Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54577.1
JCVISYN3A_0009
Nucleoside ABC transporter permease.
M. mycoides homolog: Q6MUL9.
TIGRfam Classification: 3=Putative.
Category: Essential.
Statistics
Total GO Annotation: 50
Unique PROST Go: 0
Unique BLAST Go: 27
Unique Foldseek Go: 19
Total Homologs: 97
Unique PROST Homologs: 0
Unique BLAST Homologs: 5
Unique Foldseek Homologs: 84
Structures and Sequence Alignment
The best structural homolog that predicted by 3. BF was
O05254
(Guanosine ABC transporter permease protein NupP) with a FATCAT P-Value: 0 and RMSD of 2.38 angstrom. The sequence alignment identity is 13.6%.
Structural alignment shown in left. Query protein AVX54577.1 colored as red in alignment, homolog O05254 colored as blue.
Query protein AVX54577.1 is also shown in right top, homolog O05254 showed in right bottom. They are colored based on secondary structures.
AVX54577.1 MQSKISWTLSKKSKYLFGSDTTKTKLKYIKGSIFSIIVGFIVSGIFLSFLNINPFT----YFALLFGINFDKNFYQI--SLNWMAVYIVAGLSMAIAFKS 94 O05254 --------------------MVK-RLSHLLVPLIAIILG-LAAG-ALIML-VSGYSVASGYSALWNGI-FGE-IYYVGETIRQITPYILSGLAVAFAFRT 74 AVX54577.1 GVFNIGASGQIL---TATS-VATIVFFSISGKDASSITPFMI-I-LMLITCIISAAFIAFIAGILKALFNIHEVVSTILLNW-SVF---YIFKWFFGRYQ 184 O05254 GLFNIGVEGQLLVGWTAAVWVGT-AF---DG-------PAYIHLPLALITAAAAGGLWGFIPGILKARFYVHEVIVTIMMNYIALHMTNYIISNVLTDHQ 163 AVX54577.1 DFSSGLSYTSKNI--P-----SD--QLSIGSNTVIIPLLIALICVIIIWILFSKTVLGFKLKAVGSSITGSKYIGINVKRQIITSLTLSGAVAGIAGFLS 275 O05254 D-KTGKIHESASLRSPFLEQITDYSRLHLG-------IIVALLAAVIMWFIINKSTKGFELRAVGFNQHASQYAGMSVRKNIMTSMLISGAFAGLAG--A 253 AVX54577.1 MFTVSPNNFFASNSLPT-LGFDAIAVSLVAFNNPIGIIAIGWLWAIIKTGGGPISSLYSISTQI-SGLISGILIYFTAIVSVFIAFKPWEL------LKN 367 O05254 MEGLGTFEYAAVKGAFTGVGFDGIAVALLGGNTAVGVV----LAACL-LGGLKIGAL---NMPIESGVPSEVVDIVIAIIILFVA-SSYAIRFVMGKLKK 344 AVX54577.1 K-YNLYTSKVNREIYWKLKLYTFKLRLKKIFLIFTKDYKQEVNNKYQIYTKQNQITNKTSNPHLFWNGRKNIEIELKNDLKQSIYLVKSKIDEIKKFVDQ 466 O05254 KGAN------------------------------------------------------------------------------------------------ 348 AVX54577.1 DKNSLNVSGLKNDLNKQVNLLASKYIQNLRDLDLELADHKYKIQKITSSILNEYQTNIKQAKKTHRLKIQQIKVFKESQIGIITYKFDSHNNIIEIKANK 566 O05254 ---------------------------------------------------------------------------------------------------- 348 AVX54577.1 LKTIAQLKEQIKNIKSELRLEKQISNLNKSSTQTNNSEKLEKIKQLKEQIKVVRKQANAKILEQKNKYKNQKNSVKQEQVQLQDILHQYNNYLNKEKDRF 666 O05254 ---------------------------------------------------------------------------------------------------- 348 AVX54577.1 KESKKAALVLKQKRLQAIDMNLSQSDVNKAVSLLNDLKTLITDNLDLNLNKQAIKSNQKTLKNALEIKSKIDEVLTQNIISEYDAPEHIKQKSKISLTTF 766 O05254 ---------------------------------------------------------------------------------------------------- 348 AVX54577.1 KLITNLKKQISYVITRVEEQELIDKYQQWISQAKQVVQDEKNNYEQIIKKAPRKNLADLENLFNLEKSLKEQTNLKILNLTNTMLKETK 855 O05254 ----------------------------------------------------------------------------------------- 348
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 3. BF | GO:0022857 | transmembrane transporter activity |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0008643 | carbohydrate transport |
| 3. BF | GO:0016021 | integral component of membrane |
