Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54576.1
JCVISYN3A_0008
Nucleoside ABC transporter permease.
M. mycoides homolog: Q6MUM0.
TIGRfam Classification: 3=Putative.
Category: Essential.
Statistics
Total GO Annotation: 62
Unique PROST Go: 40
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 273
Unique PROST Homologs: 182
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 4
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
O83324
(Probable riboflavin import permease protein RfuD) with a FATCAT P-Value: 0 and RMSD of 3.07 angstrom. The sequence alignment identity is 24.0%.
Structural alignment shown in left. Query protein AVX54576.1 colored as red in alignment, homolog O83324 colored as blue.
Query protein AVX54576.1 is also shown in right top, homolog O83324 showed in right bottom. They are colored based on secondary structures.
AVX54576.1 MTILFNTSILTWALALVGVLLFASLSSLVSEKAGVVNIAVEGMMIIGALVVSI--L--GTYLTSNDNKSNYTQIPIVLLAGV-IT-AVFALLHAFPAI-T 93 O83324 MGVI-GTTVIA-ILHRAAPLACAAAGALATEYAGVLGIFMEGVITFSSFCIAFFALVWGSY---------W--------GGLGITVCVVPLCLFFVAVGT 81 AVX54576.1 --LKANQIISGTAINILALGLGIFLSTSNWFGKQSQVIASGYSSIDVINITKVVNGK--TQ-QVA--SML--PIW-TIIAIILAIGLFVFFKY-TKQGMR 182 O83324 ERMRANPFLTGIAVHFSAMGMSAF-GASSMFARAA---ASAM-QMD----T-AAHGVSFTHVSLAHTRVLPHPLWGTAVAFAL-VWVFHLYLYSTNVGIN 170 AVX54576.1 YAM-VGENPNAIDAAGISVTKYRYLAVILSGFLAGVGGGVFVVTAVSGGGLFSGNM-LGYGFLGIAIMIFGQWRISFIVIGSIIFSWLFALGQQI-GT-- 277 O83324 F-MHSGEGALALQVRGTDAARYRMVSWAVAGVCAVCAGGLLVLRV----GTYTPQMAAGRGWTALAIVFLARKRMMWCVPAAIFFSGIEHMCDVLQGTHV 265 AVX54576.1 LSTNKTIQAISTLFNTLPFVLTILAMVAFSKTSRAPAAVGVPFDKAKR-------------- 325 O83324 VPT-------GVLF-ALPYILSLVVFVCTRRTS--PCRRG---ER-RRSRLLFAYLQRVTCA 313
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0022857 | transmembrane transporter activity |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0008643 | carbohydrate transport |
| 2. PF | GO:0042882 | L-arabinose transmembrane transport |
| 2. PF | GO:0015808 | L-alanine transport |
| 2. PF | GO:0055085 | transmembrane transport |
| 2. PF | GO:0098713 | leucine import across plasma membrane |
| 2. PF | GO:0015192 | L-phenylalanine transmembrane transporter activity |
| 2. PF | GO:0015823 | phenylalanine transport |
| 2. PF | GO:0015188 | L-isoleucine transmembrane transporter activity |
| 2. PF | GO:0006865 | amino acid transport |
| 2. PF | GO:0005304 | L-valine transmembrane transporter activity |
| 2. PF | GO:0015190 | L-leucine transmembrane transporter activity |
| 2. PF | GO:1903785 | L-valine transmembrane transport |
| 2. PF | GO:0015803 | branched-chain amino acid transport |
| 2. PF | GO:0010043 | response to zinc ion |
| 2. PF | GO:1903806 | L-isoleucine import across plasma membrane |
| 2. PF | GO:0042941 | D-alanine transport |
| 2. PF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 2. PF | GO:0015658 | branched-chain amino acid transmembrane transporter activity |
| 5. P | GO:0005887 | integral component of plasma membrane |
| 5. P | GO:0015592 | methylgalactoside transmembrane transporter activity |
| 5. P | GO:0015098 | molybdate ion transmembrane transporter activity |
| 5. P | GO:0015147 | L-arabinose transmembrane transporter activity |
| 5. P | GO:0042626 | ATPase-coupled transmembrane transporter activity |
| 5. P | GO:0071281 | cellular response to iron ion |
| 5. P | GO:0098721 | uracil import across plasma membrane |
| 5. P | GO:0006829 | zinc ion transport |
| 5. P | GO:0071578 | zinc ion import across plasma membrane |
| 5. P | GO:0015104 | antimonite transmembrane transporter activity |
| 5. P | GO:0015505 | uracil:cation symporter activity |
| 5. P | GO:0015603 | iron chelate transmembrane transporter activity |
| 5. P | GO:0015591 | D-ribose transmembrane transporter activity |
| 5. P | GO:0042935 | achromobactin transport |
| 5. P | GO:0015649 | 2-keto-3-deoxygluconate:proton symporter activity |
| 5. P | GO:0015751 | arabinose transmembrane transport |
| 5. P | GO:0015889 | cobalamin transport |
| 5. P | GO:0015210 | uracil transmembrane transporter activity |
| 5. P | GO:0005315 | inorganic phosphate transmembrane transporter activity |
| 5. P | GO:0015752 | D-ribose transmembrane transport |
| 5. P | GO:0015757 | galactose transmembrane transport |
