Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54572.1
JCVISYN3A_0004

16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
M. mycoides homolog: Q6MUM4.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.

Statistics

Total GO Annotation: 59
Unique PROST Go: 12
Unique BLAST Go: 0
Unique Foldseek Go: 22

Total Homologs: 1248
Unique PROST Homologs: 236
Unique BLAST Homologs: 11
Unique Foldseek Homologs: 278

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: ksgA; ribosomal RNA small subunit methyltransferase A
Zhang et al. [4]: GO:0052908|16S rRNA (adenine(1518)-N(6)/a denine(1519)-N(6))-dimethyltra nsferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q65UX3 (Ribosomal RNA small subunit methyltransferase A) with a FATCAT P-Value: 0 and RMSD of 1.67 angstrom. The sequence alignment identity is 32.0%.
Structural alignment shown in left. Query protein AVX54572.1 colored as red in alignment, homolog Q65UX3 colored as blue. Query protein AVX54572.1 is also shown in right top, homolog Q65UX3 showed in right bottom. They are colored based on secondary structures. 

  AVX54572.1 M--K------AKKYYGQNFISDLNLINKIVDVLDQNKDQLIIEIGPGKGALTKELVKRFDKVVVIEIDKDMVEILK-TKFNHSNLEIIQADVLEIDLKQL 91
      Q65UX3 MNSKRHLGHTARKRFGQNFLHDDNVIQGIVAAIYPQKGQFLVEIGPGLGALTEPVADQTDRLTVVELDRDLAQRLRHHPFLHQKLNVIETDAMQFDFGKL 100

  AVX54572.1 -----ISKYDYKNISIISNTPYYITSEILFKTLQISDLLTKAVFMLQKEVALRICSNKNENNYNNLSIACQFYSQRNFEFV-VNKKMFYPIPKVDSAIIS 185
      Q65UX3 YEDEHLAEQGQK-LRVFGNLPYNISTPLIFHLLKFYDKIQDMHFMLQKEVVKRLCAAPNSKAYGRLTIMTQYFCQV-MPVLEVPPTAFKPAPKVDSAVVR 198

  AVX54572.1 LTFNDIYKKQVNNDKKFIDFV-RL---LFNNKRKTILNNLNNIIQNKNKALEYLNTLNISSNLRPEQLDI-DQYIKLFN-LIYNSNF------------- 266
      Q65UX3 L----IPHKELPHPVKDLYWLNRVTSQAFNQRRKTLRNALSTLF-----TPEQLTALNIDLTARAENLSIAD-YARLANWLADNPPADVRRDEIIEENEE 288

  AVX54572.1  266
      Q65UX3  288

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0003723 RNA binding
1. PBF GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity
1. PBF GO:0034246 mitochondrial transcription factor activity
1. PBF GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
1. PBF GO:0052909 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity
1. PBF GO:0005634 nucleus
1. PBF GO:0052910 23S rRNA (adenine(2085)-N(6))-dimethyltransferase activity
1. PBF GO:0005737 cytoplasm
1. PBF GO:0000154 rRNA modification
1. PBF GO:0006391 transcription initiation from mitochondrial promoter
1. PBF GO:0046677 response to antibiotic
1. PBF GO:2000234 positive regulation of rRNA processing
1. PBF GO:0030688 preribosome, small subunit precursor
1. PBF GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PBF GO:0031167 rRNA methylation
2. PF GO:0032259 methylation
2. PF GO:0008168 methyltransferase activity
4. PB GO:0016430 tRNA (adenine-N6-)-methyltransferase activity
4. PB GO:0019843 rRNA binding
4. PB GO:0016422 mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity
4. PB GO:0042645 mitochondrial nucleoid
4. PB GO:0102130 malonyl-CoA methyltransferase activity
4. PB GO:0010340 carboxyl-O-methyltransferase activity
4. PB GO:0005759 mitochondrial matrix
4. PB GO:0006390 mitochondrial transcription
5. P GO:0030798 trans-aconitate 2-methyltransferase activity
5. P GO:0032786 positive regulation of DNA-templated transcription, elongation
5. P GO:0006718 juvenile hormone biosynthetic process
5. P GO:0034245 mitochondrial DNA-directed RNA polymerase complex
5. P GO:0046547 trans-aconitate 3-methyltransferase activity
5. P GO:1903109 positive regulation of mitochondrial transcription
5. P GO:0016429 tRNA (adenine-N1-)-methyltransferase activity
5. P GO:0009102 biotin biosynthetic process
5. P GO:0003712 transcription coregulator activity
5. P GO:0035049 juvenile hormone acid methyltransferase activity
5. P GO:0019010 farnesoic acid O-methyltransferase activity
5. P GO:0003676 nucleic acid binding
6. F GO:0003677 DNA binding
6. F GO:0006744 ubiquinone biosynthetic process
6. F GO:0043776 cobalt-precorrin-6B C5-methyltransferase activity
6. F GO:0008689 3-demethylubiquinone-9 3-O-methyltransferase activity
6. F GO:0030697 S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity
6. F GO:0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
6. F GO:0030651 peptide antibiotic biosynthetic process
6. F GO:0008173 RNA methyltransferase activity
6. F GO:0051539 4 iron, 4 sulfur cluster binding
6. F GO:0070475 rRNA base methylation
6. F GO:0006396 RNA processing
6. F GO:0070832 phosphatidylcholine biosynthesis from phosphoryl-ethanolamine via N-dimethylethanolamine phosphate and CDP-choline
6. F GO:0030091 protein repair
6. F GO:0102208 2-polyprenyl-6-hydroxyphenol methylase activity
6. F GO:0008425 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
6. F GO:0005506 iron ion binding
6. F GO:0008276 protein methyltransferase activity
6. F GO:0000234 phosphoethanolamine N-methyltransferase activity
6. F GO:0044550 secondary metabolite biosynthetic process
6. F GO:0106370 protein-L-histidine N-pros-methyltransferase activity
6. F GO:0046140 corrin biosynthetic process
6. F GO:0070041 rRNA (uridine-C5-)-methyltransferase activity

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0003723 RNA binding
GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity
GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0005737 cytoplasm
GO:0000154 rRNA modification
GO:0008649 rRNA methyltransferase activity
GO:0008168 methyltransferase activity
GO:0006364 rRNA processing
GO:0032259 methylation
GO:0031167 rRNA methylation
GO:0016433 rRNA (adenine) methyltransferase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q8UGD5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.52e-35 1.03e-29 0.8893
1. PBF Q251W8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.14e-61 9.97e-41 0.9278
1. PBF A7MIA7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.61e-57 7.98e-46 0.9066
1. PBF B0CL06 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.44e-39 3.52e-31 0.8666
1. PBF A8GPG7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.06e-50 8.42e-41 0.8915
1. PBF A6UP00 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 2.40e-62 9.24e-24 0.8368
1. PBF Q5NMX2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 7.22e-36 0.8428
1. PBF B9K8F0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.15e-57 1.04e-33 0.8452
1. PBF Q660T2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-39 4.07e-28 0.8686
1. PBF Q5V588 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.05e-36 2.18e-27 0.8559
1. PBF Q2IFT9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.23e-51 1.66e-38 0.888
1. PBF A1UL32 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.80e-45 7.55e-31 0.8854
1. PBF B6EL48 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.24e-59 5.79e-42 0.8755
1. PBF Q8PU18 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.11e-54 1.14e-31 0.8553
1. PBF Q2RXA9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.00e-34 2.33e-25 0.8538
1. PBF A1R4F7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.32e-36 4.74e-22 0.891
1. PBF Q5FH30 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.28e-54 8.60e-29 0.9082
1. PBF Q48VC6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.04e-46 1.58e-44 0.9299
1. PBF A5GTK9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.08e-65 2.15e-30 0.8622
1. PBF A4YT90 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.65e-41 3.17e-27 0.8762
1. PBF B5YZ89 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.13e-57 1.24e-44 0.9046
1. PBF B0CC89 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.51e-67 8.23e-40 0.8786
1. PBF B0TV52 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.34e-57 1.50e-51 0.9168
1. PBF B5Y1Z4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.69e-57 1.63e-46 0.9195
1. PBF Q5F9W4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.87e-64 3.04e-43 0.9279
1. PBF C1CA29 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.24e-57 3.64e-47 0.9169
1. PBF Q8EU92 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.17e-51 3.58e-40 0.9142
1. PBF P0DF13 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.22e-53 4.38e-45 0.9169
1. PBF B2UVG9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-61 3.84e-20 0.8227
1. PBF Q92QZ1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.99e-38 2.40e-31 0.878
1. PBF Q7MP86 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.06e-59 1.08e-42 0.89
1. PBF Q3SGF7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.37e-60 3.29e-34 0.9167
1. PBF Q0I5C3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-61 7.66e-40 0.9048
1. PBF Q2KXA2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-61 4.65e-43 0.905
1. PBF Q7NJ41 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.93e-54 2.78e-32 0.8581
1. PBF A2SC77 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.98e-59 9.80e-31 0.8816
1. PBF Q8G6I3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 1.15e-24 0.8767
1. PBF P45439 rRNA adenine N-6-methyltransferase 0.00e+00 2.15e-16 6.16e-17 0.7531
1. PBF P09891 rRNA adenine N-6-methyltransferase 0.00e+00 3.31e-18 3.65e-25 0.7153
1. PBF B5E2H6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-57 4.91e-47 0.9167
1. PBF Q9PBJ6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.23e-54 1.46e-49 0.9074
1. PBF Q6YPJ4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.19e-74 2.85e-45 0.8926
1. PBF Q9CLL5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.86e-62 7.33e-45 0.9067
1. PBF A5U153 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 0.8979
1. PBF B2A3L9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.11e-50 1.32e-43 0.9138
1. PBF A4T6P3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.23e-40 8.80e-28 0.8892
1. PBF Q88QT6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.77e-58 1.99e-50 0.8932
1. PBF A8MK56 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.61e-55 3.94e-50 0.9362
1. PBF Q2YN15 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8568
1. PBF P66663 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9421
1. PBF A3N5X6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.49e-50 7.28e-34 0.8794
1. PBF Q12K59 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.45e-60 4.29e-49 0.8941
1. PBF P59157 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.55e-70 1.65e-30 0.9038
1. PBF B8DGN7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.16e-54 3.23e-52 0.9103
1. PBF Q87C85 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.74e-55 1.70e-49 0.9158
1. PBF Q9V1P8 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.87e-53 4.14e-34 0.8481
1. PBF B9E8V8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.80e-52 5.06e-46 0.9386
1. PBF Q5QVN7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.76e-50 6.59e-45 0.9102
1. PBF A1WVT7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.92e-64 8.09e-40 0.9167
1. PBF Q9K3R5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.61e-42 7.97e-26 0.8814
1. PBF Q2JVW2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.19e-59 1.47e-29 0.8828
1. PBF Q1QKW0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-43 2.53e-28 0.8621
1. PBF Q8PP25 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.78e-55 1.41e-51 0.9103
1. PBF A2BWR2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.64e-69 8.35e-26 0.8526
1. PBF B0URM7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-61 7.66e-40 0.9045
1. PBF A3D188 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.70e-59 7.52e-46 0.9144
1. PBF Q03HF6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.88e-55 1.04e-48 0.9046
1. PBF B6J641 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.28e-64 1.52e-44 0.9355
1. PBF Q5XDX4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.35e-54 2.20e-44 0.9211
1. PBF B2RHC2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.63e-61 2.00e-44 0.8745
1. PBF Q466S6 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 5.08e-47 6.06e-31 0.8183
1. PBF A6T4I7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.11e-58 6.00e-45 0.9201
1. PBF Q5SM60 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.71e-47 3.49e-28 0.8942
1. PBF Q4ZMG5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.37e-61 5.02e-48 0.92
1. PBF B5RGC2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9049
1. PBF B1XIV9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.34e-65 1.70e-34 0.8821
1. PBF Q46L58 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.34e-59 3.49e-28 0.8226
1. PBF P21236 rRNA adenine N-6-methyltransferase 0.00e+00 8.64e-61 1.17e-08 0.8481
1. PBF B7J2F3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.66e-39 2.12e-29 0.8706
1. PBF C0QFJ2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.22e-57 1.22e-32 0.8959
1. PBF A1KHE8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 0.8926
1. PBF Q6N5B4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.69e-44 6.77e-27 0.8783
1. PBF Q135P2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-45 7.21e-27 0.8928
1. PBF Q5HBC6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.79e-55 3.75e-29 0.9086
1. PBF Q7UIR4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.59e-52 2.14e-24 0.9195
1. PBF A0R8B4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-57 1.60e-44 0.9244
1. PBF Q326I2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9061
1. PBF A9KL97 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.56e-55 8.32e-46 0.9302
1. PBF A9A0E0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.36e-57 2.90e-35 0.9361
1. PBF Q6G052 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.60e-40 1.28e-26 0.8811
1. PBF A5FS52 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.45e-48 1.13e-40 0.9233
1. PBF P13079 rRNA methyltransferase 0.00e+00 2.86e-22 2.04e-17 0.7468
1. PBF B2SDQ1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.99e-62 2.11e-42 0.8618
1. PBF P02979 rRNA adenine N-6-methyltransferase 0.00e+00 1.77e-58 1.76e-13 0.7801
1. PBF A1V727 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8852
1. PBF A6U7I6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.56e-37 5.29e-31 0.8726
