Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54579.1
JCVISYN3A_0011

Nucleoside ABC transporter substrate-binding protein.
M. mycoides homolog: Q6MUL7.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 30
Unique PROST Go: 17
Unique BLAST Go: 3
Unique Foldseek Go: 7

Total Homologs: 156
Unique PROST Homologs: 40
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 73

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: Ribose/galactose ABC transporter,substrate binding component
Zhang et al. [4]: GO:0008643|carbohydrate transport
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was Q45011 (Basic membrane protein B) with a FATCAT P-Value: 8.93e-09 and RMSD of 3.32 angstrom. The sequence alignment identity is 22.6%.
Structural alignment shown in left. Query protein AVX54579.1 colored as red in alignment, homolog Q45011 colored as blue. Query protein AVX54579.1 is also shown in right top, homolog Q45011 showed in right bottom. They are colored based on secondary structures. 

  AVX54579.1 MKKLLTVLTTFI-GISGSVSMVISCKVPTFAE-GILGQ----RVLVVTDGGNIRDKTFNESSWEGVIKYGSQIHSNFDIKNELEARQFNYKSSIGG-HTK 93
      Q45011 MR-----IVIFIFGI-----LLTSC----FSRNGIESSSKKIKISMLVD-GVLDDKSFNSSANEALLR----LKKDFP-EN-IEEV---FSCAISGVYSS 76

  AVX54579.1 WDETKHMFINEDYEYAKQNSNN------YVETPDHTIDAFRTSYNTAI-YKKADALLLAGFGHLGAVD--YAADRMKKAGNKTVVFLDAQYKKDNVISVI 184
      Q45011 -------YVS-DLDNLKRNGSDLIWLVGYMLT-DASL--LVSSENPKISY--------------GIIDPIY--------GD------DVQI-PENLIAVV 136

  AVX54579.1 FNSELAGFNAGWDAIMWANLPKMTSLNSGEFSKEAIDASNSKTDMVLQGSATGNKYISIGMFGGITNK-NAVDNYMWGLLAAMHVYNN--KFAGKEIELT 281
      Q45011 FRVEQGAFLAGYIA-----------------AK--------K-------SFSG-K---IGFIGGM--KGNIVDAFRYG-------YESGAKYANKDIEII 191

  AVX54579.1 DNKENKVKYKLQPVYYANLGSKAEVEKLNDVN---ESSWFSKGFDV----GGAKKSGIVDSLIKNQADIIFPVAGPQINDVLESTGHKPYVIGVDTDQVT 374
      Q45011 S--E-----------YSN--SFSDV----DIGRTIASKMYSKGIDVIHFAAGLAGIGVIEA-AKN--------LG----D-----GY--YVIGADQDQ-S 251

  AVX54579.1 SVGSSKKGNETRFITSAKKNIVSASVYALNRARSLQKAIIKDKTYTSKHEKEIKDGTTLV--GEQADWSISSSRKADTKWSVEKVNGSLTNAANLSVESI 472
      Q45011 YL-APK--N---FITSVIKNIGDA-LY-L-----ITGEYIKNNN--------VWEGGKVVQMG------L---R--D------GVIG-LPN-AN---E-F 307

  AVX54579.1 DYSKDKAKEIEKNL--KETLLKSG----ETF-KQYLTKTSLDKALESISKSIKDEEWEKLTLKDNGIAGIKNYWEMLIQSTKK 548
      Q45011 EY----IKVLERKIVNKEIIVPCNQEEYEIFIKQIL-K--L------------------------------------------ 341

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
2. PF GO:0043190 ATP-binding cassette (ABC) transporter complex
2. PF GO:0005886 plasma membrane
2. PF GO:0042597 periplasmic space
5. P GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
5. P GO:0015829 valine transport
5. P GO:0051938 L-glutamate import
5. P GO:0006865 amino acid transport
5. P GO:0006817 phosphate ion transport
5. P GO:0052170 suppression by symbiont of host innate immune response
5. P GO:0005618 cell wall
5. P GO:0015820 leucine transport
5. P GO:0016036 cellular response to phosphate starvation
5. P GO:0042301 phosphate ion binding
5. P GO:0016595 glutamate binding
5. P GO:0070728 leucine binding
5. P GO:0035435 phosphate ion transmembrane transport
5. P GO:0043090 amino acid import
5. P GO:0030288 outer membrane-bounded periplasmic space
5. P GO:0051701 biological process involved in interaction with host
5. P GO:0015818 isoleucine transport
6. F GO:0000976 transcription cis-regulatory region binding
6. F GO:0003677 DNA binding
6. F GO:0006164 purine nucleotide biosynthetic process
6. F GO:0045892 negative regulation of transcription, DNA-templated
6. F GO:0008643 carbohydrate transport
6. F GO:0003700 DNA-binding transcription factor activity
6. F GO:0006355 regulation of transcription, DNA-templated
7. B GO:0004222 metalloendopeptidase activity
7. B GO:0005576 extracellular region
7. B GO:0046872 metal ion binding