| 5. P | GO:1903714 | isoleucine transmembrane transport |
| 5. P | GO:0006817 | phosphate ion transport |
| 5. P | GO:0015699 | antimonite transport |
| 5. P | GO:0015420 | ABC-type vitamin B12 transporter activity |
| 5. P | GO:0015765 | methylgalactoside transport |
| 5. P | GO:0033214 | siderophore-dependent iron import into cell |
| 5. P | GO:0015857 | uracil transport |
| 5. P | GO:0042858 | chrysobactin biosynthetic process |
| 5. P | GO:0090482 | vitamin transmembrane transporter activity |
| 5. P | GO:0005354 | galactose transmembrane transporter activity |
| 5. P | GO:0015620 | ferric-enterobactin transmembrane transporter activity |
| 5. P | GO:0015685 | ferric-enterobactin import into cell |
| 5. P | GO:0015700 | arsenite transport |
| 5. P | GO:0000006 | high-affinity zinc transmembrane transporter activity |
| 5. P | GO:0033113 | cyanelle membrane |
| 5. P | GO:0015105 | arsenite transmembrane transporter activity |
| 5. P | GO:0006811 | ion transport |
| 5. P | GO:0010921 | regulation of phosphatase activity |
| 5. P | GO:0055072 | iron ion homeostasis |
| 6. F | GO:0046914 | transition metal ion binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0022857 | transmembrane transporter activity |
| GO:0055085 | transmembrane transport |
| GO:0016021 | integral component of membrane |
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P75514 | Uncharacterized protein MG121 homolog | 0.00e+00 | 8.59e-55 | 1.25e-31 | 0.8943 |
| 1. PBF | D4GPW2 | Glucose ABC transporter permease protein TsgB13 | 0.00e+00 | 1.89e-28 | 6.35e-04 | 0.7407 |
| 1. PBF | D4GPW1 | Putative glucose ABC transporter permease protein TsgC13 | 0.00e+00 | 7.76e-46 | 1.48e-17 | 0.7642 |
| 1. PBF | P47367 | Uncharacterized protein MG121 | 0.00e+00 | 3.75e-53 | 1.62e-40 | 0.86 |
| 1. PBF | A2RKA5 | Nucleoside ABC transporter permease protein NupC | 0.00e+00 | 2.30e-71 | 2.42e-29 | 0.8528 |
| 1. PBF | O05254 | Guanosine ABC transporter permease protein NupP | 0.00e+00 | 2.64e-25 | 0.021 | 0.687 |
| 1. PBF | O83324 | Probable riboflavin import permease protein RfuD | 0.00e+00 | 1.34e-36 | 1.56e-06 | 0.6681 |
| 1. PBF | O05255 | Guanosine ABC transporter permease protein NupQ | 0.00e+00 | 4.37e-62 | 3.88e-28 | 0.8433 |
| 2. PF | Q7CG49 | Autoinducer 2 import system permease protein LsrC | 1.36e-13 | 2.56e-15 | NA | 0.6267 |
| 2. PF | B2K3G0 | Autoinducer 2 import system permease protein LsrC | 1.02e-13 | 7.75e-16 | NA | 0.6313 |
| 2. PF | Q9F9B1 | Fructose import permease protein FrcC | 0.00e+00 | 1.75e-05 | NA | 0.643 |
| 2. PF | Q2PBM1 | Autoinducer 2 import system permease protein LsrD | 4.88e-13 | 1.56e-23 | NA | 0.6124 |
| 2. PF | Q8Z2X6 | Autoinducer 2 import system permease protein LsrC | 2.46e-14 | 6.33e-16 | NA | 0.6723 |
| 2. PF | Q83RD8 | Autoinducer 2 import system permease protein LsrC | 6.37e-14 | 8.21e-19 | NA | 0.6478 |
| 2. PF | Q7CG48 | Autoinducer 2 import system permease protein LsrD | 1.53e-10 | 1.60e-22 | NA | 0.6057 |
| 2. PF | O83323 | Probable riboflavin import permease protein RfuC | 5.77e-15 | 3.92e-25 | NA | 0.7197 |
| 2. PF | Q56036 | Galactoside transport system permease protein MglC | 0.00e+00 | 5.02e-12 | NA | 0.6473 |
| 2. PF | B1JLQ2 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 2.21e-22 | NA | 0.6128 |
| 2. PF | P21627 | High-affinity branched-chain amino acid transport system permease protein BraD | 0.00e+00 | 7.21e-14 | NA | 0.7303 |
| 2. PF | P0A2J1 | High-affinity branched-chain amino acid transport system permease protein LivH | 1.64e-13 | 9.13e-13 | NA | 0.727 |
| 2. PF | Q0T4L7 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 3.40e-22 | NA | 0.6316 |
| 2. PF | A4TQL7 | Autoinducer 2 import system permease protein LsrD | 1.39e-10 | 1.60e-22 | NA | 0.6039 |
| 2. PF | B1IRU5 | Autoinducer 2 import system permease protein LsrD | 1.36e-10 | 3.40e-22 | NA | 0.6388 |
| 2. PF | A1JJ54 | Autoinducer 2 import system permease protein LsrC | 1.20e-13 | 5.51e-13 | NA | 0.6265 |
| 2. PF | A9R075 | Autoinducer 2 import system permease protein LsrC | 1.22e-13 | 2.56e-15 | NA | 0.6209 |
| 2. PF | Q5PJE6 | Autoinducer 2 import system permease protein LsrC | 3.18e-14 | 1.20e-15 | NA | 0.6442 |