1. PBF A7ZHE4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.93e-58 8.45e-45 0.9221
1. PBF Q0BC07 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.62e-53 8.78e-35 0.8588
1. PBF B2SPT3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.87e-55 9.74e-52 0.907
1. PBF B3EIC2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.09e-57 3.88e-44 0.8583
1. PBF C0RI23 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8551
1. PBF C4L9L4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.98e-60 7.04e-42 0.8877
1. PBF Q8ZIK5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-60 1.54e-40 0.922
1. PBF Q0KEA7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.45e-62 1.13e-35 0.8462
1. PBF Q73NS2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.46e-42 5.86e-28 0.8916
1. PBF Q9PK40 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.60e-55 3.65e-38 0.918
1. PBF Q5LHC9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.50e-65 1.64e-43 0.8788
1. PBF Q9K0B7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.02e-65 2.14e-43 0.92
1. PBF Q4FT44 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-52 6.55e-44 0.8925
1. PBF A7FMC1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.10e-60 2.39e-40 0.9185
1. PBF Q04II4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.73e-57 1.61e-47 0.9183
1. PBF B4RJV5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.49e-64 1.60e-43 0.9271
1. PBF Q6AL71 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.05e-55 1.07e-31 0.8971
1. PBF Q7T0W5 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 2.80e-26 2.39e-22 0.8831
1. PBF A8FRV2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.50e-60 1.79e-52 0.9136
1. PBF Q8XHG8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.29e-58 3.00e-39 0.9406
1. PBF Q5R4V9 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 7.17e-25 1.17e-18 0.8892
1. PBF Q81W00 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9236
1. PBF Q65UX3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.75e-59 7.46e-43 0.9153
1. PBF P57241 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.96e-63 8.01e-33 0.898
1. PBF Q89MU0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-41 1.31e-26 0.883
1. PBF A5IQ45 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9419
1. PBF Q5GWB9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.87e-55 9.74e-52 0.9073
1. PBF Q39W34 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.36e-64 8.62e-53 0.9479
1. PBF A1RRK0 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 3.61e-50 8.28e-28 0.8854
1. PBF Q92F79 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.28e-56 4.70e-51 0.9273
1. PBF A1TEH3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.87e-42 8.87e-28 0.8986
1. PBF Q7VGZ3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.20e-58 8.74e-29 0.867
1. PBF Q83MG8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.07e-57 3.16e-44 0.9221
1. PBF A5FLP4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.18e-67 2.65e-41 0.8491
1. PBF Q48NT7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.54e-60 3.80e-48 0.9219
1. PBF B9IZC4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9247
1. PBF P59156 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.04e-57 1.01e-44 0.9206
1. PBF Q0TMD6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.29e-58 3.00e-39 0.9406
1. PBF Q47VJ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.65e-45 3.63e-43 0.8731
1. PBF Q2FJE9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9424
1. PBF Q6ADP1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.63e-40 9.70e-17 0.846
1. PBF Q03VR7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.23e-50 9.67e-45 0.8788
1. PBF Q8XA14 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.13e-57 1.24e-44 0.9223
1. PBF Q223E6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.34e-61 9.19e-42 0.8376
1. PBF B4UDZ6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.74e-53 1.70e-38 0.9014
1. PBF B0BTQ4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-58 1.49e-48 0.9165
1. PBF A6UTZ1 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 3.36e-60 8.87e-32 0.8493
1. PBF C1A383 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.30e-30 2.59e-32 0.8575
1. PBF Q2KA84 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-42 2.37e-28 0.8707
1. PBF P59155 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.07e-51 1.61e-46 0.9183
1. PBF A1JJF4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.40e-62 9.48e-39 0.9222
1. PBF Q3M3F3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.30e-62 5.04e-34 0.8966
1. PBF Q14IY7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.66e-62 2.66e-41 0.8585
1. PBF Q8ZTJ4 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.18e-41 1.70e-27 0.8911
1. PBF A0QBW0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.61e-37 8.96e-29 0.8984
1. PBF Q2A218 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.99e-62 2.11e-42 0.8614
1. PBF Q8FL96 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.9203
1. PBF Q5E865 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.00e-59 3.04e-41 0.8808
1. PBF Q3A8X5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.23e-52 8.10e-45 0.887
1. PBF Q5PDD9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9198
1. PBF C4ZPX7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9064
1. PBF Q0HS06 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.92e-58 4.92e-49 0.902
1. PBF A7ZGB4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.73e-63 1.69e-36 0.8797
1. PBF Q9Z6K0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.98e-53 1.99e-36 0.8924
1. PBF B8EB35 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.70e-59 7.52e-46 0.9143
1. PBF P10738 rRNA adenine N-6-methyltransferase 0.00e+00 1.82e-59 5.61e-10 0.8212
1. PBF A4FY32 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 3.75e-67 1.14e-27 0.8707
1. PBF Q4K4X5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.20e-59 9.81e-49 0.9065
1. PBF Q6C7H6 Dimethyladenosine transferase 0.00e+00 1.12e-28 1.32e-21 0.8478
1. PBF C3KXY4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.94e-62 5.45e-43 0.9417
1. PBF Q1QZ31 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.14e-42 1.67e-50 0.9278
1. PBF B4TWT6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.57e-57 4.12e-45 0.92
1. PBF Q64Y97 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.50e-65 1.64e-43 0.8777
1. PBF A8GXS7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.17e-49 2.57e-41 0.8934
1. PBF Q3K5T2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.88e-59 1.04e-46 0.9191
1. PBF Q1IZ94 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.96e-50 5.34e-37 0.8758
1. PBF B1I8T7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-57 4.91e-47 0.9168
1. PBF A2BR00 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.16e-68 1.81e-26 0.8748
1. PBF Q07LF4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.11e-39 5.17e-29 0.8917
1. PBF Q72B41 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.73e-59 2.11e-38 0.8654
1. PBF Q4QMZ9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.30e-57 1.63e-43 0.9107
1. PBF Q2YBP5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.23e-59 1.05e-44 0.8786
1. PBF B7JWJ7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.28e-67 1.04e-39 0.911
1. PBF Q17ZF9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.08e-64 4.57e-19 0.8199
1. PBF Q0BKP7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.99e-62 2.11e-42 0.8611
1. PBF Q67JB9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.21e-52 2.67e-44 0.9252
1. PBF A3MZB7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-58 9.92e-49 0.9186
1. PBF B2AH89 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.63e-63 1.95e-35 0.8584
1. PBF Q3AKE0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.21e-69 1.26e-27 0.8958
1. PBF Q8TQU8 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 7.99e-57 7.06e-31 0.8257
1. PBF A3CQN5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.75e-56 5.44e-48 0.9244
1. PBF B3PLS2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.20e-70 2.42e-36 0.9196
1. PBF A5VI09 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.62e-53 1.28e-55 0.9378
1. PBF B4TJ47 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9222
1. PBF Q6KH80 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.23e-74 5.53e-46 0.9237
1. PBF B1HS82 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.03e-56 8.90e-45 0.9363
1. PBF Q1B416 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.09e-46 5.15e-30 0.9032
1. PBF Q21MT0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.92e-44 2.37e-48 0.8804
1. PBF Q0SQ34 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.29e-58 3.00e-39 0.9409
1. PBF B6JGM4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.31e-45 2.46e-25 0.8943
1. PBF Q1C0H5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-60 1.54e-40 0.9223
1. PBF Q57E58 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.29e-39 9.03e-32 0.8854
1. PBF Q3J2B9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.16e-40 3.79e-28 0.8808
1. PBF Q5YPY6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.92e-36 6.66e-31 0.8443
1. PBF A5IME8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.16e-55 2.03e-31 0.8486
1. PBF Q8Z9J7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9061
1. PBF B7VIE2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.48e-58 1.56e-43 0.9012
1. PBF P16898 rRNA adenine N-6-methyltransferase 9.66e-15 5.02e-48 1.91e-19 0.7976
1. PBF C1AM01 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 0.8922
1. PBF A5F8N2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.04e-62 1.04e-43 0.8896
1. PBF Q2GGH6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.93e-54 1.42e-30 0.8889
1. PBF A1U6F8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.96e-58 2.93e-52 0.8872
1. PBF Q83AC2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.72e-64 2.26e-44 0.934
1. PBF Q5ZRF4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.62e-56 8.54e-44 0.8831
1. PBF A9L438 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.75e-59 1.11e-45 0.9145
1. PBF Q2TBQ0 Mitochondrial dimethyladenosine transferase 1 0.00e+00 3.06e-26 1.41e-19 0.8876
1. PBF Q1MR01 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.10e-60 7.47e-36 0.8796
1. PBF A0KGT8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.14e-59 2.53e-43 0.9085
1. PBF P0A0H1 rRNA adenine N-6-methyltransferase 0.00e+00 2.67e-58 3.75e-14 0.8196
1. PBF Q97EX0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.24e-57 4.51e-40 0.9474
1. PBF Q3IFD1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.78e-55 5.33e-42 0.9084
1. PBF Q2YVV2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.51e-52 1.79e-39 0.9404
1. PBF Q9JVC2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.76e-65 3.77e-43 0.9196
1. PBF Q984S7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.01e-37 5.78e-31 0.8966
1. PBF C5CS95 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.40e-57 8.25e-43 0.8703
1. PBF B1JKY3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.10e-60 2.39e-40 0.9199
1. PBF Q8E3D7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.73e-55 1.32e-43 0.9381
1. PBF Q2FSA9 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.52e-58 1.87e-31 0.848
1. PBF B7N7S6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.89e-56 8.45e-45 0.9255
1. PBF Q8KA00 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.41e-63 2.96e-34 0.8938
1. PBF A5VPL7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8638
1. PBF C3M9C2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.32e-45 2.53e-33 0.8879
1. PBF Q823V2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.85e-54 3.62e-41 0.9011
1. PBF A4IJB8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.30e-55 1.07e-46 0.9223
1. PBF A3MNW4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8871
1. PBF Q4FMR0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.00e-59 1.93e-29 0.9019
1. PBF B4T6L6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.20e-57 4.79e-45 0.9224
1. PBF C1F127 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.05e-52 2.37e-42 0.928
1. PBF Q11UL8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.46e-60 6.02e-34 0.8575
1. PBF B6JNS3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.27e-61 1.09e-19 0.8172
1. PBF A7ZW03 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9222
1. PBF Q253R6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.24e-46 4.94e-43 0.9015
1. PBF A9MA55 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8677
1. PBF Q5GSM9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.58e-54 7.03e-33 0.9086
1. PBF Q11HG9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.46e-43 7.27e-30 0.8708
1. PBF Q121Q5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.63e-21 1.69e-27 0.8217
1. PBF Q741W2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.27e-36 5.00e-29 0.8963
1. PBF Q1ILA1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.62e-55 4.81e-48 0.9083
1. PBF B4RBS4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.58e-47 1.63e-26 0.8691
1. PBF A1RMU8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.63e-57 8.19e-46 0.9137
1. PBF O25972 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.43e-63 5.06e-20 0.8308
1. PBF Q9A7N5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.82e-53 3.58e-29 0.9049
1. PBF A9AFE4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.31e-54 3.63e-35 0.87
1. PBF Q28RD6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.52e-45 2.53e-25 0.9042
1. PBF Q04C60 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.80e-40 9.68e-44 0.921
1. PBF A6TYW7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9428
1. PBF A1A3W3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.88e-36 6.62e-26 0.838
1. PBF B0R506 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.58e-44 1.11e-28 0.8348
1. PBF A9M352 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.13e-65 3.01e-43 0.9195
