Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54573.1
JCVISYN3A_0005

Uncharacterized protein.
M. mycoides homolog: Q6MUM3.
TIGRfam Classification: 1=Unknown.
Category: Nonessential.

Statistics

Total GO Annotation: 178
Unique PROST Go: 109
Unique BLAST Go: 67
Unique Foldseek Go: 1

Total Homologs: 33
Unique PROST Homologs: 24
Unique BLAST Homologs: 8
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Fibronectin-binding protein PlpA
Antczak et al. [3]: Chromosome segregation protein
Zhang et al. [4]: GO:0003779|actin binding
Bianchi et al. [5]: Unclear

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q9DBZ1 (Inhibitor of nuclear factor kappa-B kinase-interacting protein) with a FATCAT P-Value: 1.44e-09 and RMSD of 3.01 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein AVX54573.1 colored as red in alignment, homolog Q9DBZ1 colored as blue. Query protein AVX54573.1 is also shown in right top, homolog Q9DBZ1 showed in right bottom. They are colored based on secondary structures. 

  AVX54573.1 M--IRDFN--NQEVTLDDLEQNNNKTD--KN----------KPK--VQFL---MRFS---LVFSNISTHIFL-----FVLIVI-ASLFFGLRYTYYNYKV 70
      Q9DBZ1 MSEVKSRKKPGPKVAAPEPEK---RSDGRKNPEARGDAGWADPRTGLSLLSLAMTLGLAWLVFQQ--SEKFAKVEKQYRLLQTESSEFQGL-----QSKI 90

  AVX54573.1 DLITNAHKIKPSIPKLKEVYKE-AL--QVVEEV---KRE-TD-KNSSDSLINKIDEI--KTIVKEVTEF-----ANEFNDRSKKVEPKVREVIDQGKKIT 155
      Q9DBZ1 SLISS--KLESTENTLQEATSSISLMTQFEQEVSGLQRSIRDIETSEEMLTQKMQNLNEK--FQNITDFWKRTLA-EMIDDTAVF--K-SEVKDTHSEVT 182

  AVX54573.1 TDLEKVTKEIEELRKTGDSLTNRVRRGLNNFSTLGNLVGTANNDFKSVNESVIRI-----TD--LAKKISEEGKKITANVETIKKEV-DYFSK----RSE 243
      Q9DBZ1 --L-KINSADQEIK----SLTERL-KDLED-STLRN-IRTVS---RQEEEDLLRVEAQLSSDTKAVKKLEEEQHTLLARDEDLTNKLSSYEPKVEECKAH 269

  AVX54573.1 IP---------LR---DI----EKLKEIYRQKFPLFERNNKRLQEIWSKLMGIFNQFTVEKTQSNYYNHLIYI---LLFL---IIDSIVLLVLTYMSMIS 321
      Q9DBZ1 FPTIENAVHSVLRVSQDLIGTERKMEELTMQ---MFNMEDDMLRAV-SEIMEM--QKTLEGIQ--YDNSLLKMQNELVVLKGKVHD-----FIAYSSARE 356