Uniprot GO Annotations

GO Description
GO:0005886 plasma membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q92BW7 CD4+ T-cell-stimulating antigen 3.16e-06 1.19e-04 0.042 0.585
2. PF Q56328 ABC transporter riboflavin-binding protein RfuA 5.39e-06 7.05e-06 NA 0.5809
2. PF Q1CN18 Autoinducer 2-binding protein LsrB 1.90e-03 7.90e-03 NA 0.458
2. PF O32436 Transcriptional activator protein med 5.68e-06 7.68e-07 NA 0.5742
2. PF Q9V1H5 Uncharacterized lipoprotein PYRAB04520 1.90e-06 9.73e-11 NA 0.4977
2. PF A1JJ52 Autoinducer 2-binding protein LsrB 1.08e-03 1.18e-03 NA 0.4435
2. PF P29724 Membrane lipoprotein TmpC 2.53e-06 6.51e-05 NA 0.5634
2. PF P0C887 Autoinducer 2-binding protein LsrB 1.21e-03 3.71e-03 NA 0.4863
2. PF A8A069 Autoinducer 2-binding protein LsrB 1.46e-03 4.11e-03 NA 0.486
2. PF A4WER1 Autoinducer 2-binding protein LsrB 1.66e-03 1.02e-02 NA 0.5147
2. PF Q45010 Basic membrane protein A 1.02e-06 3.00e-07 NA 0.6294
2. PF Q45011 Basic membrane protein B 8.93e-09 5.98e-05 NA 0.6665
2. PF O59403 Uncharacterized lipoprotein PH1714 3.45e-07 8.29e-10 NA 0.4996
2. PF P0CL55 Basic membrane protein D 3.57e-06 8.34e-08 NA 0.6504
2. PF O31362 Basic membrane protein B 1.62e-08 1.07e-05 NA 0.6674
2. PF Q8XAY9 Autoinducer 2-binding protein LsrB 1.20e-03 1.10e-02 NA 0.4845
2. PF Q74PW2 Autoinducer 2-binding protein LsrB 1.75e-03 7.90e-03 NA 0.457
2. PF A4TQL8 Autoinducer 2-binding protein LsrB 1.84e-03 7.90e-03 NA 0.468
2. PF P0C223 Basic membrane protein A (Fragment) 8.23e-07 1.84e-05 NA 0.6921
2. PF E4QEZ3 Basic membrane protein C 4.36e-05 1.14e-10 NA 0.5995
2. PF O31357 Basic membrane protein A2 2.81e-07 4.11e-07 NA 0.6266
2. PF A7FMK0 Autoinducer 2-binding protein LsrB 1.16e-03 1.12e-02 NA 0.4513
2. PF Q2YKI6 Purine-binding protein BAB2_0673 7.94e-06 8.32e-04 NA 0.545
2. PF E4S1L1 Basic membrane protein D 3.62e-06 8.34e-08 NA 0.6493
2. PF O31284 Basic membrane protein B 1.13e-08 1.96e-05 NA 0.6905
2. PF P75062 Uncharacterized lipoprotein MG040 homolog 2.97e-05 4.87e-10 NA 0.4832
2. PF D4GPW5 Putative ABC transporter glucose-binding protein TsgA13 1.73e-05 5.30e-03 NA 0.4882
2. PF P0CL65 Basic membrane protein C 5.55e-05 1.03e-10 NA 0.5676
2. PF Q48754 CD4+ T-cell-stimulating antigen 3.54e-06 6.24e-05 NA 0.5756
2. PF A9R0S5 Autoinducer 2-binding protein LsrB 1.21e-03 7.90e-03 NA 0.4567
2. PF O05252 ABC transporter guanosine-binding protein NupN 1.15e-06 2.44e-03 NA 0.6323
2. PF A2RK47 ABC transporter nucleoside-binding protein BmpA 7.15e-08 2.21e-05 NA 0.5866
2. PF Q661N6 Basic membrane protein A1 1.52e-07 1.56e-06 NA 0.6127
2. PF B1LF99 Autoinducer 2-binding protein LsrB 1.35e-03 1.10e-02 NA 0.4848
2. PF Q8U0A4 Uncharacterized lipoprotein PF1695 1.89e-07 2.17e-08 NA 0.5029
2. PF B2K3F8 Autoinducer 2-binding protein LsrB 1.80e-03 7.07e-03 NA 0.4568
2. PF P0C888 Autoinducer 2-binding protein LsrB 1.90e-03 2.35e-03 NA 0.4849