1. PBF Q6F8A0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.09e-49 1.47e-44 0.8772
1. PBF B1LVB8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.23e-45 8.25e-30 0.8759
1. PBF B3H0R3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.58e-60 4.32e-48 0.9164
1. PBF Q88A46 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.85e-60 8.70e-48 0.8943
1. PBF B1VUF9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.93e-41 4.10e-26 0.8728
1. PBF B5Z950 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.18e-62 8.32e-19 0.8161
1. PBF P43433 Mycinamicin-resistance protein MyrB 0.00e+00 4.93e-30 2.19e-14 0.7437
1. PBF Q7NC69 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.65e-54 3.59e-31 0.8698
1. PBF P59524 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-60 1.04e-36 0.8878
1. PBF Q0TLT6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.9201
1. PBF Q9KUS2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.04e-62 1.04e-43 0.8828
1. PBF Q3IPM0 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 4.60e-40 7.32e-29 0.8584
1. PBF Q7P1U1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.70e-63 4.89e-44 0.928
1. PBF Q8KE87 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.67e-56 5.05e-40 0.8388
1. PBF Q2NE42 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.02e-52 1.12e-22 0.8246
1. PBF Q1CMT2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-60 1.54e-40 0.9187
1. PBF A7IJ80 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.26e-39 3.12e-31 0.893
1. PBF P0A4D6 rRNA adenine N-6-methyltransferase 0.00e+00 2.22e-60 2.29e-09 0.8412
1. PBF A6L1N4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.96e-58 1.10e-43 0.8818
1. PBF Q164G1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.30e-42 2.49e-24 0.8877
1. PBF Q74LI0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.97e-42 6.91e-43 0.9108
1. PBF C1KYC1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-54 1.11e-51 0.9082
1. PBF Q8A0H8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.14e-64 3.34e-44 0.8717
1. PBF A9N9I7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.42e-64 1.31e-43 0.9316
1. PBF O05952 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.06e-48 6.64e-38 0.8922
1. PBF Q8YS62 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.49e-64 4.77e-38 0.8939
1. PBF Q837A7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.36e-53 1.39e-46 0.9233
1. PBF B4EBE8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.93e-54 3.44e-35 0.8682
1. PBF B8CSX5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.81e-60 7.82e-50 0.9169
1. PBF Q6MQ47 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.78e-53 1.28e-30 0.8555
1. PBF Q8EB93 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.96e-57 4.09e-49 0.9003
1. PBF B5R1S8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.922
1. PBF A7FQA9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.79e-61 3.39e-41 0.9423
1. PBF A6SV13 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.69e-57 1.46e-38 0.9285
1. PBF Q8TH24 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.67e-56 6.73e-31 0.8159
1. PBF Q2G9Z2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.85e-44 1.43e-27 0.8688
1. PBF Q2GK91 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.01e-59 2.44e-27 0.899
1. PBF Q1DAP2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.03e-60 2.57e-40 0.9249
1. PBF A9I5F2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.27e-58 1.22e-38 0.908
1. PBF Q7WG20 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.87e-63 1.81e-40 0.878
1. PBF A1B0G4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.55e-44 2.99e-31 0.8815
1. PBF Q8PCE3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.67e-56 4.65e-51 0.9059
1. PBF Q5HS85 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.15e-71 6.80e-39 0.8958
1. PBF Q3BX82 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.92e-54 1.25e-52 0.9063
1. PBF B4S787 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.27e-58 7.10e-39 0.8638
1. PBF B7J3R3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.93e-61 4.77e-42 0.8795
1. PBF Q9PLW7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.57e-72 1.29e-38 0.8948
1. PBF Q9HQH1 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.58e-44 1.11e-28 0.8451
1. PBF B5FI34 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.92
1. PBF Q88Z93 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.20e-53 2.12e-44 0.9332
1. PBF Q9PPN8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.98e-55 2.53e-46 0.9079
1. PBF A4Y435 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.63e-57 8.19e-46 0.9014
1. PBF Q479U6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.31e-54 3.19e-41 0.9237
1. PBF A3PJZ3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.70e-40 7.71e-28 0.8804
1. PBF Q9KGK4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.66e-52 1.33e-52 0.9205
1. PBF P9WH06 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 0.8946
1. PBF A5IIC0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.09e-56 3.39e-44 0.8836
1. PBF A7GJV3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.95e-58 8.11e-42 0.9252
1. PBF Q07YJ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.34e-57 7.73e-48 0.9121
1. PBF Q145L1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.39e-51 1.58e-38 0.8825
1. PBF C0M8P2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.86e-55 4.00e-47 0.9311
1. PBF C1FQ40 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.76e-63 2.52e-42 0.942
1. PBF Q03986 rRNA adenine N-6-methyltransferase 0.00e+00 3.33e-51 5.54e-20 0.8123
1. PBF Q8DXR8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-55 1.11e-43 0.9376
1. PBF P10337 rRNA adenine N-6-methyltransferase 0.00e+00 4.97e-60 9.14e-11 0.7696
1. PBF B2S4U1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8707
1. PBF Q215S4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.42e-43 2.16e-27 0.8861
1. PBF B7GPE3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.02e-40 2.47e-24 0.8734
1. PBF B7NHF7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9062
1. PBF C0R5G4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.80e-60 1.21e-34 0.9051
1. PBF Q8TWU7 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 9.51e-56 5.80e-34 0.8569
1. PBF B9JUV4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.04e-39 1.73e-31 0.8767
1. PBF P66662 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9418
1. PBF Q3ZZE6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.09e-48 4.41e-41 0.924
1. PBF Q30NR7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.84e-66 7.64e-35 0.872
1. PBF B0RUI3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.04e-57 5.41e-51 0.906
1. PBF B1IRC5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9222
1. PBF B1JY71 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.58e-54 8.57e-35 0.8685
1. PBF Q5HII3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9415
1. PBF A4QCP0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.95e-45 1.80e-34 0.8579
1. PBF Q3JZA5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.36e-56 4.09e-43 0.9097
1. PBF B2IM67 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.34e-57 7.79e-47 0.9366
1. PBF Q7W4J6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.78e-64 3.81e-41 0.878
1. PBF Q2IX80 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.76e-46 1.49e-26 0.8815
1. PBF Q66EQ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.10e-60 2.39e-40 0.919
1. PBF Q6NIA2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.92e-44 6.89e-32 0.8793
1. PBF A9AAW1 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 7.44e-67 1.47e-28 0.8692
1. PBF B1YWD5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.52e-50 1.26e-34 0.8855
1. PBF P06571 rRNA adenine N-6-methyltransferase 0.00e+00 1.05e-61 4.04e-14 0.8027
1. PBF A1STS1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.45e-61 1.87e-40 0.8882
1. PBF Q1WV73 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.19e-47 2.64e-51 0.9379
1. PBF Q1RK29 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.88e-49 2.49e-41 0.8904
1. PBF C4K4K9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.74e-62 2.16e-35 0.8552
1. PBF C1CTN9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.45e-57 1.63e-46 0.937
1. PBF Q2T114 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.86e-54 1.32e-33 0.8729
1. PBF A8HVI9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.79e-39 8.12e-28 0.8871
1. PBF A7MWC6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.49e-59 6.34e-41 0.8775
1. PBF Q87ST6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.89e-57 1.57e-40 0.8767
1. PBF Q5M2L6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.39e-58 1.63e-48 0.9303
1. PBF A6WK59 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.75e-59 1.11e-45 0.9139
1. PBF Q2KHT8 Probable dimethyladenosine transferase 0.00e+00 1.44e-26 1.84e-21 0.8438
1. PBF A0LR93 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.17e-36 1.44e-26 0.8484
1. PBF Q1A705 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 8.69e-23 1.22e-23 0.8252
1. PBF B1LBH5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.04e-56 1.04e-31 0.8482
1. PBF B9KST5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.24e-41 3.86e-29 0.881
1. PBF Q03IR2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.18e-57 2.04e-47 0.9352
1. PBF B9DLD0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.54e-57 3.81e-42 0.9378
1. PBF Q6GJH8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.41e-52 6.27e-39 0.9398
1. PBF Q5FU61 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.51e-17 1.08e-24 0.8886
1. PBF Q8YAE2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.49e-54 2.24e-51 0.9104
1. PBF O84358 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.53e-55 2.26e-35 0.9211
1. PBF Q8DED2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.06e-59 1.08e-42 0.8898
1. PBF B1LFY7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9204
1. PBF Q3JVW6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8856
1. PBF Q3A3G8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.75e-67 1.43e-41 0.9189
1. PBF A3Q5I0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.80e-45 7.55e-31 0.9013
1. PBF C1CGR5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.02e-57 9.54e-47 0.9158
1. PBF A0KAD1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.58e-54 8.57e-35 0.8689
1. PBF O67680 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.17e-62 4.52e-23 0.9204
1. PBF Q6G438 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.91e-43 4.25e-26 0.881
1. PBF Q04720 rRNA adenine N-6-methyltransferase 0.00e+00 4.24e-51 5.11e-20 0.8093
1. PBF C1D9C2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.74e-62 5.17e-41 0.9193
1. PBF Q1GZB8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.76e-63 5.55e-38 0.9243
1. PBF Q4A645 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.95e-71 1.85e-52 0.9247
1. PBF Q38V22 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.04e-57 3.13e-52 0.939
1. PBF A9MQG2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.15e-58 2.14e-45 0.92
1. PBF Q3SRZ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.87e-43 6.98e-28 0.8679
1. PBF A9VN54 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.63e-57 2.13e-45 0.9236
1. PBF C6A222 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 3.42e-55 2.51e-30 0.8398
1. PBF A1WS95 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.01e-54 8.11e-38 0.8432
1. PBF Q5WSM3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.87e-57 8.49e-45 0.8848
1. PBF Q5FMG3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.51e-41 1.55e-40 0.877
1. PBF Q932G1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9424
1. PBF A4TQD8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-60 1.54e-40 0.9184
1. PBF A1VUN7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.41e-59 2.56e-35 0.8651
1. PBF Q68W66 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.16e-48 8.02e-40 0.8906
1. PBF Q2NZI4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.87e-55 9.74e-52 0.9072
1. PBF B8FY38 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.14e-61 9.97e-41 0.9203
1. PBF B6YTK7 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.24e-58 8.76e-34 0.8096
1. PBF A9B9Y0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.15e-60 2.71e-28 0.8935
1. PBF Q6LYK4 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 2.96e-62 8.14e-28 0.8524
1. PBF B9MIF6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.05e-60 6.53e-42 0.873
1. PBF P0DF12 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.22e-53 4.38e-45 0.9179
1. PBF Q1JNI8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.46e-47 2.25e-44 0.8972
1. PBF B7HIK9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.89e-57 4.36e-44 0.9246
1. PBF Q8NRY1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.21e-44 8.50e-34 0.8924
1. PBF Q9ZJI7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.53e-62 4.13e-20 0.8286
1. PBF Q31F24 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.20e-61 5.88e-43 0.9202
1. PBF B7L4H4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.91e-58 4.41e-44 0.9224
1. PBF Q2PG46 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 2.30e-26 4.97e-21 0.8882
1. PBF A8ALP9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.43e-56 3.08e-45 0.9064
1. PBF Q5JI54 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 5.39e-52 7.21e-30 0.833
1. PBF Q2RME8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.47e-53 2.65e-48 0.9267
1. PBF Q65PH9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.09e-55 2.39e-47 0.9391
1. PBF Q4JU23 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.95e-37 3.21e-29 0.8806
1. PBF Q2NIH8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.00e-75 6.57e-45 0.9036
1. PBF B2VGP6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.05e-60 1.87e-41 0.9172
1. PBF B3PUU6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-39 1.49e-29 0.8718
