4065
2. PF	Q9UYX8	DNA polymerase sliding clamp	2.23e-12	3.53e-02	NA	0.4338
2. PF	C6A1Y5	DNA polymerase sliding clamp	2.91e-12	1.15e-02	NA	0.4419
2. PF	P33761	Beta sliding clamp	0.00e+00	3.20e-29	NA	0.8931
2. PF	A0RXH7	DNA polymerase sliding clamp	1.79e-13	2.53e-02	NA	0.7426
2. PF	Q74MV1	DNA polymerase sliding clamp	8.83e-13	9.28e-04	NA	0.7215
2. PF	A1RXU8	DNA polymerase sliding clamp	5.00e-13	1.06e-03	NA	0.7203
2. PF	A2SSW6	DNA polymerase sliding clamp	1.15e-13	1.83e-02	NA	0.7112
2. PF	Q8ZYL6	DNA polymerase sliding clamp 2	5.04e-12	5.52e-03	NA	0.6762
2. PF	B6YVZ1	DNA polymerase sliding clamp	3.20e-12	2.79e-02	NA	0.4317
2. PF	P57763	DNA polymerase sliding clamp 2	1.98e-11	6.03e-03	NA	0.4008
2. PF	Q5JFD3	DNA polymerase sliding clamp 2	5.19e-12	4.59e-03	NA	0.4319
2. PF	Q97Z84	DNA polymerase sliding clamp 2	3.71e-12	1.91e-03	NA	0.653
2. PF	P57766	DNA polymerase sliding clamp 1	3.37e-12	1.26e-03	NA	0.4002
2. PF	Q8ZTY0	DNA polymerase sliding clamp 1	4.27e-13	2.75e-02	NA	0.7058
2. PF	Q2NE55	DNA polymerase sliding clamp	4.46e-13	7.63e-03	NA	0.751
2. PF	O16852	Proliferating cell nuclear antigen	2.55e-13	1.67e-02	NA	0.6782
2. PF	Q975N2	DNA polymerase sliding clamp 1	1.83e-11	3.86e-02	NA	0.6732
2. PF	Q9YEZ5	DNA polymerase sliding clamp 3	2.05e-12	1.01e-03	NA	0.6875
2. PF	P57762	DNA polymerase sliding clamp 1	1.77e-11	1.83e-02	NA	0.6773
2. PF	Q973F5	DNA polymerase sliding clamp 3	1.53e-12	3.39e-03	NA	0.6728
2. PF	C5A5N6	DNA polymerase sliding clamp	2.36e-12	7.18e-03	NA	0.4393
2. PF	Q8TWK3	DNA polymerase sliding clamp	1.49e-12	3.31e-03	NA	0.6652
2. PF	Q5JF32	DNA polymerase sliding clamp 1	2.17e-12	1.47e-02	NA	0.4341
2. PF	Q9Y9V7	DNA polymerase sliding clamp 2	1.80e-13	6.04e-05	NA	0.4236
3. BF	P52620	Beta sliding clamp (Fragment)	3.27e-11	NA	0.012	0.8705
4. PB	P0A988	Beta sliding clamp	0.00e+00	1.18e-29	1.21e-18	NA
4. PB	P9WNU1	Beta sliding clamp	0.00e+00	2.16e-21	1.07e-21	NA
5. P	P61074	Proliferating cell nuclear antigen	2.05e-12	1.73e-02	NA	NA
5. P	P78955	Checkpoint protein hus1	1.21e-10	1.14e-02	NA	NA
5. P	Q8NHY5	Checkpoint protein HUS1B	1.28e-10	7.77e-03	NA	NA
5. P	P32990	Late transcription factor 1	NA	1.16e-03	NA	NA
5. P	O02115	Proliferating cell nuclear antigen	8.42e-13	2.15e-02	NA	NA
5. P	O57198	Late transcription factor 1	NA	1.17e-02	NA	NA
5. P	Q5R7X9	Cell cycle checkpoint protein RAD1	6.05e-13	1.88e-02	NA	NA
5. P	Q57697	DNA polymerase sliding clamp	1.87e-12	3.09e-02	NA	NA
5. P	P68613	Late transcription factor 1	NA	1.76e-02	NA	NA
5. P	P68612	Late transcription factor 1	NA	1.76e-02	NA	NA
5. P	Q9QWZ1	Cell cycle checkpoint protein RAD1	2.30e-12	5.67e-04	NA	NA
5. P	Q84513	Probable DNA polymerase sliding clamp 1	NA	5.87e-03	NA	NA
5. P	O60671	Cell cycle checkpoint protein RAD1	3.21e-12	1.88e-02	NA	NA
6. F	Q4JAI6	DNA polymerase sliding clamp 1	1.24e-11	NA	NA	0.6787
6. F	Q9HJQ0	DNA polymerase sliding clamp	2.80e-14	NA	NA	0.7116
6. F	Q6KZF1	DNA polymerase sliding clamp	1.59e-14	NA	NA	0.7122
6. F	Q4J9A8	DNA polymerase sliding clamp 2	2.79e-12	NA	NA	0.6969