  AVX54573.1 K-TMKKILLFYIFGILSFNPFVWVSVVISFLSRPIKNRKRKFS 363
      Q9DBZ1 KGTLGE----YSLGNKGTDEY---------------------- 373

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
4. PB GO:0048156 tau protein binding
5. P GO:1902995 positive regulation of phospholipid efflux
5. P GO:0007616 long-term memory
5. P GO:0110146 magnetosome membrane
5. P GO:0048662 negative regulation of smooth muscle cell proliferation
5. P GO:0042158 lipoprotein biosynthetic process
5. P GO:0070328 triglyceride homeostasis
5. P GO:0061771 response to caloric restriction
5. P GO:0032805 positive regulation of low-density lipoprotein particle receptor catabolic process
5. P GO:0070326 very-low-density lipoprotein particle receptor binding
5. P GO:0045088 regulation of innate immune response
5. P GO:0034364 high-density lipoprotein particle
5. P GO:1905860 positive regulation of heparan sulfate proteoglycan binding
5. P GO:0120020 cholesterol transfer activity
5. P GO:0051044 positive regulation of membrane protein ectodomain proteolysis
5. P GO:0033700 phospholipid efflux
5. P GO:0008289 lipid binding
5. P GO:0010873 positive regulation of cholesterol esterification
5. P GO:1902430 negative regulation of amyloid-beta formation
5. P GO:0034375 high-density lipoprotein particle remodeling
5. P GO:0043254 regulation of protein-containing complex assembly
5. P GO:0050709 negative regulation of protein secretion
5. P GO:0042159 lipoprotein catabolic process
5. P GO:0010877 lipid transport involved in lipid storage
5. P GO:0032489 regulation of Cdc42 protein signal transduction
5. P GO:0010544 negative regulation of platelet activation
5. P GO:0090209 negative regulation of triglyceride metabolic process
5. P GO:0034372 very-low-density lipoprotein particle remodeling
5. P GO:0034363 intermediate-density lipoprotein particle
5. P GO:0044794 positive regulation by host of viral process
5. P GO:0050728 negative regulation of inflammatory response
5. P GO:0043395 heparan sulfate proteoglycan binding
5. P GO:0010165 response to X-ray
5. P GO:0002021 response to dietary excess
5. P GO:0005901 caveola
5. P GO:0010629 negative regulation of gene expression
5. P GO:0007263 nitric oxide mediated signal transduction
5. P GO:0042802 identical protein binding
5. P GO:0005543 phospholipid binding
5. P GO:0042981 regulation of apoptotic process
5. P GO:0071830 triglyceride-rich lipoprotein particle clearance
5. P GO:0006869 lipid transport
5. P GO:0034380 high-density lipoprotein particle assembly
5. P GO:0002693 positive regulation of cellular extravasation
5. P GO:0032502 developmental process
5. P GO:0000165 MAPK cascade
5. P GO:0019934 cGMP-mediated signaling
5. P GO:0005783 endoplasmic reticulum
5. P GO:0042311 vasodilation
5. P GO:0048844 artery morphogenesis
5. P GO:0031175 neuron projection development
5. P GO:0034361 very-low-density lipoprotein particle
5. P GO:0010875 positive regulation of cholesterol efflux
5. P GO:0001937 negative regulation of endothelial cell proliferation
5. P GO:0043537 negative regulation of blood vessel endothelial cell migration
5. P GO:0043083 synaptic cleft
5. P GO:0033344 cholesterol efflux
5. P GO:0060999 positive regulation of dendritic spine development
5. P GO:0034362 low-density lipoprotein particle
5. P GO:0006898 receptor-mediated endocytosis
5. P GO:0055089 fatty acid homeostasis
5. P GO:0042982 amyloid precursor protein metabolic process
5. P GO:0042632 cholesterol homeostasis
5. P GO:0042157 lipoprotein metabolic process
5. P GO:0006641 triglyceride metabolic process
5. P GO:0006707 cholesterol catabolic process
5. P GO:0015909 long-chain fatty acid transport
5. P GO:2000822 regulation of behavioral fear response
5. P GO:0005615 extracellular space
5. P GO:1905890 regulation of cellular response to very-low-density lipoprotein particle stimulus
5. P GO:0001540 amyloid-beta binding
5. P GO:0046889 positive regulation of lipid biosynthetic process
5. P GO:1905907 negative regulation of amyloid fibril formation
5. P GO:0097114 NMDA glutamate receptor clustering
5. P GO:0031012 extracellular matrix
5. P GO:0050750 low-density lipoprotein particle receptor binding
5. P GO:0090090 negative regulation of canonical Wnt signaling pathway
5. P GO:0016209 antioxidant activity
5. P GO:1903002 positive regulation of lipid transport across blood-brain barrier
5. P GO:0034384 high-density lipoprotein particle clearance
5. P GO:0034447 very-low-density lipoprotein particle clearance