1. PBF Q5PAV9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.03e-55 5.31e-22 0.8934
1. PBF B2V963 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-62 4.12e-44 0.9309
1. PBF C5A594 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 4.18e-55 2.46e-31 0.8523
1. PBF Q9RED9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.25e-55 4.93e-30 0.9163
1. PBF A4JHP7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.74e-54 4.31e-32 0.8626
1. PBF A6LF39 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.76e-62 9.62e-43 0.8704
1. PBF A8H0V2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.40e-59 7.81e-51 0.9149
1. PBF Q9CD52 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.71e-41 1.51e-26 0.8765
1. PBF A1WD86 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.59e-61 8.63e-42 0.8729
1. PBF Q5L6H5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.20e-53 9.38e-39 0.9085
1. PBF B5FGG5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.00e-59 3.04e-41 0.8773
1. PBF Q1BTQ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.58e-54 8.57e-35 0.8664
1. PBF Q4L3F0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.31e-54 1.73e-45 0.9427
1. PBF A5GLH7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.70e-63 1.26e-23 0.8765
1. PBF Q2JMR8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.89e-57 6.66e-29 0.8894
1. PBF B7MAH6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.9064
1. PBF B1WRJ7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.62e-66 9.11e-36 0.8858
1. PBF Q1RGE6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.9063
1. PBF P0A4D5 rRNA adenine N-6-methyltransferase 0.00e+00 2.22e-60 2.29e-09 0.8156
1. PBF B9DVT4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.51e-56 1.50e-45 0.9326
1. PBF Q97NN5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.45e-57 1.63e-46 0.9254
1. PBF B2K487 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.10e-60 2.39e-40 0.9189
1. PBF Q00014 rRNA adenine N-6-methyltransferase 0.00e+00 1.01e-58 2.28e-13 0.7437
1. PBF Q5LY12 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.07e-57 2.09e-48 0.932
1. PBF Q5N2S8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.12e-65 4.72e-33 0.8811
1. PBF O83357 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.21e-47 1.96e-27 0.885
1. PBF B7UI99 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.9221
1. PBF A6QEE6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.44e-52 3.61e-39 0.936
1. PBF Q3Z9F0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.98e-49 1.14e-42 0.9213
1. PBF P47701 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.72e-65 9.53e-29 0.8774
1. PBF B0TZ54 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.00e-64 1.72e-42 0.8885
1. PBF B9KIG4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.03e-55 5.31e-22 0.899
1. PBF Q2S9C3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.47e-54 2.29e-52 0.915
1. PBF B4U0U9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.65e-55 9.65e-47 0.9319
1. PBF A3NRM0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.49e-50 7.28e-34 0.8794
1. PBF Q4UR39 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.67e-56 4.65e-51 0.9062
1. PBF A7NDV3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.99e-62 2.11e-42 0.9057
1. PBF Q3B3D4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.11e-60 3.27e-43 0.8554
1. PBF P75113 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.23e-65 8.35e-25 0.8554
1. PBF Q75C90 Dimethyladenosine transferase 0.00e+00 4.67e-28 5.02e-19 0.8519
1. PBF C4K2J5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.24e-31 5.56e-35 0.8813
1. PBF Q57TH0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.32e-57 8.98e-46 0.9202
1. PBF B4F2I2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.53e-57 8.34e-43 0.9044
1. PBF Q1JIN6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.04e-46 1.58e-44 0.9321
1. PBF Q30ZP0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.57e-49 4.35e-30 0.8498
1. PBF Q3Z5V8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9048
1. PBF C5D363 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.38e-56 1.38e-44 0.9404
1. PBF B2JCX3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.01e-52 8.67e-37 0.8729
1. PBF Q1GI39 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.95e-46 3.88e-30 0.8966
1. PBF C0QUE5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.69e-65 1.73e-38 0.8755
1. PBF A4G256 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.01e-54 8.30e-39 0.9143
1. PBF Q2S0I2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.35e-34 1.10e-43 0.8635
1. PBF A5UH57 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.63e-58 6.02e-44 0.901
1. PBF A0RRT6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.73e-66 7.98e-34 0.8914
1. PBF B7LVU5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 5.64e-44 0.9047
1. PBF Q6LV41 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.07e-57 2.11e-43 0.8926
1. PBF P72666 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.50e-55 4.26e-37 0.8415
1. PBF B6HZ32 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.07e-57 2.61e-44 0.8875
1. PBF C3PPC3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.71e-32 5.73e-34 0.8746
1. PBF A6W6U4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.16e-42 4.12e-25 0.8799
1. PBF Q2GE45 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.47e-62 6.80e-28 0.8951
1. PBF Q9CHN8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.42e-50 5.18e-49 0.9316
1. PBF B7ISV1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.89e-57 4.36e-44 0.9251
1. PBF A6VFS2 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.08e-64 9.92e-28 0.8686
1. PBF B5F771 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9201
1. PBF B3CPY6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.04e-58 9.44e-32 0.8897
1. PBF A0L064 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.34e-57 1.23e-48 0.9005
1. PBF Q98RJ3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.53e-72 1.20e-51 0.8954
1. PBF Q2W0V3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.87e-40 1.43e-27 0.8784
1. PBF Q02607 rRNA adenine N-6-methyltransferase 0.00e+00 5.24e-60 1.24e-10 0.7793
1. PBF A3QBA3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.82e-60 1.40e-52 0.9153
1. PBF C1ESX0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-57 1.60e-44 0.9241
1. PBF Q1LRA1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.30e-62 6.69e-37 0.8602
1. PBF B3Q9S4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.69e-44 6.77e-27 0.8964
1. PBF P44749 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.88e-58 6.69e-44 0.9013
1. PBF B7MNR0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.77e-58 1.81e-44 0.922
1. PBF A6VU53 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.32e-55 6.65e-57 0.9117
1. PBF C6BSW3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.07e-59 6.63e-34 0.8608
1. PBF C0Q5E7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9048
1. PBF B5ZCB6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.30e-57 2.82e-45 0.9213
1. PBF Q5LQN0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.71e-43 1.15e-26 0.8534
1. PBF Q7VU11 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.06e-63 1.93e-40 0.8624
1. PBF P13957 rRNA adenine N-6-methyltransferase 0.00e+00 3.46e-58 1.93e-12 0.7779
1. PBF Q4A775 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.74e-71 2.01e-42 0.923
1. PBF Q6GBZ5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9419
1. PBF B1AJP2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.98e-55 2.53e-46 0.908
1. PBF Q7MXN7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.63e-61 2.00e-44 0.876
1. PBF Q5NHI5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.66e-62 2.66e-41 0.8605
1. PBF Q56016 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.18e-57 2.63e-45 0.9225
1. PBF Q724M5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-54 1.11e-51 0.9098
1. PBF A8G9P0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.30e-62 1.70e-40 0.9034
1. PBF Q9A1I0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.63e-54 1.47e-44 0.9102
1. PBF A8EZN3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.70e-47 4.11e-41 0.8881
1. PBF C1AXY5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.50e-33 7.19e-30 0.8443
1. PBF B2G5I8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.62e-53 1.28e-55 0.9365
1. PBF A8YX55 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.82e-42 7.58e-42 0.8966
1. PBF B3EQT0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.84e-56 7.87e-38 0.863
1. PBF B8ZU59 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.71e-41 1.51e-26 0.8868
1. PBF Q1MJ01 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.14e-42 2.73e-31 0.8709
1. PBF Q31RH6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.12e-65 4.72e-33 0.8826
1. PBF B0B7S3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.53e-55 2.26e-35 0.9211
1. PBF Q2LSQ6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.87e-58 5.82e-43 0.9329
1. PBF Q8YG94 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.24e-40 1.22e-30 0.8583
1. PBF Q63HJ1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9233
1. PBF A3PCS3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.25e-68 1.56e-27 0.8692
1. PBF B8J7H0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.74e-53 1.70e-38 0.9027
1. PBF Q5ZZN4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.32e-66 4.78e-43 0.9273
1. PBF Q82HC3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.01e-44 1.77e-25 0.8528
1. PBF Q92GV0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.20e-32 8.38e-34 0.8846
1. PBF B2SX63 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.14e-48 1.31e-38 0.8813
1. PBF P0A0H3 rRNA adenine N-6-methyltransferase 0.00e+00 2.67e-58 3.75e-14 0.7757
1. PBF Q3AXF3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-65 3.33e-31 0.8826
1. PBF B1ID54 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.17e-61 1.24e-39 0.9435
1. PBF A4WRK3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.21e-42 8.09e-30 0.87
1. PBF P78697 Dimethyladenosine transferase 0.00e+00 1.75e-26 4.70e-20 0.8572
1. PBF A6TJK9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.23e-53 9.13e-51 0.9468
1. PBF Q3ARC0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.59e-57 2.97e-44 0.8725
1. PBF A0Q5E0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.88e-62 1.43e-42 0.863
1. PBF A8GT85 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-30 3.57e-35 0.8845
1. PBF Q8RDC8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.24e-67 1.08e-43 0.9454
1. PBF A0JU87 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.03e-35 2.06e-20 0.8565
1. PBF P13978 rRNA adenine N-6-methyltransferase 0.00e+00 1.73e-58 7.12e-13 0.7737
1. PBF Q3KM04 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.53e-55 2.26e-35 0.9211
1. PBF Q1JDL6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.46e-47 2.25e-44 0.9037
1. PBF Q1AXL9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.71e-56 7.58e-33 0.8746
1. PBF Q18GB5 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.82e-25 2.13e-29 0.8541
1. PBF Q5L3V8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.65e-53 2.74e-51 0.9249
1. PBF Q6HPX5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9258
1. PBF Q3JAF3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.08e-55 2.48e-37 0.9215
1. PBF Q72GC7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.81e-48 2.80e-28 0.8934
1. PBF Q1GBR1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.80e-40 9.68e-44 0.9099
1. PBF B1ZW80 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.50e-48 1.16e-22 0.8245
1. PBF Q7U7D3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.46e-41 1.76e-25 0.8704
1. PBF B2J0A6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.97e-65 3.08e-32 0.894
1. PBF A4W6F7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.15e-56 9.37e-46 0.9151
1. PBF Q0VMV2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.38e-56 3.87e-50 0.8964
1. PBF B5EL84 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.85e-61 4.84e-42 0.896
1. PBF Q1QAR8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.67e-52 2.35e-44 0.9
1. PBF C0MF36 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.65e-55 9.65e-47 0.9309
1. PBF B1KRY8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.61e-62 8.67e-41 0.9451
1. PBF Q8CQU5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.86e-51 1.35e-42 0.9339
1. PBF Q5HRR2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.86e-51 1.35e-42 0.938
1. PBF Q6ME80 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.62e-46 4.04e-37 0.9204
1. PBF Q6MUM4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.22e-108 2.59e-161 0.9936
1. PBF Q0AGQ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.04e-62 1.71e-28 0.8827
1. PBF O51536 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.66e-39 2.12e-29 0.8792
1. PBF B7HPV2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9229
1. PBF Q49V02 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.07e-53 6.89e-47 0.9413
1. PBF Q493R7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.56e-55 1.55e-34 0.8701
1. PBF Q0S4T6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.72e-33 2.22e-30 0.8249
1. PBF B8ZNY9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.45e-57 1.63e-46 0.9254
1. PBF A1US65 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.86e-41 4.42e-29 0.8824
1. PBF Q95KJ0 Probable dimethyladenosine transferase 0.00e+00 1.95e-27 2.02e-22 0.8583
1. PBF Q7VCH7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.14e-64 2.36e-22 0.8705
1. PBF A7WYP0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9425
1. PBF P13956 rRNA adenine N-6-methyltransferase 0.00e+00 1.56e-58 9.96e-13 0.7493
1. PBF B2S2T4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.21e-47 1.96e-27 0.8792
1. PBF Q60B77 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.03e-58 3.12e-41 0.8805
1. PBF Q1CRJ9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.21e-63 3.37e-20 0.8311