| 6. F | GO:0042882 | L-arabinose transmembrane transport |
| 6. F | GO:0015808 | L-alanine transport |
| 6. F | GO:0055085 | transmembrane transport |
| 6. F | GO:0098713 | leucine import across plasma membrane |
| 6. F | GO:0015192 | L-phenylalanine transmembrane transporter activity |
| 6. F | GO:0015823 | phenylalanine transport |
| 6. F | GO:0015188 | L-isoleucine transmembrane transporter activity |
| 6. F | GO:0006865 | amino acid transport |
| 6. F | GO:0042626 | ATPase-coupled transmembrane transporter activity |
| 6. F | GO:0071281 | cellular response to iron ion |
| 6. F | GO:0005304 | L-valine transmembrane transporter activity |
| 6. F | GO:0015190 | L-leucine transmembrane transporter activity |
| 6. F | GO:1903785 | L-valine transmembrane transport |
| 6. F | GO:0015803 | branched-chain amino acid transport |
| 6. F | GO:0010043 | response to zinc ion |
| 6. F | GO:1903806 | L-isoleucine import across plasma membrane |
| 6. F | GO:0042941 | D-alanine transport |
| 6. F | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 6. F | GO:0015658 | branched-chain amino acid transmembrane transporter activity |
| 7. B | GO:0060307 | regulation of ventricular cardiac muscle cell membrane repolarization |
| 7. B | GO:0005887 | integral component of plasma membrane |
| 7. B | GO:0015592 | methylgalactoside transmembrane transporter activity |
| 7. B | GO:0099147 | extrinsic component of postsynaptic density membrane |
| 7. B | GO:0060009 | Sertoli cell development |
| 7. B | GO:0036064 | ciliary basal body |
| 7. B | GO:0033138 | positive regulation of peptidyl-serine phosphorylation |
| 7. B | GO:0097060 | synaptic membrane |
| 7. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 7. B | GO:0034705 | potassium channel complex |
| 7. B | GO:0007194 | negative regulation of adenylate cyclase activity |
| 7. B | GO:0015757 | galactose transmembrane transport |
| 7. B | GO:0120219 | subapical part of cell |
| 7. B | GO:0034237 | protein kinase A regulatory subunit binding |
| 7. B | GO:0060090 | molecular adaptor activity |
| 7. B | GO:0015765 | methylgalactoside transport |
| 7. B | GO:0051661 | maintenance of centrosome location |
| 7. B | GO:0007020 | microtubule nucleation |
| 7. B | GO:0034629 | |
| 7. B | GO:0005354 | galactose transmembrane transporter activity |
| 7. B | GO:0000242 | pericentriolar material |
| 7. B | GO:0097729 | 9+2 motile cilium |
| 7. B | GO:1903358 | regulation of Golgi organization |
| 7. B | GO:0044307 | dendritic branch |
| 7. B | GO:0005795 | Golgi stack |
| 7. B | GO:0015459 | potassium channel regulator activity |
| 7. B | GO:0005801 | cis-Golgi network |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0022857 | transmembrane transporter activity |
| GO:0055085 | transmembrane transport |
| GO:0016021 | integral component of membrane |
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 3. BF | D4GPW2 | Glucose ABC transporter permease protein TsgB13 | 2.22e-16 | NA | 2.47e-12 | 0.8299 |
| 3. BF | A2RKA6 | Nucleoside ABC transporter permease protein NupB | 2.66e-15 | NA | 6.37e-13 | 0.8336 |