5. P GO:0045807 positive regulation of endocytosis
5. P GO:1900272 negative regulation of long-term synaptic potentiation
5. P GO:0019068 virion assembly
5. P GO:0010977 negative regulation of neuron projection development
5. P GO:0010976 positive regulation of neuron projection development
5. P GO:0010467 gene expression
5. P GO:1902952 positive regulation of dendritic spine maintenance
5. P GO:0045541 negative regulation of cholesterol biosynthetic process
5. P GO:0060228 phosphatidylcholine-sterol O-acyltransferase activator activity
5. P GO:0033209 tumor necrosis factor-mediated signaling pathway
5. P GO:0071813 lipoprotein particle binding
5. P GO:0043691 reverse cholesterol transport
5. P GO:1905855 positive regulation of heparan sulfate binding
5. P GO:0071831 intermediate-density lipoprotein particle clearance
5. P GO:0006874 cellular calcium ion homeostasis
5. P GO:0042627 chylomicron
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0008201 heparin binding
5. P GO:0046911 metal chelating activity
5. P GO:1900223 positive regulation of amyloid-beta clearance
5. P GO:0051651 maintenance of location in cell
5. P GO:0034382 chylomicron remnant clearance
5. P GO:0061136 regulation of proteasomal protein catabolic process
5. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
5. P GO:0043407 negative regulation of MAP kinase activity
5. P GO:0034374 low-density lipoprotein particle remodeling
5. P GO:0035641 locomotory exploration behavior
5. P GO:0097113 AMPA glutamate receptor clustering
5. P GO:0051000 positive regulation of nitric-oxide synthase activity
6. F GO:0016021 integral component of membrane
7. B GO:0009888 tissue development
7. B GO:0034454 microtubule anchoring at centrosome
7. B GO:0005868 cytoplasmic dynein complex
7. B GO:0005819 spindle
7. B GO:0051010 microtubule plus-end binding
7. B GO:0015631 tubulin binding
7. B GO:0031252 cell leading edge
7. B GO:0099738 cell cortex region
7. B GO:0007097 nuclear migration
7. B GO:0009887 animal organ morphogenesis
7. B GO:0008045 motor neuron axon guidance
7. B GO:0019901 protein kinase binding
7. B GO:0048513 animal organ development
7. B GO:0008406 gonad development
7. B GO:0045089 positive regulation of innate immune response
7. B GO:0090316 positive regulation of intracellular protein transport
7. B GO:0010457 centriole-centriole cohesion
7. B GO:0016358 dendrite development
7. B GO:1990535 neuron projection maintenance
7. B GO:0021517 ventral spinal cord development
7. B GO:0090063 positive regulation of microtubule nucleation
7. B GO:0070050 neuron cellular homeostasis
7. B GO:0045171 intercellular bridge
7. B GO:0006935 chemotaxis
7. B GO:1904398 positive regulation of neuromuscular junction development
7. B GO:0004521 endoribonuclease activity
7. B GO:0005635 nuclear envelope
7. B GO:0072686 mitotic spindle
7. B GO:0051081 nuclear membrane disassembly
7. B GO:0018298 protein-chromophore linkage
7. B GO:0009881 photoreceptor activity
7. B GO:0032402 melanosome transport
7. B GO:0000776 kinetochore
7. B GO:0050905 neuromuscular process
7. B GO:0043005 neuron projection
7. B GO:0031122 cytoplasmic microtubule organization
7. B GO:0070831 basement membrane assembly
7. B GO:0033627 cell adhesion mediated by integrin
7. B GO:0060236 regulation of mitotic spindle organization
7. B GO:1905515 non-motile cilium assembly
7. B GO:0000922 spindle pole
7. B GO:0005874 microtubule
7. B GO:0000132 establishment of mitotic spindle orientation
7. B GO:0005938 cell cortex
7. B GO:0099558 maintenance of synapse structure
7. B GO:0003143 embryonic heart tube morphogenesis
7. B GO:0007165 signal transduction
7. B GO:0035371 microtubule plus-end
7. B GO:0071711 basement membrane organization
7. B GO:0005814 centriole
7. B GO:0008017 microtubule binding
7. B GO:0030424 axon
7. B GO:0120103 centriolar subdistal appendage
7. B GO:0061744 motor behavior
7. B GO:0031116 positive regulation of microtubule polymerization
7. B GO:0005604 basement membrane
7. B GO:0005875 microtubule associated complex
7. B GO:0006402 mRNA catabolic process
7. B GO:0005813 centrosome
7. B GO:0007528 neuromuscular junction development
7. B GO:0030286 dynein complex
7. B GO:0034446 substrate adhesion-dependent cell spreading
7. B GO:0043025 neuronal cell body
7. B GO:0055013 cardiac muscle cell development
7. B GO:0042147 retrograde transport, endosome to Golgi
7. B GO:0015630 microtubule cytoskeleton
7. B GO:0043256 laminin complex