1. PBF A8LI73 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.20e-42 2.14e-32 0.8828
1. PBF Q5P7J1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.07e-60 2.86e-45 0.8885
1. PBF Q31B19 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.73e-68 1.53e-26 0.8713
1. PBF C3LJ13 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9238
1. PBF A8Z0Y8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 0.9416
1. PBF Q7VM33 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.93e-61 8.27e-44 0.9121
1. PBF B0BBY8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.53e-55 2.26e-35 0.9031
1. PBF Q73FG7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9236
1. PBF A2S8N7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8871
1. PBF Q12XH7 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 2.50e-56 2.06e-25 0.8362
1. PBF Q7V7W0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.02e-64 1.78e-27 0.8948
1. PBF A1A7A0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.82e-57 1.13e-44 0.922
1. PBF A7G9I5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.69e-61 4.21e-40 0.9419
1. PBF Q8G1N0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.26e-39 2.94e-31 0.8667
1. PBF B4U9C8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.84e-64 1.19e-33 0.8596
1. PBF P0A0H2 rRNA adenine N-6-methyltransferase 0.00e+00 2.67e-58 3.75e-14 0.8219
1. PBF A8F909 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.81e-54 1.14e-56 0.9436
1. PBF A9MYM4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9221
1. PBF B1N079 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.94e-51 1.35e-48 0.8893
1. PBF A1BFM9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.59e-60 1.26e-46 0.8422
1. PBF B3QMU5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.86e-56 1.53e-39 0.8341
1. PBF Q6BSY5 Dimethyladenosine transferase 0.00e+00 4.53e-24 3.21e-19 0.8684
1. PBF Q73IR3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.78e-46 3.68e-35 0.9068
1. PBF Q2N8W9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.48e-44 1.10e-33 0.8622
1. PBF Q62MM2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8852
1. PBF Q0AQC3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.22e-47 5.39e-32 0.8786
1. PBF Q0SMR8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.80e-40 2.41e-28 0.8845
1. PBF C1CMT3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.09e-58 2.86e-48 0.926
1. PBF Q8P2N8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.35e-54 1.12e-44 0.9176
1. PBF A4IZF1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.99e-62 2.11e-42 0.862
1. PBF A5EIA8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.53e-41 2.92e-27 0.8766
1. PBF A1S9G5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 7.89e-46 0.9101
1. PBF A6GVR5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.45e-62 1.13e-38 0.8719
1. PBF Q63X76 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-52 1.14e-34 0.8858
1. PBF B7JK47 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.925
1. PBF Q9YEM5 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 1.22e-33 1.34e-15 0.7891
1. PBF A1KSW0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.37e-65 2.38e-43 0.9192
1. PBF C3P9I6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.18e-57 6.71e-45 0.9243
1. PBF C6DEY6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.09e-57 1.08e-42 0.9025
1. PBF Q9RU68 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.01e-33 5.98e-35 0.9082
1. PBF O59487 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 5.94e-55 3.72e-35 0.8444
1. PBF Q8Y219 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.47e-56 1.26e-33 0.8699
1. PBF A7GVW6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.22e-56 1.07e-30 0.8692
1. PBF A9QZZ0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.35e-60 1.54e-40 0.9189
1. PBF Q4UMV1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.61e-25 1.87e-36 0.89
1. PBF Q8D3I1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.97e-70 3.74e-20 0.8903
1. PBF Q6GKQ0 rRNA adenine N-6-methyltransferase 0.00e+00 2.67e-58 3.75e-14 0.8073
1. PBF Q39D37 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.43e-53 5.10e-35 0.8695
1. PBF O27381 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 2.14e-46 6.30e-23 0.8379
1. PBF Q04DR8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.03e-54 4.05e-39 0.8838
1. PBF B8D0I2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.62e-53 1.04e-46 0.9204
1. PBF Q6F2B4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.26e-77 6.59e-107 0.9734
1. PBF B2U259 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.04e-57 6.41e-44 0.9066
1. PBF Q4A936 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.29e-70 4.34e-41 0.9227
1. PBF Q0HLT2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.47e-58 1.64e-48 0.9164
1. PBF Q181C1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.53e-55 4.41e-48 0.9473
1. PBF P07287 rRNA adenine N-6-methyltransferase 2.22e-16 1.07e-04 1.38e-22 0.7391
1. PBF Q32K43 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.37e-59 5.07e-44 0.9066
1. PBF Q03T56 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.55e-52 3.08e-52 0.9301
1. PBF A5D673 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.22e-55 3.31e-40 0.9102
1. PBF Q7V1E1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.37e-68 1.90e-25 0.8678
1. PBF B5BL27 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.93e-57 3.29e-45 0.9061
1. PBF Q6D0E0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.95e-60 6.58e-42 0.9128
1. PBF Q8R6B1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.55e-71 3.21e-56 0.9092
1. PBF B3DP38 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.60e-40 3.00e-24 0.8638
1. PBF A1VD65 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.60e-59 1.09e-38 0.8828
1. PBF Q1J8J4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.09e-46 1.76e-44 0.9076
1. PBF A5U9U3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.63e-58 6.02e-44 0.9012
1. PBF Q3YS70 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.21e-55 4.86e-33 0.9041
1. PBF Q47SX4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.33e-39 1.25e-26 0.8366
1. PBF Q0I9S3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.05e-66 4.39e-24 0.8785
1. PBF A8EQW4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.67e-70 1.10e-35 0.8875
1. PBF A8G4P1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.44e-66 1.94e-25 0.8773
1. PBF A5EY68 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.73e-66 7.55e-35 0.8515
1. PBF P37468 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.29e-55 2.67e-51 0.9513
1. PBF Q8FQZ5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.24e-43 1.79e-34 0.863
1. PBF Q82W15 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.64e-61 2.39e-37 0.8947
1. PBF A0AEZ3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.82e-54 1.19e-51 0.9107
1. PBF A6X265 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.03e-41 3.38e-30 0.8619
1. PBF B1XC52 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9065
1. PBF Q6AAD7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.80e-45 9.38e-20 0.8943
1. PBF Q2LZ79 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 1.95e-25 3.69e-18 0.9049
1. PBF Q9X1F1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 8.21e-33 4.89e-31 0.8287
1. PBF Q7N8V7 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.01e-58 3.10e-45 0.9209
1. PBF A2C1Z5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 6.65e-59 7.92e-29 0.8132
1. PBF A2CA51 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.37e-64 1.09e-26 0.8843
1. PBF Q28HM1 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 2.65e-26 3.63e-22 0.8942
1. PBF B1Y7L9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.74e-52 2.34e-39 0.8516
1. PBF P20173 rRNA adenine N-6-methyltransferase 0.00e+00 6.13e-60 2.42e-09 0.8513
1. PBF A8AUQ4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.65e-56 1.13e-48 0.9255
1. PBF Q1GT31 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.44e-45 2.32e-28 0.8513
1. PBF B7GFH0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.05e-56 2.16e-44 0.9295
1. PBF A1TWF5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.15e-57 2.36e-39 0.8835
1. PBF Q7VQK3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 9.02e-64 1.19e-34 0.8864
1. PBF Q6FKY3 Dimethyladenosine transferase 0.00e+00 3.30e-33 9.24e-20 0.8565
1. PBF A0LA32 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.29e-53 1.15e-36 0.9299
1. PBF Q81JA5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 5.89e-57 4.36e-44 0.9258
1. PBF B1KGH9 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.07e-57 4.72e-50 0.9163
1. PBF Q5WLW2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.80e-52 6.44e-50 0.931
1. PBF Q2NVX6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 7.74e-60 1.79e-45 0.904
1. PBF A9IRW8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.40e-40 1.56e-27 0.8768
1. PBF B6J3A6 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.72e-64 2.26e-44 0.9338
1. PBF B5ZWD8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.18e-42 2.59e-30 0.8704
1. PBF P43038 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.10e-112 1.37e-161 0.9935
1. PBF Q1LSS2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.49e-64 8.57e-40 0.902
1. PBF B7M0E8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.9064
1. PBF B1V9I5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.40e-62 2.37e-40 0.9192
1. PBF A7I417 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.46e-72 2.06e-38 0.8818
1. PBF G0SEH7 Dimethyladenosine transferase 4.18e-12 1.78e-12 2.17e-22 0.8666
1. PBF P45438 rRNA adenine N-6-methyltransferase 0.00e+00 1.17e-50 2.67e-19 0.8103
1. PBF Q8DND3 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.73e-57 1.61e-47 0.9159
1. PBF Q0T8E4 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 0.922
1. PBF P66661 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 0.8918
1. PBF P06573 rRNA adenine N-6-methyltransferase 0.00e+00 1.75e-60 5.59e-09 0.8513
1. PBF P06572 rRNA adenine N-6-methyltransferase 0.00e+00 5.85e-59 1.62e-12 0.796
1. PBF A9KGZ8 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.77e-64 7.04e-44 0.935
1. PBF A2RCH2 Ribosomal RNA small subunit methyltransferase A 0.00e+00 4.35e-54 2.20e-44 0.9289
1. PBF Q74C12 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.41e-64 4.56e-45 0.9406
1. PBF Q475Q1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.08e-64 1.16e-34 0.8513
1. PBF Q9I5U5 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.65e-55 1.48e-50 0.9224
1. PBF Q5X0V1 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.09e-56 3.39e-44 0.8845
2. PF Q9Y829 Mitochondrial transcription factor 1 1.28e-14 5.71e-20 NA 0.7881
3. BF P65347 Uncharacterized methyltransferase Mb0092 1.80e-04 NA 8.24e-04 0.5806
3. BF E1W218 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.08e-06 NA 0.030 0.6168
3. BF P9WK02 Uncharacterized methyltransferase MT0098 5.34e-04 NA 8.24e-04 0.7004
4. PB O65090 Ribosomal RNA small subunit methyltransferase, chloroplastic 0.00e+00 4.84e-07 4.66e-33 NA
4. PB Q9D0D4 Probable dimethyladenosine transferase 0.00e+00 8.47e-26 3.21e-21 NA
4. PB Q7MNQ4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.09e-07 2.46e-05 0.005 NA
4. PB Q9VAQ5 Probable dimethyladenosine transferase 0.00e+00 2.61e-37 1.32e-19 NA
4. PB O28491 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 9.44e-52 8.49e-25 NA
4. PB Q54QK7 Probable dimethyladenosine transferase 0.00e+00 2.60e-33 1.07e-25 NA
4. PB P9WH07 Ribosomal RNA small subunit methyltransferase A 0.00e+00 1.83e-38 5.41e-27 NA
4. PB Q9UNQ2 Probable dimethyladenosine transferase 0.00e+00 8.83e-27 1.11e-21 NA
4. PB P06992 Ribosomal RNA small subunit methyltransferase A 0.00e+00 2.48e-57 2.47e-44 NA
4. PB Q811P6 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 1.69e-24 2.63e-19 NA
4. PB P91424 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 5.77e-24 2.26e-12 NA
4. PB Q8WVM0 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 9.25e-26 2.04e-20 NA
4. PB Q09522 Probable dimethyladenosine transferase 0.00e+00 7.40e-32 1.71e-19 NA
4. PB D5DIV9 Malonyl-[acyl-carrier protein] O-methyltransferase 1.23e-03 2.46e-02 9.37e-05 NA
4. PB Q87SB8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.34e-07 7.68e-06 0.026 NA
4. PB Q9USU2 Dimethyladenosine transferase 0.00e+00 4.82e-32 6.81e-22 NA
4. PB Q5U2T7 Dimethyladenosine transferase 2, mitochondrial 1.11e-14 4.37e-09 0.010 NA
4. PB Q9VTM5 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 3.23e-26 3.78e-20 NA
4. PB Q58435 Probable ribosomal RNA small subunit methyltransferase A 0.00e+00 5.35e-58 6.24e-33 NA
4. PB O22268 Ribosomal RNA small subunit methyltransferase 0.00e+00 3.47e-20 5.58e-27 NA
4. PB Q32LD4 Dimethyladenosine transferase 2, mitochondrial 5.33e-15 3.30e-07 3.24e-07 NA
4. PB A3DBD7 Malonyl-[acyl-carrier protein] O-methyltransferase 1.91e-03 1.29e-03 2.96e-06 NA
4. PB Q9FK02 Ribosomal RNA small subunit methyltransferase, mitochondrial 0.00e+00 3.46e-11 4.54e-30 NA
4. PB P41819 Dimethyladenosine transferase 0.00e+00 1.63e-26 8.86e-19 NA
4. PB Q2G0T0 Ribosomal RNA small subunit methyltransferase A 0.00e+00 3.00e-52 1.79e-39 NA
4. PB Q8JZM0 Dimethyladenosine transferase 1, mitochondrial 0.00e+00 2.56e-23 1.64e-20 NA
5. P A6V4P3 Trans-aconitate 2-methyltransferase 3.60e-03 2.94e-02 NA NA
5. P B8E5T2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.01e-07 2.45e-06 NA NA
5. P B9JBE6 Trans-aconitate 2-methyltransferase 4.96e-03 7.09e-04 NA NA
5. P B7MIR0 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.05e-06 3.75e-04 NA NA
5. P Q8A7S9 Malonyl-[acyl-carrier protein] O-methyltransferase 8.86e-05 9.65e-03 NA NA
5. P Q3IG80 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.21e-06 3.71e-04 NA NA
5. P A9M6C1 Trans-aconitate 2-methyltransferase 4.65e-03 4.08e-04 NA NA
5. P A7FGU8 Trans-aconitate 2-methyltransferase 4.64e-03 1.12e-04 NA NA
5. P A3QAZ2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.08e-06 1.02e-04 NA NA