2. PF B1JLQ3 Autoinducer 2-binding protein LsrB 1.64e-03 1.12e-02 NA 0.4568
2. PF Q0SND0 Basic membrane protein A 9.87e-07 1.96e-07 NA 0.67
2. PF P47286 Uncharacterized lipoprotein MG040 8.57e-06 1.02e-19 NA 0.5267
5. P Q57A58 Leu/Ile/Val-binding protein homolog 4 9.57e-03 3.15e-02 NA NA
5. P Q2YK58 Leu/Ile/Val-binding protein homolog 7 1.61e-03 8.04e-03 NA NA
5. P P9WGT6 Phosphate-binding protein PstS 3 4.38e-01 9.41e-03 NA NA
5. P Q2PBM5 Autoinducer 2-binding protein LsrB NA 1.94e-03 NA NA
5. P Q577I2 Leu/Ile/Val-binding protein homolog 8 1.68e-03 1.07e-02 NA NA
5. P Q8FWQ3 Leu/Ile/Val-binding protein homolog 8 1.45e-03 1.01e-02 NA NA
5. P Q9CBE5 Phosphate-binding protein PstS 3 2.35e-01 1.86e-02 NA NA
5. P Q2YL86 Leu/Ile/Val-binding protein homolog 4 8.89e-03 3.15e-02 NA NA
5. P P45766 Putative amino-acid ABC transporter-binding protein YhdW NA 1.47e-02 NA NA
5. P A6TEB5 Autoinducer 2-binding protein LsrB 1.65e-03 1.13e-03 NA NA
5. P Q8YBM4 Leu/Ile/Val-binding protein homolog 8 1.42e-03 1.54e-02 NA NA
5. P P0C0J7 46 kDa surface antigen 5.88e-03 3.07e-02 NA NA
5. P P9WGT9 Phosphate-binding protein PstS 2 4.51e-01 4.21e-02 NA NA
5. P P9WGU0 Phosphate-binding protein PstS 1 3.78e-01 2.00e-02 NA NA
5. P A0A0H3M950 Phosphate-binding protein PstS1 3.79e-01 1.47e-02 NA NA
5. P P0A5Y3 Phosphate-binding protein PstS 3 2.82e-01 9.41e-03 NA NA
5. P Q577J0 Leu/Ile/Val-binding protein homolog 7 1.82e-03 8.04e-03 NA NA
5. P P9WGT7 Phosphate-binding protein PstS 3 4.54e-01 9.41e-03 NA NA
5. P Q9KK89 Phosphate-binding protein PstS 3 5.38e-01 2.05e-02 NA NA
5. P Q8FXP1 Leu/Ile/Val-binding protein homolog 4 1.54e-02 3.15e-02 NA NA
5. P Q66EZ2 Autoinducer 2-binding protein LsrB 1.55e-03 7.07e-03 NA NA
5. P Q2YK50 Leu/Ile/Val-binding protein homolog 8 1.49e-03 1.07e-02 NA NA
5. P Q8YDV4 Leu/Ile/Val-binding protein homolog 4 8.73e-03 2.78e-02 NA NA
5. P P9WGT8 Phosphate-binding protein PstS 2 3.85e-01 4.21e-02 NA NA
5. P P76142 Autoinducer 2-binding protein LsrB 1.19e-03 9.94e-03 NA NA
5. P Q49410 High affinity transport system protein p37 4.24e-01 1.46e-02 NA NA
5. P Q52812 General L-amino acid-binding periplasmic protein AapJ 5.81e-01 3.89e-02 NA NA
5. P B1IRU4 Autoinducer 2-binding protein LsrB 1.21e-03 2.46e-03 NA NA
5. P A0A0H3MBK5 Phosphate-binding protein PstS3 2.66e-01 9.41e-03 NA NA
5. P P0C0J8 46 kDa surface antigen 2.42e-03 3.07e-02 NA NA
5. P Q1C135 Autoinducer 2-binding protein LsrB 1.61e-03 7.90e-03 NA NA
5. P P40400 Putative aliphatic sulfonates-binding protein 4.49e-01 1.54e-02 NA NA
5. P Q8FWP6 Leu/Ile/Val-binding protein homolog 7 1.52e-03 6.32e-03 NA NA
5. P Q9K9G5 Formylaminopyrimidine-binding protein 5.23e-01 2.66e-02 NA NA
5. P Q8YBN1 Leu/Ile/Val-binding protein homolog 7 1.52e-03 3.71e-03 NA NA
5. P P58068 Putative amino-acid ABC transporter-binding protein YhdW 4.80e-01 2.55e-02 NA NA