| 3. BF | Q57321 | Galactoside transport system permease protein MglC homolog | 5.54e-04 | NA | 0.006 | 0.6135 |
| 3. BF | O05254 | Guanosine ABC transporter permease protein NupP | 0.00e+00 | NA | 1.14e-26 | 0.8458 |
| 3. BF | O83323 | Probable riboflavin import permease protein RfuC | 1.34e-10 | NA | 0.020 | 0.7658 |
| 3. BF | Q56036 | Galactoside transport system permease protein MglC | 2.41e-08 | NA | 0.040 | 0.7254 |
| 3. BF | P75515 | Uncharacterized protein MG120 homolog | 2.41e-10 | NA | 2.83e-28 | 0.6163 |
| 3. BF | P47366 | Uncharacterized protein MG120 | 5.60e-09 | NA | 1.11e-31 | 0.5845 |
| 6. F | Q7CG49 | Autoinducer 2 import system permease protein LsrC | 8.02e-07 | NA | NA | 0.6564 |
| 6. F | B2K3G0 | Autoinducer 2 import system permease protein LsrC | 1.33e-07 | NA | NA | 0.6656 |
| 6. F | Q9F9B1 | Fructose import permease protein FrcC | 2.95e-08 | NA | NA | 0.6631 |
| 6. F | A2RKA5 | Nucleoside ABC transporter permease protein NupC | 5.44e-12 | NA | NA | 0.7235 |
| 6. F | Q2PBM1 | Autoinducer 2 import system permease protein LsrD | 2.69e-07 | NA | NA | 0.7143 |
| 6. F | Q8Z2X6 | Autoinducer 2 import system permease protein LsrC | 4.65e-07 | NA | NA | 0.7001 |
| 6. F | Q83RD8 | Autoinducer 2 import system permease protein LsrC | 1.16e-07 | NA | NA | 0.6994 |
| 6. F | Q7CG48 | Autoinducer 2 import system permease protein LsrD | 7.65e-09 | NA | NA | 0.7214 |
| 6. F | B1JLQ2 | Autoinducer 2 import system permease protein LsrD | 7.79e-09 | NA | NA | 0.7131 |
| 6. F | P21627 | High-affinity branched-chain amino acid transport system permease protein BraD | 7.10e-11 | NA | NA | 0.7159 |
| 6. F | P0A2J1 | High-affinity branched-chain amino acid transport system permease protein LivH | 1.20e-07 | NA | NA | 0.6531 |
| 6. F | Q0T4L7 | Autoinducer 2 import system permease protein LsrD | 1.03e-08 | NA | NA | 0.6973 |
| 6. F | A4TQL7 | Autoinducer 2 import system permease protein LsrD | 7.23e-09 | NA | NA | 0.7231 |
| 6. F | B1IRU5 | Autoinducer 2 import system permease protein LsrD | 9.27e-09 | NA | NA | 0.6968 |
| 6. F | P21628 | High-affinity branched-chain amino acid transport system permease protein BraE | 6.19e-06 | NA | NA | 0.6651 |
| 6. F | A1JJ54 | Autoinducer 2 import system permease protein LsrC | 8.23e-08 | NA | NA | 0.6624 |
| 6. F | A9R075 | Autoinducer 2 import system permease protein LsrC | 1.40e-07 | NA | NA | 0.6549 |
| 6. F | Q5PJE6 | Autoinducer 2 import system permease protein LsrC | 8.24e-08 | NA | NA | 0.706 |
| 6. F | B1XEA2 | Autoinducer 2 import system permease protein LsrC | 2.25e-07 | NA | NA | 0.6958 |
| 6. F | Q2PBL8 | Autoinducer 2 import system permease protein LsrD | 3.69e-07 | NA | NA | 0.6906 |
| 6. F | P75514 | Uncharacterized protein MG121 homolog | 2.68e-09 | NA | NA | 0.792 |
| 6. F | A7FMJ8 | Autoinducer 2 import system permease protein LsrC | 3.01e-06 | NA | NA | 0.7072 |
| 6. F | Q8G845 | Fructose import permease protein FruG | 1.07e-11 | NA | NA | 0.6748 |
| 6. F | Q7N2D7 | Autoinducer 2 import system permease protein LsrD | 1.00e-08 | NA | NA | 0.7042 |
| 6. F | P0AE27 | L-arabinose transport system permease protein AraH | 3.48e-08 | NA | NA | 0.6781 |