5. P Q8XA22 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.81e-07 2.35e-04 NA NA
5. P A8H0P3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.68e-05 1.83e-03 NA NA
5. P B4F055 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.03e-06 2.74e-03 NA NA
5. P C1AJX2 Trans-aconitate 2-methyltransferase 4.55e-03 1.57e-05 NA NA
5. P C5CSI6 Trans-aconitate 2-methyltransferase 9.10e-03 5.31e-04 NA NA
5. P B1IVQ2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.98e-07 5.67e-04 NA NA
5. P B9MBN9 Trans-aconitate 2-methyltransferase 6.66e-03 4.85e-05 NA NA
5. P A8FRM9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.75e-07 1.31e-05 NA NA
5. P Q82HD9 Trans-aconitate 2-methyltransferase 7.41e-03 3.01e-05 NA NA
5. P B1LP88 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.06e-06 5.67e-04 NA NA
5. P C6Y2G0 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.65e-05 7.21e-05 NA NA
5. P Q02N15 Trans-aconitate 2-methyltransferase 7.38e-03 3.80e-02 NA NA
5. P C6CB42 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.04e-06 2.08e-04 NA NA
5. P B5XQT8 Trans-aconitate 2-methyltransferase 3.37e-03 3.82e-04 NA NA
5. P A1KFB7 Trans-aconitate 2-methyltransferase 3.72e-03 1.57e-05 NA NA
5. P B6I5E9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.01e-06 5.72e-04 NA NA
5. P Q15NR8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.38e-04 1.15e-03 NA NA
5. P P44702 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.68e-07 1.53e-05 NA NA
5. P B1KF36 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.91e-06 1.73e-06 NA NA
5. P Q9US51 Mitochondrial transcription factor 1 8.18e-14 1.04e-17 NA NA
5. P A1T273 Trans-aconitate 2-methyltransferase 3.36e-03 8.78e-04 NA NA
5. P A1JU33 Trans-aconitate 2-methyltransferase 4.32e-03 2.44e-04 NA NA
5. P B3H2W9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.76e-08 2.09e-05 NA NA
5. P Q5PNB8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.11e-06 9.39e-05 NA NA
5. P B7UH15 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.05e-06 3.75e-04 NA NA
5. P B6IAS2 Trans-aconitate 2-methyltransferase 3.12e-03 4.66e-05 NA NA
5. P B3PTJ5 Trans-aconitate 2-methyltransferase 4.97e-03 9.12e-05 NA NA
5. P C6DC08 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.94e-07 4.01e-04 NA NA
5. P Q8XAZ2 Trans-aconitate 2-methyltransferase 3.21e-03 1.75e-04 NA NA
5. P C3M8G8 Trans-aconitate 2-methyltransferase 7.15e-03 6.28e-04 NA NA
5. P B2VI36 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.04e-06 8.69e-06 NA NA
5. P B7LZC1 Trans-aconitate 2-methyltransferase 3.84e-03 6.53e-05 NA NA
5. P A5FKD7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.10e-06 5.15e-05 NA NA
5. P Q4QNC1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 5.25e-07 1.04e-06 NA NA
5. P Q0T1T1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.06e-06 5.72e-04 NA NA
5. P B5Z149 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.64e-07 3.35e-04 NA NA
5. P Q0T4L2 Trans-aconitate 2-methyltransferase 3.40e-03 9.77e-05 NA NA
5. P P14908 Mitochondrial transcription factor 1 3.11e-15 1.53e-19 NA NA
5. P P47490 Putative tRNA methyltransferase MG248 3.95e-06 3.49e-05 NA NA
5. P Q119M4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.51e-07 1.18e-05 NA NA
5. P Q8Z4J9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.08e-06 2.61e-04 NA NA
5. P B7NIJ1 Trans-aconitate 2-methyltransferase 3.16e-03 9.67e-05 NA NA
5. P B1LXF6 Trans-aconitate 2-methyltransferase 3.17e-03 2.77e-04 NA NA
5. P B7LRD2 Trans-aconitate 2-methyltransferase 3.67e-03 3.78e-05 NA NA
5. P C5BAI6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.10e-07 5.31e-05 NA NA
5. P A6TCI9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.35e-06 8.60e-06 NA NA
5. P A1S987 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.07e-07 1.36e-04 NA NA
5. P Q9VH38 Dimethyladenosine transferase 2, mitochondrial 2.93e-10 1.73e-07 NA NA
5. P Q6N3T8 Trans-aconitate 2-methyltransferase 4.35e-03 5.01e-03 NA NA
5. P C6CWS7 Malonyl-[acyl-carrier protein] O-methyltransferase 7.90e-03 1.34e-03 NA NA
5. P P54471 tRNA (adenine(22)-N(1))-methyltransferase 1.07e-04 5.67e-03 NA NA
5. P B0TUD3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.26e-07 7.87e-05 NA NA
5. P A8GI34 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.19e-06 4.51e-03 NA NA
5. P Q133R5 Trans-aconitate 2-methyltransferase 4.40e-03 3.61e-04 NA NA
5. P B5XNG1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.29e-06 3.13e-06 NA NA
5. P Q2KAZ5 Trans-aconitate 2-methyltransferase 5.26e-03 5.21e-04 NA NA
5. P C6AQR4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.16e-06 1.70e-04 NA NA
5. P C6CNL2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.40e-06 2.04e-04 NA NA
5. P Q1CHU7 Trans-aconitate 2-methyltransferase 4.32e-03 1.01e-04 NA NA
5. P B7MYK8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.09e-06 3.51e-04 NA NA
5. P Q9VJK8 Juvenile hormone acid O-methyltransferase 3.52e-03 2.33e-04 NA NA
5. P Q98K73 Trans-aconitate 2-methyltransferase 4.63e-03 3.67e-05 NA NA
5. P A1AB99 Trans-aconitate 2-methyltransferase 3.24e-03 1.76e-04 NA NA
5. P Q1R8F7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.08e-06 3.75e-04 NA NA
5. P B2K7X9 Trans-aconitate 2-methyltransferase 4.53e-03 1.01e-04 NA NA
5. P Q0THR9 Trans-aconitate 2-methyltransferase 2.74e-03 5.47e-05 NA NA
5. P Q8ZDP7 Trans-aconitate 2-methyltransferase 4.70e-03 1.01e-04 NA NA
5. P A9MGW2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.56e-07 7.07e-05 NA NA
5. P B6EMW5 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.18e-07 2.05e-05 NA NA
5. P Q8FF14 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.07e-06 3.75e-04 NA NA
5. P A0LXM6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.38e-07 2.79e-07 NA NA
5. P Q57L59 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.11e-05 6.82e-03 NA NA
5. P A9N0W9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.09e-06 9.39e-05 NA NA
5. P A0A1X9WEP1 Nocamycin O-methyltransferase 3.59e-03 1.43e-03 NA NA
5. P B7N4U4 Trans-aconitate 2-methyltransferase 3.21e-03 6.79e-05 NA NA
5. P Q1BF27 Trans-aconitate 2-methyltransferase 3.76e-03 6.78e-06 NA NA
5. P Q087P4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.67e-07 1.11e-05 NA NA
5. P O74529 Uncharacterized methyltransferase C70.08c 1.61e-03 5.93e-03 NA NA
5. P C6X2D2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.34e-07 1.10e-03 NA NA
5. P Q6LUN9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.87e-07 1.13e-04 NA NA
5. P Q1C564 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.27e-06 2.46e-02 NA NA
5. P P87250 Mitochondrial transcription factor 1 3.32e-14 2.20e-19 NA NA
5. P B1LF96 Trans-aconitate 2-methyltransferase 3.43e-03 1.44e-04 NA NA
5. P P76145 Trans-aconitate 2-methyltransferase 3.39e-03 1.31e-04 NA NA
5. P B5F9T8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 5.28e-07 5.20e-05 NA NA
5. P Q2IYT0 Trans-aconitate 2-methyltransferase 4.02e-03 1.17e-02 NA NA
5. P Q9H5Q4 Dimethyladenosine transferase 2, mitochondrial 9.21e-15 2.15e-08 NA NA
5. P B8F678 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.02e-07 4.24e-04 NA NA
5. P A1AEA5 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.10e-06 3.75e-04 NA NA
5. P A3N3J4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.84e-08 1.54e-05 NA NA
5. P C5W7S9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.02e-06 5.67e-04 NA NA
5. P B2HNX5 Trans-aconitate 2-methyltransferase 3.89e-03 3.08e-07 NA NA
5. P P87292 Mitochondrial transcription factor 1 8.66e-15 1.85e-19 NA NA
5. P A8A072 Trans-aconitate 2-methyltransferase 3.20e-03 2.00e-04 NA NA
5. P B3QFV9 Trans-aconitate 2-methyltransferase 4.16e-03 5.01e-03 NA NA
5. P A6WS64 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.42e-07 5.12e-06 NA NA
5. P A1K8U5 Trans-aconitate 2-methyltransferase 3.98e-03 5.43e-03 NA NA
5. P B7NRM8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.00e-06 1.94e-04 NA NA
5. P A4TKY7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.05e-06 2.46e-02 NA NA
5. P A4Y3T4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.51e-07 1.81e-05 NA NA
5. P Q07PZ6 Trans-aconitate 2-methyltransferase 4.88e-03 1.73e-05 NA NA
5. P Q0HM44 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.10e-07 1.23e-06 NA NA
5. P A1TP97 Trans-aconitate 2-methyltransferase 7.80e-03 6.88e-03 NA NA
5. P Q8FZM5 Trans-aconitate 2-methyltransferase 4.60e-03 4.08e-04 NA NA
5. P Q767F1 Juvenile hormone acid O-methyltransferase 3.68e-03 4.36e-04 NA NA
5. P A4WAG4 Trans-aconitate 2-methyltransferase 4.82e-03 9.96e-05 NA NA
5. P Q0HRP2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.59e-07 1.08e-06 NA NA
5. P Q6D211 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.15e-07 3.71e-05 NA NA
5. P B7M8I9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.81e-07 5.72e-04 NA NA
5. P A1RN54 tRNA1(Val) (adenine(37)-N6)-methyltransferase 5.65e-07 1.71e-05 NA NA
5. P P66886 Probable trans-aconitate 2-methyltransferase 4.12e-03 1.57e-05 NA NA
5. P E4TI44 Malonyl-[acyl-carrier protein] O-methyltransferase 1.09e-02 1.95e-03 NA NA
5. P Q3SPQ7 Trans-aconitate 2-methyltransferase 5.05e-03 1.07e-02 NA NA
5. P A6VKA4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.18e-06 1.00e-07 NA NA
5. P B7L7L9 Trans-aconitate 2-methyltransferase 3.81e-03 4.27e-05 NA NA
5. P A0KPC4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.62e-07 9.90e-07 NA NA
5. P Q32CU6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.72e-07 3.86e-04 NA NA
5. P B5ZUL2 Trans-aconitate 2-methyltransferase 5.16e-03 2.86e-05 NA NA
5. P A0PN72 Trans-aconitate 2-methyltransferase 3.17e-03 5.95e-07 NA NA
5. P A9R3Z3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.11e-07 2.46e-02 NA NA
5. P Q8FHF2 Trans-aconitate 2-methyltransferase 2.63e-03 5.36e-05 NA NA
5. P B7GHW9 Malonyl-[acyl-carrier protein] O-methyltransferase 3.52e-03 1.09e-02 NA NA
5. P Q669E2 Trans-aconitate 2-methyltransferase 4.52e-03 1.01e-04 NA NA
5. P A8A386 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.03e-06 5.67e-04 NA NA
5. P Q9CJZ9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.31e-07 3.63e-06 NA NA
5. P B0UPF4 Trans-aconitate 2-methyltransferase 3.86e-03 7.50e-05 NA NA
5. P Q8A9H7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.67e-07 2.89e-05 NA NA
5. P A7FFT0 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.57e-06 2.46e-02 NA NA
5. P B7LDG8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.06e-06 6.00e-04 NA NA
5. P Q8YI91 Trans-aconitate 2-methyltransferase NA 1.98e-04 NA NA
5. P A8AD10 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.09e-06 5.21e-04 NA NA
5. P C4LCN4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.41e-07 7.39e-08 NA NA
5. P A3PTG0 Trans-aconitate 2-methyltransferase 3.76e-03 6.78e-06 NA NA
5. P Q6Q870 N-methyltransferase sirN 3.25e-02 2.79e-02 NA NA
5. P Q8EI95 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.76e-07 1.16e-06 NA NA
5. P B0UWL8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.24e-07 9.86e-05 NA NA
5. P A7GSD9 Malonyl-[acyl-carrier protein] O-methyltransferase 4.21e-03 1.88e-03 NA NA
5. P C0PVY6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.13e-06 7.57e-05 NA NA
5. P B5QTV6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.11e-06 7.00e-05 NA NA
5. P A7MXM2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.03e-07 5.15e-05 NA NA
5. P B1XEA7 Trans-aconitate 2-methyltransferase 3.23e-03 1.31e-04 NA NA
5. P B8CU29 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.99e-07 6.11e-06 NA NA
5. P Q9RX93 Trans-aconitate 2-methyltransferase 3.49e-03 3.82e-04 NA NA
5. P C6UQY1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.74e-07 3.35e-04 NA NA
5. P B7LUY9 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.20e-07 1.27e-03 NA NA
5. P A3D0V3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.59e-07 2.45e-06 NA NA
5. P P75427 Putative tRNA methyltransferase MPN_351 2.13e-05 1.34e-03 NA NA
5. P Q65W50 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.97e-07 3.70e-06 NA NA
5. P C4ZWT6 Trans-aconitate 2-methyltransferase 3.25e-03 1.31e-04 NA NA
5. P A5VRJ7 Trans-aconitate 2-methyltransferase 4.45e-03 4.08e-04 NA NA
5. P A4SRS5 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.47e-07 8.27e-05 NA NA
5. P C6UBI3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.02e-06 5.67e-04 NA NA
5. P B7N6G4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.89e-07 5.67e-04 NA NA
5. P Q11RK8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.66e-05 3.82e-04 NA NA
5. P A7ZQ20 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.28e-07 6.00e-04 NA NA
5. P Q7N1W7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.26e-06 2.59e-05 NA NA
5. P Q92RC5 Trans-aconitate 2-methyltransferase 2.92e-03 1.15e-04 NA NA
5. P A6GWI6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.09e-06 1.06e-05 NA NA
5. P Q3YYU0 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.04e-06 6.00e-04 NA NA
5. P B2TYI8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.07e-06 5.11e-04 NA NA
5. P B2RK25 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.01e-04 1.83e-05 NA NA
5. P Q31XR1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.66e-07 5.11e-04 NA NA
5. P Q8DEQ3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.88e-07 7.14e-05 NA NA
5. P A5UA66 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.92e-07 5.80e-06 NA NA
5. P B7VJ58 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.92e-07 7.57e-05 NA NA
5. P A9L1L1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.02e-06 3.70e-06 NA NA
5. P A0L0I8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.92e-07 5.47e-05 NA NA
5. P P64557 Uncharacterized protein YgfM 3.47e-01 4.30e-02 NA NA
5. P A6U707 Trans-aconitate 2-methyltransferase 7.41e-03 1.26e-05 NA NA
5. P Q1RBP8 Trans-aconitate 2-methyltransferase 3.42e-03 4.81e-05 NA NA
5. P A4T0W0 Trans-aconitate 2-methyltransferase 4.43e-03 8.43e-05 NA NA
5. P Q0TER3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.02e-06 3.31e-04 NA NA