| 2. PF | B1XEA2 | Autoinducer 2 import system permease protein LsrC | 2.61e-14 | 5.40e-19 | NA | 0.6712 |
| 2. PF | Q2PBL8 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 2.90e-22 | NA | 0.5891 |
| 2. PF | A7FMJ8 | Autoinducer 2 import system permease protein LsrC | 8.49e-14 | 5.77e-14 | NA | 0.625 |
| 2. PF | A2RKA6 | Nucleoside ABC transporter permease protein NupB | 0.00e+00 | 7.76e-27 | NA | 0.7099 |
| 2. PF | Q8G845 | Fructose import permease protein FruG | 0.00e+00 | 1.20e-14 | NA | 0.641 |
| 2. PF | Q7N2D7 | Autoinducer 2 import system permease protein LsrD | 5.81e-13 | 2.14e-22 | NA | 0.6005 |
| 2. PF | P0AE27 | L-arabinose transport system permease protein AraH | 0.00e+00 | 1.40e-15 | NA | 0.5789 |
| 2. PF | Q1C137 | Autoinducer 2 import system permease protein LsrC | 9.61e-14 | 2.56e-15 | NA | 0.671 |
| 2. PF | P0A2J2 | High-affinity branched-chain amino acid transport system permease protein LivH | 1.68e-13 | 9.13e-13 | NA | 0.7272 |
| 2. PF | A4TQL6 | Autoinducer 2 import system permease protein LsrC | 1.14e-13 | 2.56e-15 | NA | 0.6418 |
| 2. PF | P36948 | Ribose import permease protein RbsC | 7.59e-14 | 3.73e-10 | NA | 0.6765 |
| 2. PF | Q2PBM2 | Autoinducer 2 import system permease protein LsrC | 3.74e-14 | 1.01e-20 | NA | 0.6422 |
| 2. PF | B1JLQ1 | Autoinducer 2 import system permease protein LsrC | 9.59e-14 | 8.65e-16 | NA | 0.6251 |
| 2. PF | Q1C136 | Autoinducer 2 import system permease protein LsrD | 6.23e-13 | 1.60e-22 | NA | 0.6131 |
| 2. PF | Q8X504 | Autoinducer 2 import system permease protein LsrD | 1.30e-10 | 4.44e-21 | NA | 0.6435 |
| 2. PF | P0AGI6 | Xylose transport system permease protein XylH | 0.00e+00 | 1.53e-09 | NA | 0.6027 |
| 2. PF | A8A068 | Autoinducer 2 import system permease protein LsrD | 1.26e-10 | 3.40e-22 | NA | 0.6398 |
| 2. PF | B1LFA0 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 3.00e-22 | NA | 0.6311 |
| 2. PF | P0AGI7 | Xylose transport system permease protein XylH | 0.00e+00 | 1.53e-09 | NA | 0.6066 |
| 2. PF | P44736 | Ribose import permease protein RbsC | 0.00e+00 | 9.53e-13 | NA | 0.6738 |
| 2. PF | Q1CN16 | Autoinducer 2 import system permease protein LsrC | 9.84e-14 | 2.56e-15 | NA | 0.6225 |
| 2. PF | P44885 | Galactoside transport system permease protein MglC | 0.00e+00 | 1.82e-13 | NA | 0.6575 |
| 2. PF | O34500 | Manganese transport system membrane protein MntD | 1.46e-07 | 8.05e-09 | NA | 0.4877 |
| 2. PF | A4WER2 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 1.57e-24 | NA | 0.6694 |
| 2. PF | A8A067 | Autoinducer 2 import system permease protein LsrC | 3.36e-14 | 3.61e-19 | NA | 0.6355 |
| 2. PF | P0AFS2 | Autoinducer 2 import system permease protein LsrD | 1.38e-10 | 3.40e-22 | NA | 0.627 |
| 2. PF | Q8Z2X7 | Autoinducer 2 import system permease protein LsrD | 1.50e-10 | 3.47e-21 | NA | 0.6093 |
| 2. PF | Q8ZKQ3 | Autoinducer 2 import system permease protein LsrC | 2.84e-14 | 1.20e-15 | NA | 0.6703 |
| 2. PF | A6TEB6 | Autoinducer 2 import system permease protein LsrD | 2.96e-13 | 1.57e-24 | NA | 0.66 |
| 2. PF | B1LFA1 | Autoinducer 2 import system permease protein LsrC | 3.42e-14 | 1.33e-19 | NA | 0.6511 |
| 2. PF | B1XEA3 | Autoinducer 2 import system permease protein LsrD | 1.44e-10 | 3.40e-22 | NA | 0.6387 |
| 2. PF | Q5PJE5 | Autoinducer 2 import system permease protein LsrD | 1.10e-10 | 3.02e-21 | NA | 0.6489 |
| 2. PF | Q8XAY8 | Autoinducer 2 import system permease protein LsrC | 2.66e-14 | 1.71e-19 | NA | 0.5975 |
| 2. PF | Q1CN17 | Autoinducer 2 import system permease protein LsrD | 0.00e+00 | 1.60e-22 | NA | 0.6047 |
| 2. PF | Q7N2D8 | Autoinducer 2 import system permease protein LsrC | 2.14e-14 | 3.00e-20 | NA | 0.5901 |
| 2. PF | Q57HE1 | Autoinducer 2 import system permease protein LsrD | 1.08e-10 | 3.18e-21 | NA | 0.6359 |
| 2. PF | A4WER3 | Autoinducer 2 import system permease protein LsrC | 1.21e-13 | 1.40e-17 | NA | 0.6307 |
| 2. PF | B1IRU6 | Autoinducer 2 import system permease protein LsrC | 2.96e-14 | 3.61e-19 | NA | 0.6445 |
| 2. PF | A9R076 | Autoinducer 2 import system permease protein LsrD | 1.56e-10 | 1.60e-22 | NA | 0.5977 |
| 2. PF | Q66EZ0 | Autoinducer 2 import system permease protein LsrC | 9.07e-14 | 7.75e-16 | NA | 0.6287 |