| 6. F | Q1C137 | Autoinducer 2 import system permease protein LsrC | 1.35e-07 | NA | NA | 0.666 |
| 6. F | P0A2J2 | High-affinity branched-chain amino acid transport system permease protein LivH | 6.54e-11 | NA | NA | 0.6816 |
| 6. F | A4TQL6 | Autoinducer 2 import system permease protein LsrC | 1.42e-07 | NA | NA | 0.6637 |
| 6. F | P36948 | Ribose import permease protein RbsC | 2.35e-09 | NA | NA | 0.7114 |
| 6. F | Q2PBM2 | Autoinducer 2 import system permease protein LsrC | 5.44e-08 | NA | NA | 0.7068 |
| 6. F | B1JLQ1 | Autoinducer 2 import system permease protein LsrC | 1.19e-07 | NA | NA | 0.6628 |
| 6. F | Q1C136 | Autoinducer 2 import system permease protein LsrD | 6.98e-09 | NA | NA | 0.7162 |
| 6. F | P0AGI6 | Xylose transport system permease protein XylH | 3.79e-04 | NA | NA | 0.6166 |
| 6. F | Q8X504 | Autoinducer 2 import system permease protein LsrD | 8.71e-09 | NA | NA | 0.705 |
| 6. F | A8A068 | Autoinducer 2 import system permease protein LsrD | 3.38e-07 | NA | NA | 0.6809 |
| 6. F | B1LFA0 | Autoinducer 2 import system permease protein LsrD | 5.57e-07 | NA | NA | 0.7052 |
| 6. F | P0AGI7 | Xylose transport system permease protein XylH | 2.58e-04 | NA | NA | 0.6166 |
| 6. F | P44736 | Ribose import permease protein RbsC | 4.16e-09 | NA | NA | 0.6955 |
| 6. F | Q1CN16 | Autoinducer 2 import system permease protein LsrC | 1.14e-07 | NA | NA | 0.666 |
| 6. F | P44885 | Galactoside transport system permease protein MglC | 2.70e-08 | NA | NA | 0.718 |
| 6. F | A4WER2 | Autoinducer 2 import system permease protein LsrD | 4.35e-07 | NA | NA | 0.7258 |
| 6. F | O05255 | Guanosine ABC transporter permease protein NupQ | 9.81e-08 | NA | NA | 0.7071 |
| 6. F | A8A067 | Autoinducer 2 import system permease protein LsrC | 1.63e-07 | NA | NA | 0.7177 |
| 6. F | P0AFS2 | Autoinducer 2 import system permease protein LsrD | 4.83e-07 | NA | NA | 0.6975 |
| 6. F | Q8Z2X7 | Autoinducer 2 import system permease protein LsrD | 2.71e-07 | NA | NA | 0.7227 |
| 6. F | Q8ZKQ3 | Autoinducer 2 import system permease protein LsrC | 9.90e-07 | NA | NA | 0.7042 |
| 6. F | A6TEB6 | Autoinducer 2 import system permease protein LsrD | 4.99e-07 | NA | NA | 0.7166 |
| 6. F | B1LFA1 | Autoinducer 2 import system permease protein LsrC | 7.77e-08 | NA | NA | 0.705 |
| 6. F | B1XEA3 | Autoinducer 2 import system permease protein LsrD | 9.52e-09 | NA | NA | 0.6985 |
| 6. F | Q5PJE5 | Autoinducer 2 import system permease protein LsrD | 2.54e-07 | NA | NA | 0.7376 |
| 6. F | Q8XAY8 | Autoinducer 2 import system permease protein LsrC | 1.35e-07 | NA | NA | 0.6952 |
| 6. F | Q1CN17 | Autoinducer 2 import system permease protein LsrD | 2.89e-07 | NA | NA | 0.7195 |
| 6. F | Q7N2D8 | Autoinducer 2 import system permease protein LsrC | 6.17e-08 | NA | NA | 0.7105 |
| 6. F | P30296 | High-affinity branched-chain amino acid transport system permease protein LivM | 4.76e-06 | NA | NA | 0.6761 |
| 6. F | Q57HE1 | Autoinducer 2 import system permease protein LsrD | 2.68e-07 | NA | NA | 0.7226 |
| 6. F | A4WER3 | Autoinducer 2 import system permease protein LsrC | 1.31e-07 | NA | NA | 0.7061 |
| 6. F | B1IRU6 | Autoinducer 2 import system permease protein LsrC | 1.27e-07 | NA | NA | 0.7095 |
