Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54584.1
JCVISYN3A_0026
Single-stranded DNA-binding protein.
M. mycoides homolog: Q6MUK5.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 33
Unique PROST Go: 12
Unique BLAST Go: 4
Unique Foldseek Go: 5
Total Homologs: 279
Unique PROST Homologs: 11
Unique BLAST Homologs: 4
Unique Foldseek Homologs: 96
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q6GF73
(Single-stranded DNA-binding protein) with a FATCAT P-Value: 0 and RMSD of 1.08 angstrom. The sequence alignment identity is 36.4%.
Structural alignment shown in left. Query protein AVX54584.1 colored as red in alignment, homolog Q6GF73 colored as blue.
Query protein AVX54584.1 is also shown in right top, homolog Q6GF73 showed in right bottom. They are colored based on secondary structures.
AVX54584.1 M-NRVNLVGRITRDLELRVAKNGSKFVFFTVAVSEFSTR---EEKTNYIPCSAFDKTAENMVKYLSKGSLISVEGRITTRNNQTPDGKFETIVNVLAERV 96 Q6GF73 MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVVADSI 100 AVX54584.1 NFLEPSKNRNNMT-----------TEQNDNFTPNQPTQQNSDSSFD-DLVVSDDDELSILWE 146 Q6GF73 QFLEP-KNSND-TQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDD-LPF--- 156
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006260 | DNA replication |
| 1. PBF | GO:0003697 | single-stranded DNA binding |
| 1. PBF | GO:0006281 | DNA repair |
| 1. PBF | GO:0042645 | mitochondrial nucleoid |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0006310 | DNA recombination |
| 1. PBF | GO:0009295 | nucleoid |
| 1. PBF | GO:0051096 | positive regulation of helicase activity |
| 3. BF | GO:0090297 | positive regulation of mitochondrial DNA replication |
| 3. BF | GO:0051289 | protein homotetramerization |
| 3. BF | GO:1905776 | positive regulation of DNA helicase activity |
| 4. PB | GO:0006264 | mitochondrial DNA replication |
| 5. P | GO:0032211 | negative regulation of telomere maintenance via telomerase |
| 5. P | GO:0035861 | site of double-strand break |
| 5. P | GO:0043047 | single-stranded telomeric DNA binding |
| 5. P | GO:0000724 | double-strand break repair via homologous recombination |
| 5. P | GO:0006974 | cellular response to DNA damage stimulus |
| 5. P | GO:0010212 | response to ionizing radiation |
| 5. P | GO:0010521 | telomerase inhibitor activity |
| 5. P | GO:0000781 | chromosome, telomeric region |
| 5. P | GO:1990879 | CST complex |
| 5. P | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 5. P | GO:0044818 | mitotic G2/M transition checkpoint |
| 5. P | GO:0070876 | SOSS complex |
| 6. F | GO:0003682 | chromatin binding |
| 6. F | GO:1990099 | pre-primosome complex |
| 6. F | GO:1990077 | primosome complex |
| 6. F | GO:0005524 | ATP binding |