| 2. PF | A9MZG3 | Autoinducer 2 import system permease protein LsrD | 1.08e-10 | 3.18e-21 | NA | 0.6375 |
| 2. PF | P47366 | Uncharacterized protein MG120 | 2.05e-11 | 3.92e-02 | NA | 0.6946 |
| 2. PF | Q9ZDG1 | Uncharacterized protein RP368 | 0.00e+00 | 1.80e-33 | NA | 0.6779 |
| 2. PF | A1JJ53 | Autoinducer 2 import system permease protein LsrD | 4.39e-13 | 4.76e-23 | NA | 0.6121 |
| 2. PF | P0AGI2 | Ribose import permease protein RbsC | 0.00e+00 | 2.20e-09 | NA | 0.6708 |
| 2. PF | A7FMJ9 | Autoinducer 2 import system permease protein LsrD | 1.63e-10 | 2.51e-22 | NA | 0.5972 |
| 2. PF | P0AGI3 | Ribose import permease protein RbsC | 0.00e+00 | 2.20e-09 | NA | 0.6708 |
| 2. PF | Q57HE2 | Autoinducer 2 import system permease protein LsrC | 3.34e-14 | 1.66e-15 | NA | 0.681 |
| 2. PF | Q8ZKQ2 | Autoinducer 2 import system permease protein LsrD | 1.10e-10 | 3.18e-21 | NA | 0.6454 |
| 2. PF | P0AGI5 | Xylose transport system permease protein XylH | 0.00e+00 | 1.53e-09 | NA | 0.6273 |
| 2. PF | Q1JUP6 | L-arabinose ABC transporter permease protein AraH | 0.00e+00 | 1.11e-09 | NA | 0.612 |
| 2. PF | P55569 | Probable ABC transporter permease protein y4mJ | 0.00e+00 | 2.08e-10 | NA | 0.6935 |
| 2. PF | A9MZG2 | Autoinducer 2 import system permease protein LsrC | 3.72e-14 | 2.94e-15 | NA | 0.6811 |
| 2. PF | Q0T4L8 | Autoinducer 2 import system permease protein LsrC | 3.72e-14 | 1.09e-18 | NA | 0.6346 |
| 2. PF | B2K3F9 | Autoinducer 2 import system permease protein LsrD | 6.48e-13 | 2.10e-22 | NA | 0.6001 |
| 2. PF | Q66EZ1 | Autoinducer 2 import system permease protein LsrD | 1.73e-10 | 2.21e-22 | NA | 0.6052 |
| 2. PF | Q8G846 | Fructose import permease protein FruF | 3.76e-13 | 1.74e-15 | NA | 0.6311 |
| 2. PF | P0AEX8 | High-affinity branched-chain amino acid transport system permease protein LivH | 1.90e-13 | 1.97e-12 | NA | 0.7257 |
| 2. PF | A6TEB7 | Autoinducer 2 import system permease protein LsrC | 1.56e-13 | 7.98e-17 | NA | 0.6345 |
| 2. PF | P75515 | Uncharacterized protein MG120 homolog | 9.99e-16 | 4.45e-03 | NA | 0.7212 |
| 2. PF | Q4J711 | Xylose/arabinose import permease protein XylH | 0.00e+00 | 2.02e-18 | NA | 0.6665 |
| 5. P | B4T4N5 | Vitamin B12 import system permease protein BtuC | 3.81e-06 | 4.14e-05 | NA | NA |
| 5. P | B1LE19 | Vitamin B12 import system permease protein BtuC | 1.39e-05 | 6.13e-05 | NA | NA |
| 5. P | B7MVJ0 | Vitamin B12 import system permease protein BtuC | 3.99e-05 | 4.80e-05 | NA | NA |
| 5. P | B4TGH8 | Vitamin B12 import system permease protein BtuC | 3.89e-06 | 4.09e-05 | NA | NA |
| 5. P | P40410 | Iron-uptake system permease protein FeuB | 1.24e-06 | 9.17e-04 | NA | NA |
| 5. P | Q0THB7 | Vitamin B12 import system permease protein BtuC | 1.45e-05 | 3.64e-05 | NA | NA |
| 5. P | A9N235 | Vitamin B12 import system permease protein BtuC | 3.89e-06 | 4.09e-05 | NA | NA |
| 5. P | P44691 | High-affinity zinc uptake system membrane protein ZnuB | 2.70e-08 | 1.53e-08 | NA | NA |
| 5. P | P37737 | Ferric-anguibactin transport system permease protein FatC | 2.67e-06 | 1.29e-12 | NA | NA |
| 5. P | B7N549 | Vitamin B12 import system permease protein BtuC | 2.73e-05 | 4.05e-05 | NA | NA |
| 5. P | Q2YX91 | Probable heme-iron transport system permease protein IsdF | 7.97e-06 | 3.13e-06 | NA | NA |
| 5. P | P45191 | Phosphate transport system permease protein PstC | 1.28e-03 | 3.19e-03 | NA | NA |
| 5. P | P9WG06 | Phosphate transport system permease protein PstC 1 | 2.16e-03 | 1.06e-02 | NA | NA |
| 5. P | P0AFS1 | Autoinducer 2 import system permease protein LsrD | 1.13e-10 | 3.40e-22 | NA | NA |
| 5. P | D4GSY8 | Probable anion ABC transporter permease protein HVO_1887 | 9.88e-03 | 3.16e-03 | NA | NA |
| 5. P | P31309 | Manganese import system permease protein ScaB | 7.11e-08 | 2.00e-07 | NA | NA |
| 5. P | B7LQ78 | Vitamin B12 import system permease protein BtuC | 4.62e-06 | 2.63e-05 | NA | NA |
| 5. P | Q7N3Q3 | Vitamin B12 import system permease protein BtuC | 6.33e-06 | 2.61e-06 | NA | NA |
| 5. P | P55190 | Uncharacterized protein YbaS | 4.40e-04 | 1.90e-04 | NA | NA |
| 5. P | Q9PKW9 | Probable metal transport system membrane protein TC_0342 | NA | 2.32e-11 | NA | NA |