5. P C3LSR6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.98e-07 1.85e-05 NA NA
5. P B6JIA0 Trans-aconitate 2-methyltransferase 2.39e-03 1.13e-02 NA NA
5. P B8ISV4 Trans-aconitate 2-methyltransferase 4.53e-03 1.71e-04 NA NA
5. P Q9KU62 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.85e-07 1.85e-05 NA NA
5. P B5Z1X6 Trans-aconitate 2-methyltransferase 2.57e-03 1.75e-04 NA NA
5. P P9WGA3 Probable trans-aconitate 2-methyltransferase 3.21e-03 1.57e-05 NA NA
5. P A6LD46 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.40e-07 4.31e-05 NA NA
5. P A1JKJ4 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.84e-06 7.29e-04 NA NA
5. P B1IRU1 Trans-aconitate 2-methyltransferase 3.17e-03 1.31e-04 NA NA
5. P Q32G05 Trans-aconitate 2-methyltransferase 2.21e-03 4.62e-05 NA NA
5. P B5BAS2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.10e-06 9.39e-05 NA NA
5. P A6L532 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.27e-07 6.00e-04 NA NA
5. P Q9UTA9 Uncharacterized methyltransferase C25B8.09 1.10e-04 3.68e-03 NA NA
5. P A4TLZ2 Trans-aconitate 2-methyltransferase 4.55e-03 1.01e-04 NA NA
5. P B5RD57 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.12e-06 7.00e-05 NA NA
5. P Q6FDV0 Malonyl-[acyl-carrier protein] O-methyltransferase 2.12e-02 1.21e-02 NA NA
5. P Q8ZMX8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.05e-06 7.57e-05 NA NA
5. P P9WGA2 Probable trans-aconitate 2-methyltransferase 4.43e-03 1.57e-05 NA NA
5. P A1U9V4 Trans-aconitate 2-methyltransferase 3.62e-03 6.78e-06 NA NA
5. P Q749W5 Malonyl-[acyl-carrier protein] O-methyltransferase 3.69e-03 3.09e-02 NA NA
5. P Q1C6F5 Trans-aconitate 2-methyltransferase 4.61e-03 1.01e-04 NA NA
5. P A1W9K6 Trans-aconitate 2-methyltransferase 6.46e-03 9.30e-05 NA NA
5. P Q1QJC0 Trans-aconitate 2-methyltransferase 4.08e-03 1.02e-02 NA NA
5. P P37543 Uncharacterized protein YabB 3.15e-07 1.98e-03 NA NA
5. P B1JHA2 Trans-aconitate 2-methyltransferase 4.45e-03 1.01e-04 NA NA
5. P C4ZYJ8 tRNA1(Val) (adenine(37)-N6)-methyltransferase 8.44e-07 5.67e-04 NA NA
5. P Q7MVG0 tRNA1(Val) (adenine(37)-N6)-methyltransferase 2.27e-06 1.69e-05 NA NA
5. P Q0SED2 Trans-aconitate 2-methyltransferase 4.21e-03 3.42e-05 NA NA
5. P B1XBQ2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.73e-07 5.67e-04 NA NA
5. P Q83QI2 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.06e-06 5.72e-04 NA NA
5. P P31825 tRNA1(Val) (adenine(37)-N6)-methyltransferase 9.51e-07 5.67e-04 NA NA
5. P Q216J6 Trans-aconitate 2-methyltransferase 4.90e-03 8.11e-05 NA NA
5. P Q0I4T7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.73e-07 1.25e-04 NA NA
5. P B7URP6 Trans-aconitate 2-methyltransferase 2.78e-03 6.28e-05 NA NA
5. P Q5LCS1 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.01e-07 2.76e-03 NA NA
5. P Q83RE0 Trans-aconitate 2-methyltransferase 3.06e-03 1.06e-04 NA NA
5. P P64558 Uncharacterized protein YgfM 3.44e-01 4.30e-02 NA NA
5. P B7MMY3 Trans-aconitate 2-methyltransferase 3.51e-03 4.81e-05 NA NA
5. P A4WDE6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.40e-07 5.72e-04 NA NA
5. P Q3TL26 Dimethyladenosine transferase 2, mitochondrial 3.22e-15 2.88e-09 NA NA
5. P C0Z787 Malonyl-[acyl-carrier protein] O-methyltransferase 6.17e-03 8.86e-05 NA NA
5. P A7MH06 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.17e-07 4.38e-06 NA NA
5. P A0QM44 Trans-aconitate 2-methyltransferase 3.46e-03 2.91e-06 NA NA
5. P B0CHP1 Trans-aconitate 2-methyltransferase 4.58e-03 4.08e-04 NA NA
5. P A6WZN1 Trans-aconitate 2-methyltransferase 5.22e-03 1.40e-03 NA NA
5. P Q12R91 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.02e-04 4.40e-04 NA NA
5. P C6VS84 tRNA1(Val) (adenine(37)-N6)-methyltransferase 6.05e-07 1.05e-04 NA NA
5. P A5UGT6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 7.02e-07 2.45e-06 NA NA
5. P Q1CKF3 tRNA1(Val) (adenine(37)-N6)-methyltransferase 1.23e-06 2.46e-02 NA NA
5. P Q64TX7 tRNA1(Val) (adenine(37)-N6)-methyltransferase 4.16e-07 1.22e-03 NA NA
5. P Q5E7Q6 tRNA1(Val) (adenine(37)-N6)-methyltransferase 3.84e-07 5.10e-05 NA NA
5. P Q8UH15 Trans-aconitate 2-methyltransferase 6.68e-03 4.12e-04 NA NA
5. P A5TZ21 Trans-aconitate 2-methyltransferase 3.60e-03 1.57e-05 NA NA
5. P A9R6H5 Trans-aconitate 2-methyltransferase 4.76e-03 1.01e-04 NA NA
5. P A7ZLX5 Trans-aconitate 2-methyltransferase 5.15e-03 6.53e-05 NA NA
6. F Q2FRP5 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase 3.04e-06 NA NA 0.595
6. F B2TUM0 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.06e-05 NA NA 0.5747
6. F Q3J8U2 Ubiquinone biosynthesis O-methyltransferase 3.13e-06 NA NA 0.4691
6. F A1JLA0 Ubiquinone biosynthesis O-methyltransferase 3.57e-06 NA NA 0.4459
6. F P0DG16 Uncharacterized RNA methyltransferase SpyM3_1299 3.37e-06 NA NA 0.6438
6. F B1LLI3 Ubiquinone biosynthesis O-methyltransferase 4.41e-06 NA NA 0.4641
6. F Q9KEF5 Uncharacterized RNA methyltransferase BH0897 7.22e-06 NA NA 0.6778
6. F P0DG17 Uncharacterized RNA methyltransferase SPs0562 5.10e-06 NA NA 0.6427
6. F Q8YR05 Uncharacterized RNA methyltransferase alr3654 9.34e-06 NA NA 0.6563
6. F A8H1S1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.33e-05 NA NA 0.6024
6. F Q6KHE2 Uncharacterized RNA methyltransferase MMOB5020 2.10e-06 NA NA 0.6102
6. F A1T1P0 Uncharacterized methyltransferase Mvan_0241 2.66e-03 NA NA 0.4067
6. F Q8P0H4 Uncharacterized RNA methyltransferase spyM18_1360 1.04e-05 NA NA 0.6242
6. F A7ZP50 Ubiquinone biosynthesis O-methyltransferase 4.35e-06 NA NA 0.4325
6. F Q0TFL0 Ubiquinone biosynthesis O-methyltransferase 4.26e-06 NA NA 0.433
6. F Q8E0T7 Uncharacterized RNA methyltransferase SAG0633 9.11e-06 NA NA 0.6236
6. F Q4ZQ44 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.46e-06 NA NA 0.6414
6. F A9MIM3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.90e-05 NA NA 0.5592
6. F A1JM74 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.96e-05 NA NA 0.5354
6. F Q2SWE9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.91e-05 NA NA 0.6142
6. F B1LN12 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.58e-05 NA NA 0.5539
6. F Q7N839 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.92e-06 NA NA 0.6408
6. F A7MTS9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.39e-06 NA NA 0.6697
6. F Q2A275 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.38e-06 NA NA 0.5957
6. F Q5PGN2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.40e-05 NA NA 0.5599
6. F B7LM95 Ubiquinone biosynthesis O-methyltransferase 3.68e-06 NA NA 0.4388
6. F A0QUV5 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 3.70e-03 NA NA 0.6067
6. F A5F0U5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 3.75e-05 NA NA 0.5016
6. F B1IXV6 Ubiquinone biosynthesis O-methyltransferase 4.36e-06 NA NA 0.4332
6. F Q7VZG7 Ubiquinone biosynthesis O-methyltransferase 6.37e-06 NA NA 0.4472
6. F C4M572 tRNA (guanine(37)-N1)-methyltransferase 4.17e-05 NA NA 0.5334
6. F A3CSX5 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase 2.92e-06 NA NA 0.5646
6. F Q9ALP0 dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase 1.83e-02 NA NA 0.6511
6. F Q92AV4 Uncharacterized RNA methyltransferase lin1815 2.30e-06 NA NA 0.6346
6. F Q9JP88 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 3.24e-06 NA NA 0.5998
6. F Q8ES75 Uncharacterized RNA methyltransferase OB0768 6.70e-06 NA NA 0.6816
6. F Q5PCY1 Ubiquinone biosynthesis O-methyltransferase 4.56e-06 NA NA 0.44
6. F B2K9A4 Ubiquinone biosynthesis O-methyltransferase 2.97e-06 NA NA 0.4367
6. F Q8D4B4 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.66e-06 NA NA 0.5883
6. F Q5ZVI4 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.30e-06 NA NA 0.593
6. F Q66CZ4 Ubiquinone biosynthesis O-methyltransferase 3.30e-06 NA NA 0.4124
6. F B7NPF5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.00e-05 NA NA 0.5753
6. F Q8E6F5 Uncharacterized RNA methyltransferase gbs0613 8.99e-06 NA NA 0.624
6. F B7NAK5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.08e-05 NA NA 0.5259
6. F Q7WGT9 Ubiquinone biosynthesis O-methyltransferase 5.55e-06 NA NA 0.4423
6. F B1X8C6 Ubiquinone biosynthesis O-methyltransferase 3.74e-06 NA NA 0.4633
6. F B5FDT8 Ubiquinone biosynthesis O-methyltransferase 3.40e-06 NA NA 0.4487
6. F Q892Z2 Uncharacterized RNA methyltransferase CTC_01941 2.14e-05 NA NA 0.5741
6. F Q0CCX8 Methyltransferase gedG 9.41e-03 NA NA 0.5466
6. F B1IWR3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.53e-05 NA NA 0.5554
6. F Q88MB9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.42e-06 NA NA 0.5682
6. F Q92AQ7 Uncharacterized RNA methyltransferase lin1863 4.77e-06 NA NA 0.6317
6. F P44643 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.92e-06 NA NA 0.6334
6. F A0Q5J5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.70e-06 NA NA 0.6342
6. F P61820 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 2.13e-08 NA NA 0.6538
6. F A4Y759 Ubiquinone biosynthesis O-methyltransferase 3.21e-06 NA NA 0.4273
6. F Q62JV9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.91e-05 NA NA 0.5954
6. F B5EYW1 Ubiquinone biosynthesis O-methyltransferase 4.55e-06 NA NA 0.4439
6. F B0TK00 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.51e-05 NA NA 0.608
6. F Q07758 Nodulation protein S 1.97e-07 NA NA 0.618
6. F B5Y822 tRNA (guanine-N(7)-)-methyltransferase 1.77e-02 NA NA 0.4844
6. F Q9Z721 Uncharacterized RNA methyltransferase CPn_0885/CP_0981/CPj0885/CpB0914 2.29e-06 NA NA 0.5847
6. F B8J9E3 Protein-L-isoaspartate O-methyltransferase 4.78e-05 NA NA 0.6359
6. F Q14IC3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.83e-06 NA NA 0.6083
6. F Q8DSK3 Uncharacterized RNA methyltransferase SMU_1779c 6.61e-06 NA NA 0.651
6. F Q97NV8 Uncharacterized RNA methyltransferase SP_1901 4.36e-06 NA NA 0.6502
6. F B5QYK4 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 6.14e-05 NA NA 0.5593
6. F B8CJP2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.31e-05 NA NA 0.6242
6. F B4TBE3 Ubiquinone biosynthesis O-methyltransferase 4.50e-06 NA NA 0.444
6. F A8ADY5 Ubiquinone biosynthesis O-methyltransferase 3.47e-06 NA NA 0.4213
6. F Q8D8E0 Ubiquinone biosynthesis O-methyltransferase 2.55e-06 NA NA 0.4464
6. F Q8FFP0 Ubiquinone biosynthesis O-methyltransferase 3.51e-06 NA NA 0.4354
6. F Q3ILA5 Ubiquinone biosynthesis O-methyltransferase 4.82e-06 NA NA 0.4192
6. F D3UZL8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.60e-05 NA NA 0.5327
6. F Q46ZH7 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.86e-05 NA NA 0.5952
6. F Q821Q5 Uncharacterized RNA methyltransferase CCA_00883 1.82e-06 NA NA 0.6588
6. F Q1R9I4 Ubiquinone biosynthesis O-methyltransferase 4.45e-06 NA NA 0.4354
6. F Q830R6 Uncharacterized RNA methyltransferase EF_2706 7.16e-06 NA NA 0.6448
6. F A6TD57 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 5.26e-06 NA NA 0.6267
6. F Q7MFU0 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.58e-06 NA NA 0.6
6. F B4SYU8 Ubiquinone biosynthesis O-methyltransferase 5.14e-06 NA NA 0.4389
6. F B4TRN5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.83e-05 NA NA 0.5291
6. F B2K9X0 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.67e-05 NA NA 0.5707
6. F A7FKF4 Ubiquinone biosynthesis O-methyltransferase 3.41e-06 NA NA 0.4106
6. F Q5NGX1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 8.42e-06 NA NA 0.6089
6. F A6VUQ2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.17e-05 NA NA 0.6288
6. F Q68WG7 Ribosomal RNA small subunit methyltransferase H 1.25e-02 NA NA 0.2774
6. F B5YSF1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.10e-05 NA NA 0.5616
6. F Q8DC67 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.32e-05 NA NA 0.66
6. F B6I7I7 Ubiquinone biosynthesis O-methyltransferase 4.32e-06 NA NA 0.4352
6. F B0JX03 Ribosomal protein L11 methyltransferase 9.96e-05 NA NA 0.61
6. F Q8Z841 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.90e-05 NA NA 0.5579
6. F Q5V3Q6 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase 5.40e-06 NA NA 0.6075
6. F Q0BKU7 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.78e-06 NA NA 0.6089
6. F Q0I3Y4 Ubiquinone biosynthesis O-methyltransferase 3.42e-06 NA NA 0.4885
6. F A6TBT7 Ubiquinone biosynthesis O-methyltransferase 4.36e-06 NA NA 0.4601
6. F Q9CGB9 Uncharacterized RNA methyltransferase YljE 8.51e-06 NA NA 0.5992
6. F F2JTX5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.09e-05 NA NA 0.6715
6. F Q87BG5 Ubiquinone biosynthesis O-methyltransferase 3.07e-06 NA NA 0.455
6. F A4FWV6 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 2.36e-08 NA NA 0.6628
6. F A7ZDV3 tRNA/tmRNA (uracil-C(5))-methyltransferase 4.07e-06 NA NA 0.5782
6. F Q6D3S2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.35e-05 NA NA 0.5302
6. F B7N5J4 Ubiquinone biosynthesis O-methyltransferase 3.74e-06 NA NA 0.4385
6. F Q7U326 tRNA/tmRNA (uracil-C(5))-methyltransferase 9.22e-06 NA NA 0.5656
6. F Q87LP5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.38e-05 NA NA 0.6629
6. F A1SSB8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.14e-05 NA NA 0.6428
6. F Q99SY9 Uncharacterized RNA methyltransferase SAV1897 2.60e-06 NA NA 0.6691
6. F B5BBV5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.78e-05 NA NA 0.5298
6. F Q23552 Phosphoethanolamine N-methyltransferase 1 7.23e-04 NA NA 0.5192
6. F Q323P2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.75e-05 NA NA 0.5745
6. F Q9CDP0 Uncharacterized RNA methyltransferase YwfF 2.44e-04 NA NA 0.6254
6. F Q1IDL9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.66e-06 NA NA 0.5818
6. F P0DG15 Uncharacterized RNA methyltransferase SPs0836 1.04e-05 NA NA 0.6241
6. F Q6GFG0 Uncharacterized RNA methyltransferase SAR1988 2.66e-06 NA NA 0.6736
6. F Q99Z86 Uncharacterized RNA methyltransferase SPy_1346/M5005_Spy1098 1.08e-05 NA NA 0.624
6. F Q5E5J8 Ubiquinone biosynthesis O-methyltransferase 3.48e-06 NA NA 0.4542
6. F Q9KL20 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 3.20e-05 NA NA 0.5214
6. F Q4K898 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.63e-06 NA NA 0.5821