| 6. F | D4GPW1 | Putative glucose ABC transporter permease protein TsgC13 | 1.18e-08 | NA | NA | 0.6852 |
| 6. F | A9R076 | Autoinducer 2 import system permease protein LsrD | 7.71e-09 | NA | NA | 0.7157 |
| 6. F | Q66EZ0 | Autoinducer 2 import system permease protein LsrC | 8.69e-07 | NA | NA | 0.6649 |
| 6. F | A9MZG3 | Autoinducer 2 import system permease protein LsrD | 2.23e-07 | NA | NA | 0.7344 |
| 6. F | Q56955 | Chelated iron transport system membrane protein YfeD | 1.60e-04 | NA | NA | 0.6029 |
| 6. F | Q9ZDG1 | Uncharacterized protein RP368 | 6.63e-06 | NA | NA | 0.7748 |
| 6. F | A1JJ53 | Autoinducer 2 import system permease protein LsrD | 3.84e-07 | NA | NA | 0.7227 |
| 6. F | P47367 | Uncharacterized protein MG121 | 1.89e-13 | NA | NA | 0.817 |
| 6. F | P0AGI2 | Ribose import permease protein RbsC | 1.43e-08 | NA | NA | 0.7271 |
| 6. F | A7FMJ9 | Autoinducer 2 import system permease protein LsrD | 7.90e-09 | NA | NA | 0.7013 |
| 6. F | P0AGI3 | Ribose import permease protein RbsC | 1.01e-08 | NA | NA | 0.7293 |
| 6. F | Q57HE2 | Autoinducer 2 import system permease protein LsrC | 7.20e-07 | NA | NA | 0.6977 |
| 6. F | O83324 | Probable riboflavin import permease protein RfuD | 1.34e-08 | NA | NA | 0.6828 |
| 6. F | Q8ZKQ2 | Autoinducer 2 import system permease protein LsrD | 2.42e-07 | NA | NA | 0.7376 |
| 6. F | P0AGI5 | Xylose transport system permease protein XylH | 3.83e-04 | NA | NA | 0.6083 |
| 6. F | Q8K9M7 | High-affinity zinc uptake system membrane protein ZnuB | 1.61e-04 | NA | NA | 0.5626 |
| 6. F | Q1JUP6 | L-arabinose ABC transporter permease protein AraH | 1.67e-08 | NA | NA | 0.6547 |
| 6. F | P55569 | Probable ABC transporter permease protein y4mJ | 2.95e-08 | NA | NA | 0.7085 |
| 6. F | Q0T4L8 | Autoinducer 2 import system permease protein LsrC | 1.27e-07 | NA | NA | 0.7068 |
| 6. F | A9MZG2 | Autoinducer 2 import system permease protein LsrC | 5.43e-07 | NA | NA | 0.6968 |
| 6. F | Q66EZ1 | Autoinducer 2 import system permease protein LsrD | 8.37e-09 | NA | NA | 0.7114 |
| 6. F | B2K3F9 | Autoinducer 2 import system permease protein LsrD | 7.75e-09 | NA | NA | 0.7203 |
| 6. F | Q8G846 | Fructose import permease protein FruF | 3.06e-09 | NA | NA | 0.6596 |
| 6. F | P0AEX8 | High-affinity branched-chain amino acid transport system permease protein LivH | 5.43e-11 | NA | NA | 0.6796 |
| 6. F | A6TEB7 | Autoinducer 2 import system permease protein LsrC | 1.19e-07 | NA | NA | 0.7079 |
| 6. F | O84073 | Probable metal transport system membrane protein CT_070 | 2.81e-04 | NA | NA | 0.5241 |
| 6. F | Q4J711 | Xylose/arabinose import permease protein XylH | 1.79e-08 | NA | NA | 0.7164 |
| 7. B | Q70FJ1 | A-kinase anchor protein 9 | NA | NA | 5.59e-04 | NA |
| 7. B | P39328 | Galactofuranose transporter permease protein YtfT | 4.61e-07 | NA | 0.006 | NA |
| 7. B | P32720 | D-allose transport system permease protein AlsC | 1.22e-08 | NA | 2.60e-04 | NA |
| 7. B | P77315 | Probable ABC transporter permease protein YphD | 1.67e-08 | NA | 1.32e-04 | NA |
| 7. B | P23200 | Galactoside transport system permease protein MglC | 2.55e-08 | NA | 0.042 | NA |