| 6. F | GO:0006269 | DNA replication, synthesis of RNA primer |
| 7. B | GO:0070584 | mitochondrion morphogenesis |
| 7. B | GO:0009508 | plastid chromosome |
| 7. B | GO:0042644 | chloroplast nucleoid |
| 7. B | GO:0006268 | DNA unwinding involved in DNA replication |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003677 | DNA binding |
| GO:0003697 | single-stranded DNA binding |
| GO:0006260 | DNA replication |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q931K4 | Single-stranded DNA-binding protein 1 | 4.90e-11 | 4.24e-51 | 3.43e-21 | 0.7259 |
| 1. PBF | O69302 | Single-stranded DNA-binding protein | 6.88e-10 | 7.38e-24 | 7.67e-10 | 0.7169 |
| 1. PBF | P57610 | Single-stranded DNA-binding protein | 2.13e-09 | 1.36e-33 | 2.55e-08 | 0.7082 |
| 1. PBF | Q8DXI7 | Single-stranded DNA-binding protein 4 | 3.05e-13 | 3.96e-34 | 7.92e-14 | 0.7927 |
| 1. PBF | P66850 | Single-stranded DNA-binding protein 1 | 7.05e-09 | 3.10e-38 | 1.08e-14 | 0.6683 |
| 1. PBF | Q8K933 | Single-stranded DNA-binding protein | 1.85e-09 | 5.47e-34 | 7.54e-10 | 0.6803 |
| 1. PBF | Q97CX3 | Single-stranded DNA-binding protein 3 | 8.89e-09 | 8.80e-48 | 6.89e-19 | 0.6805 |
| 1. PBF | P0AGE2 | Single-stranded DNA-binding protein | 7.21e-12 | 3.90e-22 | 8.25e-07 | 0.6698 |
| 1. PBF | Q8NLG0 | Single-stranded DNA-binding protein | 1.06e-07 | 8.56e-09 | 3.73e-04 | 0.6146 |
| 1. PBF | Q8KAM2 | Single-stranded DNA-binding protein 2 | 1.82e-07 | 2.39e-25 | 8.48e-06 | 0.7608 |
| 1. PBF | P59927 | Single-stranded DNA-binding protein | 8.91e-11 | 6.69e-25 | 2.60e-08 | 0.7211 |
| 1. PBF | Q8A7M7 | Single-stranded DNA-binding protein | 3.71e-11 | 1.64e-26 | 1.81e-04 | 0.6503 |
| 1. PBF | P59933 | Single-stranded DNA-binding protein | 5.98e-12 | 1.48e-36 | 4.70e-08 | 0.6715 |
| 1. PBF | Q9PHE7 | Single-stranded DNA-binding protein 1 | 4.15e-14 | 5.67e-21 | 6.69e-08 | 0.7535 |
| 1. PBF | P66851 | Single-stranded DNA-binding protein 1 | 3.97e-09 | 3.10e-38 | 1.08e-14 | 0.6628 |
| 1. PBF | Q8KSB6 | Single-stranded DNA-binding protein | 2.53e-07 | 1.69e-30 | 4.99e-07 | 0.6011 |
| 1. PBF | P0A2F6 | Single-stranded DNA-binding protein 1 | 2.64e-12 | 5.93e-22 | 8.14e-07 | 0.6753 |
| 1. PBF | Q8CNK0 | Single-stranded DNA-binding protein | 7.46e-14 | 1.32e-26 | 8.75e-13 | 0.791 |
| 1. PBF | Q89A53 | Single-stranded DNA-binding protein | 1.10e-10 | 1.58e-36 | 1.50e-07 | 0.7247 |
| 1. PBF | P18022 | Plasmid-derived single-stranded DNA-binding protein | 5.20e-09 | 1.32e-22 | 1.45e-06 | 0.648 |
| 1. PBF | Q8R6M2 | Single-stranded DNA-binding protein | 4.06e-11 | 4.16e-43 | 4.15e-11 | 0.8312 |
| 1. PBF | P0A4K1 | Single-stranded DNA-binding protein | 2.26e-13 | 5.76e-10 | 4.25e-06 | 0.8088 |