6. F Q71YW4 Uncharacterized RNA methyltransferase LMOf2365_1727 2.26e-06 NA NA 0.6352
6. F Q8R5Z8 Uncharacterized RNA methyltransferase FN1713 2.17e-05 NA NA 0.604
6. F Q0T2P9 Ubiquinone biosynthesis O-methyltransferase 4.37e-06 NA NA 0.4359
6. F Q5WW81 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.38e-06 NA NA 0.5781
6. F B7LN23 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.92e-05 NA NA 0.5738
6. F Q7VKU9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 8.00e-06 NA NA 0.6163
6. F Q8Z560 Ubiquinone biosynthesis O-methyltransferase 4.50e-06 NA NA 0.4389
6. F A4W8M4 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 3.65e-05 NA NA 0.5598
6. F Q8ZQJ5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.84e-05 NA NA 0.559
6. F A2SF76 Protein-L-isoaspartate O-methyltransferase 3.73e-04 NA NA 0.5477
6. F B7MXR3 Ubiquinone biosynthesis O-methyltransferase 4.37e-06 NA NA 0.436
6. F B3E6I4 Protein-L-isoaspartate O-methyltransferase 6.13e-07 NA NA 0.617
6. F Q32DV8 Ubiquinone biosynthesis O-methyltransferase 3.28e-06 NA NA 0.4352
6. F A8GGX8 Ubiquinone biosynthesis O-methyltransferase 3.92e-06 NA NA 0.4326
6. F B2J397 Ribosomal protein L11 methyltransferase 5.08e-06 NA NA 0.5505
6. F Q8E1E4 Uncharacterized RNA methyltransferase SAG0413 7.87e-06 NA NA 0.6505
6. F C4LBR5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 4.50e-06 NA NA 0.6039
6. F C0PXN9 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.97e-05 NA NA 0.5634
6. F Q820C5 Ubiquinone biosynthesis O-methyltransferase 4.44e-06 NA NA 0.4359
6. F Q0TJI9 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.41e-05 NA NA 0.5603
6. F Q7MHP7 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.38e-05 NA NA 0.6311
6. F A0KU76 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.80e-05 NA NA 0.5888
6. F A4TNI8 Ubiquinone biosynthesis O-methyltransferase 3.47e-06 NA NA 0.4039
6. F C4ZY31 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.69e-05 NA NA 0.5587
6. F A7FK27 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.69e-05 NA NA 0.5629
6. F Q8DKB7 Uncharacterized RNA methyltransferase tlr0942 9.19e-06 NA NA 0.6122
6. F Q7NGN4 Uncharacterized RNA methyltransferase gll3134 1.03e-05 NA NA 0.598
6. F A9AA91 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 2.53e-08 NA NA 0.6626
6. F Q88SY9 Uncharacterized RNA methyltransferase lp_3226 1.10e-05 NA NA 0.5981
6. F B5F101 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.89e-05 NA NA 0.5298
6. F Q1C9H5 Ubiquinone biosynthesis O-methyltransferase 3.38e-06 NA NA 0.4105
6. F Q8E6W1 Uncharacterized RNA methyltransferase gbs0448 7.56e-06 NA NA 0.6373
6. F A8H499 Ubiquinone biosynthesis O-methyltransferase 2.97e-06 NA NA 0.4566
6. F Q5XAU1 Uncharacterized RNA methyltransferase M6_Spy1337 3.58e-06 NA NA 0.6352
6. F Q97R12 Uncharacterized RNA methyltransferase SP_1029 1.85e-03 NA NA 0.5031
6. F B6I8H9 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.25e-05 NA NA 0.5606
6. F Q0VCJ8 Protein-L-histidine N-pros-methyltransferase 3.40e-03 NA NA 0.4944
6. F Q74I68 Uncharacterized RNA methyltransferase LJ_1698 1.05e-05 NA NA 0.6037
6. F Q9ZCY2 Ribosomal RNA small subunit methyltransferase H 1.34e-02 NA NA 0.4132
6. F Q8PMU6 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.39e-06 NA NA 0.5987
6. F P37431 Ubiquinone biosynthesis O-methyltransferase 4.56e-06 NA NA 0.4231
6. F Q73EJ5 Uncharacterized RNA methyltransferase BCE_0363 4.85e-06 NA NA 0.6266
6. F Q21KA1 tRNA/tmRNA (uracil-C(5))-methyltransferase 4.00e-06 NA NA 0.6029
6. F B4T0E3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.13e-05 NA NA 0.5376
6. F B6EKM3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 3.81e-06 NA NA 0.6216
6. F Q5XBK8 Uncharacterized RNA methyltransferase M6_Spy1070 1.12e-05 NA NA 0.6239
6. F Q81ZD6 Uncharacterized RNA methyltransferase BA_0333/GBAA_0333/BAS0318 5.13e-06 NA NA 0.6755
6. F B7M7D4 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.15e-05 NA NA 0.5609
6. F C3LWJ3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 3.80e-05 NA NA 0.5204
6. F Q8R918 Uncharacterized RNA methyltransferase TTE1812 4.16e-06 NA NA 0.6321
6. F C0Q093 Ubiquinone biosynthesis O-methyltransferase 4.57e-06 NA NA 0.4404
6. F P0DG14 Uncharacterized RNA methyltransferase SpyM3_1024 1.04e-05 NA NA 0.6242
6. F Q8Y6I1 Uncharacterized RNA methyltransferase lmo1703 2.36e-06 NA NA 0.6358
6. F Q2L016 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.35e-04 NA NA 0.6045
6. F B7LD52 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.22e-05 NA NA 0.5258
6. F Q2Y6W3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 2.10e-05 NA NA 0.567
6. F Q8DNH6 Uncharacterized RNA methyltransferase spr1717 4.57e-06 NA NA 0.6517
6. F Q885Y8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.42e-06 NA NA 0.5872
6. F B7MFZ8 Ubiquinone biosynthesis O-methyltransferase 4.41e-06 NA NA 0.4317
6. F Q57R80 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.07e-05 NA NA 0.5615
6. F B5EPA4 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 2.59e-05 NA NA 0.5705
6. F Q3M6M1 Ribosomal protein L11 methyltransferase 5.04e-06 NA NA 0.5379
6. F A5UJR5 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 8.45e-09 NA NA 0.5566
6. F B7MQW3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.20e-05 NA NA 0.5752
6. F Q1INS6 Protein-L-isoaspartate O-methyltransferase 1.11e-06 NA NA 0.6131
6. F Q8R933 Uncharacterized RNA methyltransferase TTE1797 1.14e-05 NA NA 0.5504
6. F D0JIM5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.21e-05 NA NA 0.5567
6. F M1W268 Methyltransferase CPUR_05424 9.51e-03 NA NA 0.5467
6. F Q1CFZ1 Ubiquinone biosynthesis O-methyltransferase 3.25e-06 NA NA 0.4108
6. F Q50203 Ribosomal RNA small subunit methyltransferase G 1.93e-04 NA NA 0.5417
6. F A9N824 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.98e-05 NA NA 0.5463
6. F A1A998 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.30e-05 NA NA 0.5611
6. F A6VGG1 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 2.51e-08 NA NA 0.6668
6. F Q97J51 Uncharacterized RNA methyltransferase CA_C1435 1.65e-05 NA NA 0.6376
6. F B5FPZ6 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.60e-05 NA NA 0.5297
6. F B3PL62 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 8.31e-06 NA NA 0.6388
6. F A0A067XMV2 Methyltransferase ptaH 4.96e-03 NA NA 0.5287
6. F Q74D67 Uncharacterized RNA methyltransferase GSU1452 8.96e-06 NA NA 0.6289
6. F A8A296 Ubiquinone biosynthesis O-methyltransferase 3.27e-06 NA NA 0.4402
6. F A6WZP8 Ribosomal RNA small subunit methyltransferase H 2.16e-02 NA NA 0.5671
6. F A1W8J9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 4.78e-05 NA NA 0.5414
6. F Q8FJE7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.20e-05 NA NA 0.555
6. F Q74IG2 Uncharacterized RNA methyltransferase LJ_1606 4.14e-06 NA NA 0.646
6. F P9WJZ0 Probable S-adenosylmethionine-dependent methyltransferase MT3114 4.39e-03 NA NA 0.6467
6. F A3MZ07 Ubiquinone biosynthesis O-methyltransferase 1.08e-05 NA NA 0.49
6. F Q99YP3 Uncharacterized RNA methyltransferase SPy_1606/M5005_Spy1319 3.84e-06 NA NA 0.6435
6. F D3VBF7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.79e-05 NA NA 0.5355
6. F C6DEQ3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.54e-05 NA NA 0.5357
6. F Q8ZGR6 Ubiquinone biosynthesis O-methyltransferase 3.37e-06 NA NA 0.4419
6. F B5R249 Ubiquinone biosynthesis O-methyltransferase 5.00e-06 NA NA 0.4443
6. F Q9M571 Phosphoethanolamine N-methyltransferase 1.90e-03 NA NA 0.4208
6. F Q8XIK5 Uncharacterized RNA methyltransferase CPE2114 1.63e-05 NA NA 0.5316
6. F Q7A4Q9 Uncharacterized RNA methyltransferase SA1713 2.64e-06 NA NA 0.674
6. F Q4USG1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.21e-05 NA NA 0.6322
6. F B8ZTN3 Ribosomal RNA small subunit methyltransferase G 1.84e-04 NA NA 0.5132
6. F Q7W676 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.08e-05 NA NA 0.5132
6. F A0KGG9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 7.59e-06 NA NA 0.6001
6. F A7ZJS7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.18e-05 NA NA 0.5271
6. F C3LLV3 Ubiquinone biosynthesis O-methyltransferase 3.30e-06 NA NA 0.471
6. F B1X800 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.16e-05 NA NA 0.5559
6. F B7J921 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 2.58e-05 NA NA 0.5903
6. F Q8XE29 Ubiquinone biosynthesis O-methyltransferase 3.21e-06 NA NA 0.4307
6. F Q83S14 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.28e-05 NA NA 0.575
6. F Q5HEM5 Uncharacterized RNA methyltransferase SACOL1957 2.74e-06 NA NA 0.6743
6. F B5FNR7 Ubiquinone biosynthesis O-methyltransferase 4.66e-06 NA NA 0.4356
6. F Q9X0H9 Uncharacterized RNA methyltransferase TM_1094 3.20e-06 NA NA 0.586
6. F B1JS96 Ubiquinone biosynthesis O-methyltransferase 3.28e-06 NA NA 0.4435
6. F A8ZXR8 Protein-L-isoaspartate O-methyltransferase 8.18e-07 NA NA 0.6253
6. F B7VGS0 Ubiquinone biosynthesis O-methyltransferase 2.68e-06 NA NA 0.4683
6. F A4WDX1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.12e-06 NA NA 0.6625
6. F A5IBU7 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.72e-06 NA NA 0.5705
6. F A7ZYG2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.57e-05 NA NA 0.5746
6. F A7I332 tRNA/tmRNA (uracil-C(5))-methyltransferase 2.25e-06 NA NA 0.6115
6. F B7UMV1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.64e-05 NA NA 0.5562
6. F B4TPG0 Ubiquinone biosynthesis O-methyltransferase 5.14e-06 NA NA 0.444
6. F Q1RE66 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.31e-05 NA NA 0.5747
6. F Q8X6Q5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.87e-05 NA NA 0.5747
6. F Q7VXM6 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.05e-04 NA NA 0.5165
6. F O26249 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 9.90e-09 NA NA 0.6394
6. F E5KIC0 Cypemycin N-terminal methyltransferase 8.86e-04 NA NA 0.4652
6. F Q5H1Q8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.17e-05 NA NA 0.6056
6. F A5CXB2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.70e-06 NA NA 0.5816
6. F Q32ID7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.14e-05 NA NA 0.5443
6. F Q63UT8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.78e-05 NA NA 0.5958
6. F Q9HPN4 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 6.26e-08 NA NA 0.5917
6. F A4SRC5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.25e-06 NA NA 0.6032
6. F Q609G2 Ubiquinone biosynthesis O-methyltransferase 4.81e-06 NA NA 0.468
6. F Q3BVV1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.07e-05 NA NA 0.6161
6. F Q5X5A8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 6.43e-06 NA NA 0.588
6. F Q8P017 Uncharacterized RNA methyltransferase spyM18_1615 3.33e-06 NA NA 0.6437
6. F A7MF48 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.06e-05 NA NA 0.5556
6. F Q5ZMH6 Protein-L-histidine N-pros-methyltransferase 3.25e-03 NA NA 0.4968
6. F B5XNZ3 Ubiquinone biosynthesis O-methyltransferase 4.76e-06 NA NA 0.4623
6. F A0LL58 Protein-L-isoaspartate O-methyltransferase 1 4.18e-07 NA NA 0.6289
6. F A8AIQ7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.15e-05 NA NA 0.5713
6. F Q5HN37 Uncharacterized RNA methyltransferase SERP1435 3.08e-06 NA NA 0.6614
6. F Q8DUV4 Uncharacterized RNA methyltransferase SMU_788 8.13e-06 NA NA 0.679
6. F Q57M77 Ubiquinone biosynthesis O-methyltransferase 4.55e-06 NA NA 0.4392
6. F A9R284 Ubiquinone biosynthesis O-methyltransferase 3.30e-06 NA NA 0.4461
6. F B7MHG3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 4.79e-05 NA NA 0.5758
6. F Q5AR54 Nonribosomal peptide synthetase asqK 8.17e-01 NA NA 0.4565
6. F Q8AA22 Uncharacterized RNA methyltransferase BT_0643 2.46e-06 NA NA 0.6502
6. F A1K4G2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 3.47e-05 NA NA 0.5752
6. F A5F1U0 Ubiquinone biosynthesis O-methyltransferase 3.27e-06 NA NA 0.4711
6. F Q5R111 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.58e-05 NA NA 0.6638
6. F B4EUF2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 5.00e-06 NA NA 0.6154
6. F Q8DPY7 Uncharacterized RNA methyltransferase spr0932 1.85e-03 NA NA 0.5017
6. F Q81Z48 Uncharacterized RNA methyltransferase BA_0426/GBAA_0426/BAS0414 4.10e-06 NA NA 0.5957
6. F Q0T8K2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC 5.08e-05 NA NA 0.5752
6. F F6CY50 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 9.38e-06 NA NA 0.6704
6. F Q8CRU6 Uncharacterized RNA methyltransferase SE_1582 3.00e-06 NA NA 0.6724
6. F B2I705 Ubiquinone biosynthesis O-methyltransferase 3.02e-06 NA NA 0.4552
6. F Q9PAM5 Ubiquinone biosynthesis O-methyltransferase 2.42e-06 NA NA 0.4519
6. F A9MJY3 Ubiquinone biosynthesis O-methyltransferase 5.09e-06 NA NA 0.4232
6. F Q4WQY5 Methyltransferase tpcM 7.52e-03 NA NA 0.518
6. F Q7WI42 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 1.04e-04 NA NA 0.5196
6. F B7UFP4 Ubiquinone biosynthesis O-methyltransferase 4.50e-06 NA NA 0.4332
6. F Q5E320 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 4.91e-06 NA NA 0.6145
6. F Q5P841 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 2.84e-05 NA NA 0.6014
6. F B0U3W1 Ubiquinone biosynthesis O-methyltransferase 3.07e-06 NA NA 0.4518
7. B A6UR90 Protein-L-isoaspartate O-methyltransferase 1.84e-06 NA 0.006 NA
7. B Q9K623 Malonyl-[acyl-carrier protein] O-methyltransferase 5.05e-03 NA 0.001 NA
7. B Q8EAR4 Release factor glutamine methyltransferase 7.51e-07 NA 0.038 NA
7. B L0D9B6 Ornithine lipid N-methyltransferase 1.34e-07 NA 2.08e-04 NA
7. B Q81MB2 Malonyl-[acyl-carrier protein] O-methyltransferase 2.48e-03 NA 0.018 NA
7. B Q818X2 Malonyl-[acyl-carrier protein] O-methyltransferase 4.07e-03 NA 0.030 NA
7. B Q31DJ1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD 2.61e-06 NA 0.016 NA
7. B Q6M116 Protein-L-isoaspartate O-methyltransferase 1.69e-06 NA 0.039 NA
7. B P9WK03 Uncharacterized methyltransferase Rv0089 2.04e-03 NA 8.24e-04 NA
7. B Q57836 Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) 1.53e-08 NA 0.015 NA
7. B A8MGS9 Uncharacterized methyltransferase Clos_1076 1.96e-03 NA 5.20e-04 NA