6. F	Q6LWJ8	DNA polymerase sliding clamp	1.45e-12	NA	NA	0.7054
6. F	Q9YFT8	DNA polymerase sliding clamp 1	2.92e-12	NA	NA	0.6832
6. F	A6VHX7	DNA polymerase sliding clamp	1.46e-12	NA	NA	0.706
6. F	Q18E60	DNA polymerase sliding clamp	1.45e-13	NA	NA	0.7437
6. F	Q9MAY3	Proliferating cell nuclear antigen	1.91e-13	NA	NA	0.6832
6. F	Q0W2J4	DNA polymerase sliding clamp	2.90e-14	NA	NA	0.7793
6. F	Q6B6N4	Proliferating cell nuclear antigen	7.38e-13	NA	NA	0.6815
6. F	Q9P9H8	DNA polymerase sliding clamp	1.56e-13	NA	NA	0.742
6. F	Q9HN45	DNA polymerase sliding clamp	1.54e-13	NA	NA	0.7392
6. F	P57761	Proliferating cell nuclear antigen	8.72e-13	NA	NA	0.6915
6. F	A7I849	DNA polymerase sliding clamp	6.03e-13	NA	NA	0.4024
6. F	Q3ZBW4	Proliferating cell nuclear antigen	1.58e-12	NA	NA	0.6898
6. F	P61258	Proliferating cell nuclear antigen	1.39e-12	NA	NA	0.6939
6. F	Q8PX25	DNA polymerase sliding clamp	5.20e-14	NA	NA	0.7109
6. F	Q12U18	DNA polymerase sliding clamp	1.61e-13	NA	NA	0.4079
6. F	O82134	Proliferating cell nuclear antigen	1.93e-13	NA	NA	0.6981
6. F	Q755A0	DNA damage checkpoint protein 1	1.05e-03	NA	NA	0.2709
6. F	Q46E39	DNA polymerase sliding clamp	1.42e-13	NA	NA	0.7093
6. F	O73947	DNA polymerase sliding clamp	3.05e-12	NA	NA	0.4385
6. F	Q9DEA3	Proliferating cell nuclear antigen	1.21e-12	NA	NA	0.6747
6. F	Q43124	Proliferating cell nuclear antigen	1.74e-13	NA	NA	0.7073
6. F	Q979S2	DNA polymerase sliding clamp	1.62e-14	NA	NA	0.7121
6. F	A6UQZ4	DNA polymerase sliding clamp	1.31e-12	NA	NA	0.706
6. F	B0R7F7	DNA polymerase sliding clamp	1.61e-13	NA	NA	0.7393
6. F	A0B7Y8	DNA polymerase sliding clamp	9.27e-14	NA	NA	0.7077
6. F	Q9W644	Proliferating cell nuclear antigen	7.24e-13	NA	NA	0.6763
6. F	Q2FNX1	DNA polymerase sliding clamp	2.25e-12	NA	NA	0.7418
6. F	P18248	Proliferating cell nuclear antigen	4.79e-12	NA	NA	0.6721
6. F	O01377	Proliferating cell nuclear antigen	2.31e-13	NA	NA	0.6874
6. F	Q3IU15	DNA polymerase sliding clamp	1.58e-13	NA	NA	0.4032
6. F	A4G0K8	DNA polymerase sliding clamp	1.50e-12	NA	NA	0.6967
6. F	A5UMB4	DNA polymerase sliding clamp	5.34e-13	NA	NA	0.745
6. F	O27367	DNA polymerase sliding clamp	6.22e-13	NA	NA	0.7455
6. F	A9A8V2	DNA polymerase sliding clamp	1.42e-12	NA	NA	0.7057
6. F	Q758W7	DNA damage checkpoint control protein RAD17	5.33e-07	NA	NA	0.4759
6. F	A6UUW0	DNA polymerase sliding clamp	1.95e-12	NA	NA	0.7324
6. F	Q00265	Proliferating cell nuclear antigen large form	1.89e-08	NA	NA	0.6743
6. F	B9LU30	DNA polymerase sliding clamp	1.61e-13	NA	NA	0.4076
6. F	P53358	Proliferating cell nuclear antigen	3.47e-12	NA	NA	0.6678
6. F	Q8TUF7	DNA polymerase sliding clamp	7.06e-14	NA	NA	0.4081
6. F	A9A2X4	DNA polymerase sliding clamp	2.07e-13	NA	NA	0.7342
6. F	P57765	DNA polymerase sliding clamp 3	6.76e-12	NA	NA	0.4148
6. F	B8GG80	DNA polymerase sliding clamp	9.45e-14	NA	NA	0.3984
6. F	A3CVJ2	DNA polymerase sliding clamp	3.96e-13	NA	NA	0.745
6. F	Q00268	Proliferating cell nuclear antigen	2.10e-13	NA	NA	0.7023