| 5. P | P06609 | Vitamin B12 import system permease protein BtuC | 1.40e-05 | 6.13e-05 | NA | NA |
| 5. P | Q9HQ19 | Cobalamin import system permease protein BtuC | 1.03e-05 | 5.28e-03 | NA | NA |
| 5. P | Q47085 | Achromobactin transport system permease protein CbrB | 4.25e-06 | 2.74e-03 | NA | NA |
| 5. P | P39832 | High-affinity zinc uptake system membrane protein ZnuB | 3.08e-08 | 6.55e-06 | NA | NA |
| 5. P | B5BA35 | Vitamin B12 import system permease protein BtuC | 4.65e-06 | 3.64e-05 | NA | NA |
| 5. P | B5RAW6 | Vitamin B12 import system permease protein BtuC | 4.64e-06 | 4.14e-05 | NA | NA |
| 5. P | B7M1C0 | Vitamin B12 import system permease protein BtuC | 3.56e-05 | 4.01e-05 | NA | NA |
| 5. P | Q8ZKL0 | Pantothenate precursors transporter PanS | 2.35e-04 | 5.64e-03 | NA | NA |
| 5. P | Q87Q39 | Vitamin B12 import system permease protein BtuC | 7.98e-06 | 1.03e-02 | NA | NA |
| 5. P | A8AHA4 | Vitamin B12 import system permease protein BtuC | 3.19e-06 | 1.30e-05 | NA | NA |
| 5. P | Q6RH51 | UPF0324 membrane protein TauZ | 1.78e-03 | 1.12e-02 | NA | NA |
| 5. P | P47548 | Uncharacterized protein MG306 | 9.23e-04 | 2.04e-02 | NA | NA |
| 5. P | Q6D656 | Vitamin B12 import system permease protein BtuC | 6.77e-06 | 1.18e-05 | NA | NA |
| 5. P | O34933 | Fe(3+)-citrate import system permease protein YfmD | 3.51e-06 | 9.93e-04 | NA | NA |
| 5. P | P0AEX7 | High-affinity branched-chain amino acid transport system permease protein LivH | 1.63e-13 | 1.97e-12 | NA | NA |
| 5. P | B7L6I4 | Vitamin B12 import system permease protein BtuC | 3.97e-05 | 4.32e-05 | NA | NA |
| 5. P | Q89AW1 | Putative transport protein bbp_117 | 7.24e-04 | 8.75e-03 | NA | NA |
| 5. P | Q8ZDX4 | Vitamin B12 import system permease protein BtuC | 3.24e-06 | 9.24e-06 | NA | NA |
| 5. P | Q321G8 | Vitamin B12 import system permease protein BtuC | 3.85e-05 | 4.60e-05 | NA | NA |
| 5. P | Q56992 | Hemin transport system permease protein HmuU | 5.54e-06 | 2.08e-04 | NA | NA |
| 5. P | O34382 | Uncharacterized membrane protein YvoD | 9.02e-04 | 9.17e-04 | NA | NA |
| 5. P | Q56954 | Chelated iron transport system membrane protein YfeC | 8.70e-08 | 1.96e-11 | NA | NA |
| 5. P | B7NT65 | Vitamin B12 import system permease protein BtuC | 1.40e-05 | 6.13e-05 | NA | NA |
| 5. P | Q57130 | Molybdate import system permease protein MolB | 1.53e-05 | 4.80e-05 | NA | NA |
| 5. P | P65208 | 2-keto-3-deoxygluconate permease 1 | 3.43e-03 | 7.83e-03 | NA | NA |
| 5. P | Q9Z8J7 | Probable metal transport system membrane protein CPn_0346/CP_0414/CPj0346/CpB0353 | 3.37e-07 | 2.63e-09 | NA | NA |
| 5. P | P73087 | Uncharacterized membrane protein slr2045 | 4.99e-08 | 9.54e-04 | NA | NA |
| 5. P | P57402 | High-affinity zinc uptake system membrane protein ZnuB | 1.80e-08 | 4.79e-06 | NA | NA |
| 5. P | B1JJ25 | Vitamin B12 import system permease protein BtuC | 3.56e-06 | 9.24e-06 | NA | NA |
| 5. P | C4ZYH3 | Vitamin B12 import system permease protein BtuC | 1.43e-05 | 6.13e-05 | NA | NA |
| 5. P | O05731 | Probable iron chelatin transport system permease protein HP_0889 | 6.50e-06 | 7.98e-05 | NA | NA |
| 5. P | B6I8R6 | Vitamin B12 import system permease protein BtuC | 3.71e-05 | 4.70e-05 | NA | NA |
| 5. P | O34832 | Fe(3+)-citrate import system permease protein YfmE | 1.11e-06 | 5.41e-04 | NA | NA |
| 5. P | P94418 | Petrobactin import system permease protein YclN | 5.52e-06 | 1.20e-09 | NA | NA |
| 5. P | P15030 | Fe(3+) dicitrate transport system permease protein FecC | 2.58e-06 | 4.41e-03 | NA | NA |
| 5. P | Q6GHV2 | Probable heme-iron transport system permease protein IsdF | 6.97e-06 | 3.70e-06 | NA | NA |
| 5. P | Q9PBK2 | Phosphate transport system permease protein PstC | 1.29e-03 | 7.06e-03 | NA | NA |
| 5. P | B7US50 | Vitamin B12 import system permease protein BtuC | 3.02e-05 | 4.05e-05 | NA | NA |
| 5. P | B5FJA1 | Vitamin B12 import system permease protein BtuC | 3.96e-06 | 4.09e-05 | NA | NA |
| 5. P | P0AGH8 | Phosphate transport system permease protein PstC | 2.23e-03 | 6.67e-04 | NA | NA |
| 5. P | Q9CNJ5 | Phosphate transport system permease protein PstC | 7.07e-03 | 6.14e-03 | NA | NA |
| 5. P | Q99UX0 | Probable heme-iron transport system permease protein IsdF | 1.79e-05 | 3.70e-06 | NA | NA |