| 1. PBF | Q98M41 | Single-stranded DNA-binding protein | 8.09e-12 | 1.33e-25 | 4.33e-04 | 0.7029 |
| 1. PBF | P66848 | Single-stranded DNA-binding protein | 4.57e-12 | 8.20e-27 | 4.28e-15 | 0.668 |
| 1. PBF | Q9ZCC2 | Single-stranded DNA-binding protein | 1.59e-09 | 4.79e-28 | 6.10e-07 | 0.6702 |
| 1. PBF | Q8D254 | Single-stranded DNA-binding protein | 1.12e-13 | 2.23e-31 | 2.35e-07 | 0.8297 |
| 1. PBF | Q92G30 | Single-stranded DNA-binding protein | 2.63e-10 | 2.84e-30 | 2.09e-07 | 0.6496 |
| 1. PBF | P28043 | Plasmid-derived single-stranded DNA-binding protein | 3.27e-10 | 1.19e-25 | 5.73e-07 | 0.6576 |
| 1. PBF | Q93GP7 | Single-stranded DNA-binding protein 2 | 5.14e-10 | 1.37e-26 | 3.38e-08 | 0.649 |
| 1. PBF | Q9PDI7 | Single-stranded DNA-binding protein 2 | 7.31e-10 | 1.96e-28 | 0.003 | 0.6646 |
| 1. PBF | Q92FK7 | Single-stranded DNA-binding protein 2 | 6.69e-11 | 2.26e-47 | 1.40e-21 | 0.7479 |
| 1. PBF | Q83EP4 | Single-stranded DNA-binding protein | 1.98e-11 | 1.22e-31 | 3.83e-08 | 0.6667 |
| 1. PBF | Q9WZ73 | Single-stranded DNA-binding protein | 1.20e-13 | 1.95e-31 | 1.37e-09 | 0.7337 |
| 1. PBF | P37455 | Single-stranded DNA-binding protein A | 1.55e-09 | 1.76e-32 | 9.64e-20 | 0.6736 |
| 1. PBF | Q890K1 | Single-stranded DNA-binding protein | 8.96e-11 | 2.45e-16 | 3.63e-15 | 0.673 |
| 1. PBF | Q8EA81 | Single-stranded DNA-binding protein | 1.64e-08 | 3.49e-03 | 1.49e-07 | 0.6874 |
| 1. PBF | P56898 | Single-stranded DNA-binding protein | 2.14e-08 | 4.94e-26 | 6.82e-04 | 0.6669 |
| 1. PBF | P28046 | Single-stranded DNA-binding protein | 1.18e-10 | 5.73e-22 | 1.81e-07 | 0.6926 |
| 1. PBF | Q9CJP4 | Single-stranded DNA-binding protein | 1.07e-10 | 8.15e-30 | 1.17e-06 | 0.6898 |
| 1. PBF | Q5XE77 | Single-stranded DNA-binding protein 1 | 1.33e-15 | 3.18e-22 | 2.95e-07 | 0.8914 |
| 1. PBF | Q9CDM9 | Single-stranded DNA-binding protein 2 | 1.52e-10 | 4.91e-40 | 2.31e-14 | 0.6952 |
| 1. PBF | Q8YAR8 | Single-stranded DNA-binding protein 1 | 3.37e-09 | 9.06e-29 | 2.69e-20 | 0.679 |
| 1. PBF | P0A4K0 | Single-stranded DNA-binding protein 1 | 4.15e-11 | 5.76e-10 | 4.25e-06 | 0.8052 |
| 1. PBF | Q839Y9 | Single-stranded DNA-binding protein | 3.63e-11 | 1.46e-21 | 4.15e-14 | 0.6603 |
| 1. PBF | Q6G7V6 | Single-stranded DNA-binding protein 1 | 7.09e-09 | 3.66e-52 | 1.32e-20 | 0.7588 |
| 1. PBF | P66849 | Single-stranded DNA-binding protein | 9.17e-10 | 8.20e-27 | 4.28e-15 | 0.6593 |
| 1. PBF | Q92FR5 | Single-stranded DNA-binding protein 1 | 7.18e-11 | 9.15e-27 | 2.75e-20 | 0.6822 |
| 1. PBF | P0AGE3 | Single-stranded DNA-binding protein | 4.53e-12 | 3.90e-22 | 8.25e-07 | 0.6647 |