5. P Q58662 Uncharacterized protein MJ1266 1.26e-03 1.97e-04 NA NA
5. P P9WGU1 Phosphate-binding protein PstS 1 4.41e-01 2.00e-02 NA NA
5. P B1XEA4 Autoinducer 2-binding protein LsrB 2.10e-03 9.94e-03 NA NA
5. P A7ZLX3 Autoinducer 2-binding protein LsrB 1.30e-03 2.35e-03 NA NA
6. F B2U2G3 HTH-type transcriptional repressor PurR 2.06e-03 NA NA 0.5091
6. F Q7MB18 Autoinducer 2-binding protein LsrB 1.81e-03 NA NA 0.4611
6. F Q05954 Uncharacterized HTH-type transcriptional regulator SCO4158 1.06e-03 NA NA 0.496
6. F A9MZG4 Autoinducer 2-binding protein LsrB 1.05e-03 NA NA 0.4707
6. F A6VKQ8 D-apiose import binding protein 2.19e-05 NA NA 0.5163
6. F Q5HNH3 Catabolite control protein A 1.50e-03 NA NA 0.516
6. F Q0I4B4 HTH-type transcriptional repressor PurR 3.27e-07 NA NA 0.4806
6. F A8A0K5 HTH-type transcriptional repressor PurR 2.01e-03 NA NA 0.5087
6. F Q7VL44 HTH-type transcriptional repressor PurR 5.33e-03 NA NA 0.501
6. F B5Z492 HTH-type transcriptional repressor PurR 2.03e-03 NA NA 0.5085
6. F Q8Z2X8 Autoinducer 2-binding protein LsrB 1.03e-03 NA NA 0.4908
6. F P44329 Ribose operon repressor 5.64e-04 NA NA 0.5307
6. F B8F4D0 HTH-type transcriptional repressor PurR 5.00e-07 NA NA 0.5058
6. F Q9CPA2 Ribose operon repressor 3.78e-04 NA NA 0.5337
6. F Q8G848 Fructose import binding protein FruE 4.94e-04 NA NA 0.4488
6. F P0ACQ1 Ribose operon repressor 4.51e-04 NA NA 0.5519
6. F Q65TP0 HTH-type transcriptional repressor PurR 1.27e-03 NA NA 0.513
6. F B6EH86 HTH-type transcriptional repressor PurR 9.37e-04 NA NA 0.5436
6. F Q8ZKQ1 Autoinducer 2-binding protein LsrB 1.16e-03 NA NA 0.4904
6. F P96711 Arabinose metabolism transcriptional repressor 4.01e-03 NA NA 0.4488
6. F O07329 Catabolite control protein A 4.97e-04 NA NA 0.4637
6. F A1JP52 HTH-type transcriptional repressor PurR 1.73e-03 NA NA 0.5039
6. F Q57HE0 Autoinducer 2-binding protein LsrB 1.06e-03 NA NA 0.4796
6. F B7VMG4 HTH-type transcriptional repressor PurR 2.39e-07 NA NA 0.526
6. F Q8CNV8 Catabolite control protein A 1.52e-03 NA NA 0.4778
6. F P99175 Catabolite control protein A 1.28e-03 NA NA 0.4475
6. F B5FF00 HTH-type transcriptional repressor PurR 1.55e-07 NA NA 0.5409
6. F Q9JMQ1 Probable HTH-type transcriptional repressor ExuR 7.68e-04 NA NA 0.4753
6. F P0ACQ3 Ribose operon repressor 4.47e-04 NA NA 0.5443
6. F B6IB98 HTH-type transcriptional repressor PurR 2.04e-03 NA NA 0.5082
6. F P74892 Sucrose operon repressor 6.98e-04 NA NA 0.4664
6. F A6VNL0 HTH-type transcriptional repressor PurR 5.38e-04 NA NA 0.5361
6. F B7NBB1 HTH-type transcriptional repressor PurR 1.77e-03 NA NA 0.507
6. F Q9CN88 HTH-type transcriptional repressor PurR 4.33e-04 NA NA 0.5165
6. F Q8NW33 Catabolite control protein A 2.11e-03 NA NA 0.4399
6. F Q8DAQ5 HTH-type transcriptional repressor PurR 2.37e-07 NA NA 0.5324
6. F Q87QW9 HTH-type transcriptional repressor PurR 1.86e-07 NA NA 0.53