| 5. P | P42362 | Manganese import system permease protein ScaB | 3.86e-06 | 6.92e-09 | NA | NA |
| 5. P | P39328 | Galactofuranose transporter permease protein YtfT | 0.00e+00 | 3.89e-13 | NA | NA |
| 5. P | Q9KD29 | Manganese transport system membrane protein MntC | 2.06e-08 | 2.00e-12 | NA | NA |
| 5. P | Q5PH87 | Vitamin B12 import system permease protein BtuC | 2.64e-06 | 3.64e-05 | NA | NA |
| 5. P | P0AGI1 | Ribose import permease protein RbsC | 0.00e+00 | 2.20e-09 | NA | NA |
| 5. P | Q2PBL9 | Autoinducer 2 import system permease protein LsrC | NA | 6.36e-22 | NA | NA |
| 5. P | Q8FH26 | Vitamin B12 import system permease protein BtuC | 3.54e-05 | 6.07e-05 | NA | NA |
| 5. P | P44661 | Probable iron transport system membrane protein HI_0360 | 7.02e-08 | 2.41e-12 | NA | NA |
| 5. P | A9MFB6 | Vitamin B12 import system permease protein BtuC | 4.72e-06 | 1.04e-04 | NA | NA |
| 5. P | Q8NX64 | Probable heme-iron transport system permease protein IsdF | 9.04e-06 | 4.33e-06 | NA | NA |
| 5. P | O34610 | High-affinity zinc uptake system membrane protein ZnuB | 6.19e-09 | 1.12e-07 | NA | NA |
| 5. P | O31568 | Probable siderophore transport system permease protein YfiZ | 8.38e-06 | 1.03e-04 | NA | NA |
| 5. P | Q2FZE5 | Probable heme-iron transport system permease protein IsdF | 1.08e-05 | 6.70e-06 | NA | NA |
| 5. P | Q08382 | Molybdenum transport system permease protein ModB | 5.69e-03 | 3.54e-03 | NA | NA |
| 5. P | P77672 | Autoinducer 2 import system permease protein LsrC | 2.60e-14 | 5.40e-19 | NA | NA |
| 5. P | B5QVW1 | Vitamin B12 import system permease protein BtuC | 1.11e-05 | 4.14e-05 | NA | NA |
| 5. P | Q0T4S1 | Vitamin B12 import system permease protein BtuC | 3.71e-05 | 7.26e-05 | NA | NA |
| 5. P | P40411 | Iron-uptake system permease protein FeuC | 3.80e-06 | 6.85e-06 | NA | NA |
| 5. P | P23877 | Ferric enterobactin transport system permease protein FepG | 1.45e-07 | 9.45e-04 | NA | NA |
| 5. P | Q7C1M5 | Vitamin B12 import system permease protein BtuC | 3.94e-05 | 5.34e-05 | NA | NA |
| 5. P | Q2YL00 | Probable ABC transporter permease protein BAB2_0490 | 2.44e-03 | 3.17e-02 | NA | NA |
| 5. P | P94419 | Petrobactin import system permease protein YclO | 2.84e-06 | 1.75e-10 | NA | NA |
| 5. P | Q6RH59 | UPF0324 membrane protein TauZ | 4.52e-04 | 1.40e-02 | NA | NA |
| 5. P | P37482 | Uncharacterized transporter YycB | 8.71e-04 | 4.64e-02 | NA | NA |
| 5. P | P65207 | 2-keto-3-deoxygluconate permease 1 | 3.52e-03 | 7.83e-03 | NA | NA |
| 5. P | O34451 | Uncharacterized ABC transporter permease protein YvrB | 4.47e-06 | 1.50e-03 | NA | NA |
| 5. P | Q92YC7 | UPF0324 membrane protein RA0957 | 1.14e-03 | 5.53e-03 | NA | NA |
| 5. P | Q8D927 | Vitamin B12 import system permease protein BtuC | 6.91e-06 | 2.30e-03 | NA | NA |
| 5. P | P0AGI0 | Phosphate transport system permease protein PstC | 9.02e-03 | 6.67e-04 | NA | NA |
| 5. P | B5YPZ9 | Vitamin B12 import system permease protein BtuC | 1.34e-05 | 3.20e-05 | NA | NA |
| 5. P | Q58420 | Probable phosphate transport system permease protein PstC | 1.14e-03 | 3.38e-03 | NA | NA |
| 5. P | Q32FI8 | Vitamin B12 import system permease protein BtuC | 3.03e-05 | 5.29e-05 | NA | NA |
| 5. P | A8GDR2 | Vitamin B12 import system permease protein BtuC | 1.91e-05 | 2.97e-05 | NA | NA |
| 5. P | P45946 | Arsenite resistance protein ArsB | 1.62e-03 | 2.27e-02 | NA | NA |
| 5. P | Q92AG0 | Manganese transport system membrane protein MntC | 1.51e-08 | 2.00e-10 | NA | NA |
| 5. P | P0AGM8 | Uracil permease | 5.95e-03 | 3.62e-02 | NA | NA |
| 5. P | A6TAH6 | Vitamin B12 import system permease protein BtuC | 1.04e-05 | 3.50e-06 | NA | NA |
| 5. P | Q8Y652 | Manganese transport system membrane protein MntC | 1.53e-08 | 1.39e-10 | NA | NA |
| 5. P | P41006 | Uracil permease | 7.10e-03 | 4.89e-03 | NA | NA |
| 5. P | Q8ZPS8 | Vitamin B12 import system permease protein BtuC | 1.07e-05 | 4.09e-05 | NA | NA |
| 5. P | Q57PU6 | Vitamin B12 import system permease protein BtuC | 1.07e-05 | 4.32e-05 | NA | NA |
| 5. P | Q50098 | Phosphate transport system permease protein PstC | 2.38e-03 | 1.20e-02 | NA | NA |
| 5. P | A7FHG9 | Vitamin B12 import system permease protein BtuC | 1.10e-05 | 9.24e-06 | NA | NA |