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P43040 Uncharacterized protein MCAP_0005 1.11e-16 6.56e-69 2.30e-179 0.6237
5. P P43056 Uncharacterized protein MHO_3790 2.54e-01 2.01e-02 NA NA
5. P Q5EAJ6 Inhibitor of nuclear factor kappa-B kinase-interacting protein 2.59e-08 1.25e-04 NA NA
5. P P0DO94 Apolipoprotein E 2.83e-07 2.79e-02 NA NA
5. P P0DUP7 Apolipoprotein E 6.10e-06 4.32e-02 NA NA
5. P P56164 Major pollen allergen Pha a 5.1 2.98e-02 2.79e-02 NA NA
5. P P0DTR8 Apolipoprotein E 1.25e-05 8.80e-03 NA NA
5. P P10517 Apolipoprotein E 1.78e-06 4.62e-02 NA NA
5. P Q6NE78 Probable magnetosome protein Mms36 7.83e-04 7.15e-03 NA NA
5. P Q9GLM6 Apolipoprotein E 1.56e-05 1.41e-03 NA NA
5. P A0A0D9S1R0 Apolipoprotein E 3.46e-06 2.90e-03 NA NA
5. P Q91VC4 Plasmalemma vesicle-associated protein 8.57e-07 4.23e-02 NA NA
5. P A2VE53 Inhibitor of nuclear factor kappa-B kinase-interacting protein 4.63e-09 4.67e-04 NA NA
5. P Q8BGQ6 EF-hand calcium-binding domain-containing protein 14 4.19e-06 4.47e-03 NA NA
5. P Q9WV78 Plasmalemma vesicle-associated protein 4.23e-07 3.00e-02 NA NA
5. P Q9DBZ1 Inhibitor of nuclear factor kappa-B kinase-interacting protein 1.44e-09 5.85e-05 NA NA
5. P P0DKW8 Apolipoprotein E 4.80e-06 5.00e-02 NA NA
5. P P05770 Apolipoprotein E 4.23e-06 8.18e-03 NA NA
5. P P0DKY2 Apolipoprotein E 7.07e-06 8.18e-03 NA NA
5. P Q9GLM7 Apolipoprotein E 1.74e-07 4.85e-02 NA NA
5. P Q8BMK4 Cytoskeleton-associated protein 4 1.02e-05 6.38e-03 NA NA
5. P P0DMS6 Apolipoprotein A-I 3.30e-05 4.11e-02 NA NA
5. P P75384 Uncharacterized protein MG280 homolog 4.87e-06 2.73e-06 NA NA
5. P P47522 Uncharacterized protein MG280 3.92e-06 2.56e-07 NA NA
5. P Q70UQ0 Inhibitor of nuclear factor kappa-B kinase-interacting protein 2.12e-08 5.46e-05 NA NA
7. B P11046 Laminin subunit beta-1 1.23e-02 NA 0.022 NA
7. B A1VAZ2 Ribonuclease Y 2.26e-04 NA 0.007 NA
7. B Q8HZI9 Laminin subunit gamma-2 4.10e-04 NA 0.026 NA
7. B Q9HP81 Sensory rhodopsin II transducer 6.07e-05 NA 0.032 NA
7. B Q14203 Dynactin subunit 1 9.29e-05 NA 0.044 NA
7. B B0R6B1 Sensory rhodopsin II transducer 5.59e-05 NA 0.032 NA
7. B O08788 Dynactin subunit 1 2.71e-04 NA 0.038 NA
7. B Q728D2 Ribonuclease Y 1.01e-05 NA 0.007 NA