6. F B2VEM5 HTH-type transcriptional repressor PurR 1.75e-03 NA NA 0.5093
6. F A7N1L2 HTH-type transcriptional repressor PurR 2.21e-07 NA NA 0.5347
6. F P55568 Probable ABC transporter periplasmic-binding protein y4mI 3.19e-04 NA NA 0.5028
6. F Q56194 Catabolite control protein A 1.50e-03 NA NA 0.4583
6. F B0BP99 HTH-type transcriptional repressor PurR 5.81e-04 NA NA 0.4913
6. F P72396 HTH-type transcriptional regulator MalR 6.25e-04 NA NA 0.4387
6. F P0ACP8 HTH-type transcriptional repressor PurR 2.01e-03 NA NA 0.5088
6. F P0ACQ2 Ribose operon repressor 3.73e-04 NA NA 0.5579
6. F Q5HF38 Catabolite control protein A 2.47e-03 NA NA 0.4275
6. F P46828 Catabolite control protein A 1.80e-03 NA NA 0.5089
6. F Q5E4H9 HTH-type transcriptional repressor PurR 2.54e-04 NA NA 0.5355
6. F Q54430 Sucrose operon repressor 3.57e-06 NA NA 0.4079
6. F B3H1F6 HTH-type transcriptional repressor PurR 4.70e-04 NA NA 0.5087
6. F P0ACP9 HTH-type transcriptional repressor PurR 2.02e-03 NA NA 0.5089
6. F B1IQ96 HTH-type transcriptional repressor PurR 1.85e-03 NA NA 0.5088
6. F Q2PBL7 Autoinducer 2-binding protein LsrB 1.16e-03 NA NA 0.4625
6. F Q321B7 HTH-type transcriptional repressor PurR 2.01e-03 NA NA 0.5088
6. F Q7MJ57 HTH-type transcriptional repressor PurR 1.56e-07 NA NA 0.5113
6. F A9QZB3 HTH-type transcriptional repressor PurR 1.84e-03 NA NA 0.508
6. F B0UUN7 HTH-type transcriptional repressor PurR 6.39e-07 NA NA 0.5017
6. F Q6LQB9 HTH-type transcriptional repressor PurR 2.76e-04 NA NA 0.5349
6. F B1LEM6 HTH-type transcriptional repressor PurR 1.88e-03 NA NA 0.5103
6. F Q6G8J1 Catabolite control protein A 1.35e-03 NA NA 0.4697
6. F P72469 HTH-type transcriptional regulator reg1 5.46e-04 NA NA 0.4568
6. F Q9KRC1 HTH-type transcriptional repressor PurR 4.28e-04 NA NA 0.5235
6. F C4ZYC2 HTH-type transcriptional repressor PurR 1.98e-03 NA NA 0.5092
6. F A5F7H0 HTH-type transcriptional repressor PurR 1.42e-07 NA NA 0.5222
6. F Q6GFX2 Catabolite control protein A 2.47e-03 NA NA 0.4244
6. F A9KNI6 HTH-type transcriptional regulator Cphy_2742 2.06e-03 NA NA 0.4846
6. F C3LN44 HTH-type transcriptional repressor PurR 2.10e-07 NA NA 0.4968
6. F B7NTX5 HTH-type transcriptional repressor PurR 2.01e-03 NA NA 0.5089
6. F Q0T4B4 HTH-type transcriptional repressor PurR 2.00e-03 NA NA 0.5085
6. F P37947 HTH-type transcriptional regulator DegA 1.30e-03 NA NA 0.4772
6. F B7M0L5 HTH-type transcriptional repressor PurR 2.00e-03 NA NA 0.5087
6. F A3N0H9 HTH-type transcriptional repressor PurR 4.13e-04 NA NA 0.4942
6. F B7L5L1 HTH-type transcriptional repressor PurR 2.02e-03 NA NA 0.5083
7. B C0IPP1 Probable neutral protease 2 homolog A 5.96e-01 NA 0.012 NA
7. B D4DGR5 Probable neutral protease 2 homolog TRV_06370 5.22e-01 NA 0.020 NA
7. B D4AM79 Probable neutral protease 2 homolog ARB_04769 4.70e-01 NA 0.020 NA