| 5. P | Q9WXX9 | Probable metal transport system membrane protein TM_0125 | 1.28e-08 | 5.41e-04 | NA | NA |
| 5. P | B7MAS2 | Vitamin B12 import system permease protein BtuC | 1.40e-05 | 6.13e-05 | NA | NA |
| 5. P | Q9KSL2 | Vitamin B12 import system permease protein BtuC | 4.87e-06 | 3.04e-04 | NA | NA |
| 5. P | B0R5G3 | Cobalamin import system permease protein BtuC | 3.47e-06 | 5.28e-03 | NA | NA |
| 5. P | P0AF01 | Molybdenum transport system permease protein ModB | 7.42e-03 | 7.47e-03 | NA | NA |
| 5. P | Q6MN26 | UPF0324 membrane protein Bd1437 | 3.54e-04 | 2.53e-02 | NA | NA |
| 5. P | Q893H9 | UPF0324 membrane protein CTC_01844 | 9.81e-04 | 5.52e-04 | NA | NA |
| 5. P | Q578M9 | Probable ABC transporter permease protein BruAb2_0483 | 2.49e-03 | 3.17e-02 | NA | NA |
| 5. P | P0AGI4 | Xylose transport system permease protein XylH | 0.00e+00 | 1.53e-09 | NA | NA |
| 5. P | P37738 | Ferric-anguibactin transport system permease protein FatD | 1.37e-05 | 2.19e-11 | NA | NA |
| 5. P | Q9Z809 | Probable metal transport system membrane protein CPn_0543/CP_0209/CPj0543/CpB0565 | 8.41e-08 | 9.23e-10 | NA | NA |
| 5. P | Q58286 | Putative ABC transporter permease protein MJ0876 | 7.51e-06 | 1.93e-07 | NA | NA |
| 5. P | P37772 | Inner membrane ABC transporter permease protein YjfF | 0.00e+00 | 3.05e-20 | NA | NA |
| 5. P | Q6LQ76 | Vitamin B12 import system permease protein BtuC | 6.28e-06 | 2.23e-04 | NA | NA |
| 5. P | P0AGM7 | Uracil permease | 6.05e-03 | 3.62e-02 | NA | NA |
| 5. P | O84422 | Probable metal transport system membrane protein CT_417 | 6.02e-09 | 2.34e-09 | NA | NA |
| 5. P | Q9ZKW2 | Probable iron chelatin transport system permease protein jhp_0822 | 6.69e-06 | 1.76e-04 | NA | NA |
| 5. P | P32720 | D-allose transport system permease protein AlsC | 6.01e-14 | 1.82e-08 | NA | NA |
| 5. P | P77315 | Probable ABC transporter permease protein YphD | 0.00e+00 | 1.74e-12 | NA | NA |
| 5. P | P23200 | Galactoside transport system permease protein MglC | 0.00e+00 | 4.70e-13 | NA | NA |
| 5. P | P0AGH9 | Phosphate transport system permease protein PstC | 1.63e-03 | 6.67e-04 | NA | NA |
| 5. P | Q8Z8H3 | 2-keto-3-deoxygluconate permease 2 | 1.15e-02 | 1.58e-02 | NA | NA |
| 5. P | Q55282 | Manganese transport system membrane protein MntB | 2.26e-07 | 1.64e-12 | NA | NA |
| 5. P | P31606 | Uncharacterized membrane protein in ycf23-apcF intergenic region | 6.88e-08 | 2.57e-10 | NA | NA |
| 5. P | Q2FHU7 | Probable heme-iron transport system permease protein IsdF | 1.36e-05 | 3.70e-06 | NA | NA |
| 5. P | A1JPQ9 | Vitamin B12 import system permease protein BtuC | 6.04e-06 | 5.60e-06 | NA | NA |
| 5. P | B1XG18 | Vitamin B12 import system permease protein BtuC | 1.39e-05 | 6.13e-05 | NA | NA |
| 5. P | B2U360 | Vitamin B12 import system permease protein BtuC | 3.81e-05 | 6.74e-05 | NA | NA |
| 5. P | Q57552 | Putative ABC transporter permease protein MJ0087 | 5.15e-06 | 2.82e-02 | NA | NA |
| 5. P | A9R099 | Vitamin B12 import system permease protein BtuC | 8.13e-06 | 9.24e-06 | NA | NA |
| 5. P | Q47086 | Achromobactin transport system permease protein CbrC | 2.88e-06 | 9.97e-03 | NA | NA |
| 5. P | Q8FVS6 | Probable ABC transporter permease protein BRA0749/BS1330_II0742 | 2.41e-03 | 3.62e-02 | NA | NA |
| 5. P | Q6GA81 | Probable heme-iron transport system permease protein IsdF | 1.03e-05 | 4.33e-06 | NA | NA |
| 5. P | A7X154 | Probable heme-iron transport system permease protein IsdF | 6.79e-06 | 3.70e-06 | NA | NA |
| 5. P | A8A0Q3 | Vitamin B12 import system permease protein BtuC | 3.63e-05 | 5.17e-05 | NA | NA |
| 5. P | Q7A651 | Probable heme-iron transport system permease protein IsdF | 8.64e-06 | 3.70e-06 | NA | NA |
| 5. P | A6QG35 | Probable heme-iron transport system permease protein IsdF | 9.74e-06 | 3.70e-06 | NA | NA |
| 5. P | B2K660 | Vitamin B12 import system permease protein BtuC | 9.22e-06 | 9.24e-06 | NA | NA |
| 5. P | P96118 | Zinc transport system membrane protein TroC | 1.08e-07 | 2.82e-06 | NA | NA |
| 5. P | P0AE26 | L-arabinose transport system permease protein AraH | 0.00e+00 | 1.40e-15 | NA | NA |
| 5. P | Q81XB1 | Petrobactin import system permease protein FatD | 1.87e-05 | 7.32e-06 | NA | NA |
| 5. P | O32209 | Putative molybdenum transport system permease protein YvgM | 2.57e-02 | 4.76e-03 | NA | NA |
| 5. P | P0AF02 | Molybdenum transport system permease protein ModB | 8.38e-03 | 7.47e-03 | NA | NA |
| 5. P | Q8ZQZ4 | 2-keto-3-deoxygluconate permease 2 | 1.27e-02 | 1.33e-02 | NA | NA |
| 5. P | Q2NXY9 | 2-keto-3-deoxygluconate permease | 1.33e-03 | 4.44e-02 | NA | NA |
| 5. P | P9WG07 | Phosphate transport system permease protein PstC 1 | 2.01e-03 | 1.06e-02 | NA | NA |
| 5. P | P45045 | Xylose transport system permease protein XylH | NA | 6.95e-13 | NA | NA |
| 5. P | Q5HGV0 | Probable heme-iron transport system permease protein IsdF | 9.40e-06 | 3.70e-06 | NA | NA |
| 5. P | A7ZMH9 | Vitamin B12 import system permease protein BtuC | 4.22e-05 | 4.01e-05 | NA | NA |
| 5. P | Q9TJR4 | Probable sulfate transport system permease protein cysT | 1.16e-02 | 5.35e-04 | NA | NA |
| 5. P | Q89AJ1 | High-affinity zinc uptake system membrane protein ZnuB | 1.65e-08 | 8.09e-07 | NA | NA |
| 5. P | Q3Z259 | Vitamin B12 import system permease protein BtuC | 4.04e-05 | 6.20e-05 | NA | NA |
| 5. P | O83079 | Probable metal transport system membrane protein TP_0036 | 1.97e-07 | 1.74e-09 | NA | NA |
| 5. P | P44660 | Probable iron transport system membrane protein HI_0359 | 4.69e-08 | 7.11e-10 | NA | NA |
| 5. P | O58968 | Probable ABC transporter permease protein PH1215 | 6.18e-03 | 1.82e-03 | NA | NA |
| 5. P | Q56955 | Chelated iron transport system membrane protein YfeD | 5.78e-08 | 9.42e-12 | NA | NA |
| 5. P | A1ABP7 | Vitamin B12 import system permease protein BtuC | 1.37e-05 | 6.13e-05 | NA | NA |
| 5. P | B4TUF7 | Vitamin B12 import system permease protein BtuC | 3.84e-06 | 4.09e-05 | NA | NA |
| 5. P | P15029 | Fe(3+) dicitrate transport system permease protein FecD | 2.72e-06 | 6.22e-04 | NA | NA |
| 5. P | P42361 | Manganese import system permease protein ScaB | 6.02e-09 | 9.35e-10 | NA | NA |
| 5. P | Q55472 | Osmoprotective compounds uptake permease protein GgtC | 6.34e-03 | 1.35e-03 | NA | NA |
| 5. P | O84073 | Probable metal transport system membrane protein CT_070 | 1.94e-07 | 1.33e-11 | NA | NA |
| 5. P | Q1RB84 | Vitamin B12 import system permease protein BtuC | 1.39e-05 | 6.13e-05 | NA | NA |
| 5. P | Q8K9M7 | High-affinity zinc uptake system membrane protein ZnuB | 2.02e-07 | 1.04e-06 | NA | NA |
| 5. P | Q8X4L7 | Vitamin B12 import system permease protein BtuC | 1.35e-05 | 3.20e-05 | NA | NA |
| 5. P | P0A629 | Phosphate transport system permease protein PstC 1 | 2.73e-03 | 1.06e-02 | NA | NA |
| 5. P | P23876 | Ferric enterobactin transport system permease protein FepD | 2.72e-06 | 2.30e-06 | NA | NA |
| 5. P | Q7MLE7 | Vitamin B12 import system permease protein BtuC | 7.04e-06 | 3.51e-03 | NA | NA |
| 5. P | B5F7F5 | Vitamin B12 import system permease protein BtuC | 1.13e-05 | 4.09e-05 | NA | NA |
| 5. P | Q58666 | Probable branched-chain amino acid transport permease protein LivM | 4.55e-12 | 4.30e-24 | NA | NA |
| 5. P | B1IPL6 | Vitamin B12 import system permease protein BtuC | 3.84e-05 | 5.17e-05 | NA | NA |
| 5. P | Q9PJX8 | Probable metal transport system membrane protein TC_0698 | 4.91e-09 | 8.05e-09 | NA | NA |
| 5. P | Q8Z6I5 | Vitamin B12 import system permease protein BtuC | 2.42e-06 | 4.09e-05 | NA | NA |
| 5. P | Q669Z9 | Vitamin B12 import system permease protein BtuC | 3.51e-06 | 9.24e-06 | NA | NA |
| 5. P | O07568 | Uncharacterized protein YhjN | 1.96e-03 | 4.24e-02 | NA | NA |
| 5. P | Q58665 | Probable branched-chain amino acid transport permease protein LivH | 0.00e+00 | 4.39e-25 | NA | NA |
| 5. P | Q87C90 | Phosphate transport system permease protein PstC | 1.26e-03 | 1.16e-02 | NA | NA |
| 6. F | P21628 | High-affinity branched-chain amino acid transport system permease protein BraE | 2.04e-10 | NA | NA | 0.6205 |
| 6. F | P30296 | High-affinity branched-chain amino acid transport system permease protein LivM | 5.33e-15 | NA | NA | 0.6234 |
| 6. F | Q57321 | Galactoside transport system permease protein MglC homolog | 2.17e-07 | NA | NA | 0.6599 |
| 6. F | Q9Z8J6 | Probable metal transport system membrane protein CPn_0347/CP_0413/CPj0347/CpB0354 | 1.61e-07 | NA | NA | 0.5699 |