| 1. PBF | Q1RK72 | Single-stranded DNA-binding protein | 1.17e-09 | 3.56e-28 | 8.10e-05 | 0.6587 |
| 1. PBF | Q8DSD8 | Single-stranded DNA-binding protein | 8.13e-12 | 4.30e-39 | 5.50e-12 | 0.674 |
| 1. PBF | Q68Y11 | Single-stranded DNA-binding protein | 4.84e-09 | 9.89e-28 | 2.24e-07 | 0.6499 |
| 1. PBF | Q89L50 | Single-stranded DNA-binding protein | 1.27e-11 | 4.62e-28 | 0.001 | 0.6664 |
| 1. PBF | P18310 | Plasmid-derived single-stranded DNA-binding protein | 1.42e-10 | 2.16e-23 | 2.22e-05 | 0.6452 |
| 1. PBF | Q5XA62 | Single-stranded DNA-binding protein 2 | 1.79e-09 | 1.25e-36 | 7.99e-14 | 0.6754 |
| 1. PBF | Q8G0J1 | Single-stranded DNA-binding protein | 1.86e-10 | 1.10e-24 | 0.005 | 0.6489 |
| 1. PBF | Q847G1 | Single-stranded DNA-binding protein | 9.28e-09 | 2.78e-30 | 2.42e-06 | 0.6878 |
| 1. PBF | Q72UU3 | Single-stranded DNA-binding protein | 4.78e-13 | 9.67e-03 | 0.003 | 0.879 |
| 1. PBF | O51141 | Single-stranded DNA-binding protein | 3.81e-09 | 9.58e-38 | 4.49e-05 | 0.6699 |
| 1. PBF | Q9Z8F7 | Single-stranded DNA-binding protein | 8.29e-06 | 2.75e-34 | 7.87e-04 | 0.6157 |
| 1. PBF | Q8VMM4 | Single-stranded DNA-binding protein | 1.55e-09 | 2.20e-22 | 1.55e-06 | 0.6756 |
| 1. PBF | P25762 | Single-stranded DNA-binding protein | 4.51e-11 | 3.87e-23 | 3.36e-08 | 0.678 |
| 1. PBF | Q8E7H6 | Single-stranded DNA-binding protein 2 | 1.67e-15 | 1.12e-21 | 1.37e-07 | 0.8988 |
| 1. PBF | Q8G757 | Single-stranded DNA-binding protein | 4.01e-09 | 4.91e-10 | 9.55e-06 | 0.6008 |
| 1. PBF | P44409 | Single-stranded DNA-binding protein | 2.18e-12 | 9.36e-28 | 6.60e-07 | 0.7027 |
| 1. PBF | P46390 | Single-stranded DNA-binding protein | 9.03e-08 | 8.77e-33 | 6.94e-07 | 0.5869 |
| 1. PBF | Q9AFI5 | Single-stranded DNA-binding protein | 2.72e-08 | 1.17e-30 | 1.47e-06 | 0.6163 |
| 1. PBF | Q8YHC2 | Single-stranded DNA-binding protein | 3.38e-10 | 1.18e-24 | 0.008 | 0.6527 |
| 1. PBF | Q9A894 | Single-stranded DNA-binding protein | 1.78e-08 | 4.79e-28 | 0.001 | 0.6872 |
| 1. PBF | O84048 | Single-stranded DNA-binding protein | 2.29e-06 | 9.44e-40 | 4.40e-04 | 0.627 |
| 1. PBF | Q8E0Z9 | Single-stranded DNA-binding protein 3 | 9.69e-12 | 1.24e-35 | 1.11e-13 | 0.7376 |
| 1. PBF | Q8L2A6 | Single-stranded DNA-binding protein | 1.20e-10 | 4.15e-19 | 6.13e-06 | 0.6872 |
| 1. PBF | Q9PPT7 | Single-stranded DNA-binding protein | 5.88e-10 | 2.87e-42 | 2.01e-12 | 0.6737 |
| 1. PBF | O83101 | Single-stranded DNA-binding protein | 1.60e-10 | 9.09e-36 | 8.28e-06 | 0.6585 |
| 1. PBF | Q87DQ5 | Single-stranded DNA-binding protein | 7.08e-10 | 4.29e-28 | 0.002 | 0.6814 |
| 1. PBF | Q82FG5 | Single-stranded DNA-binding protein 1 | 1.93e-07 | 3.03e-12 | 1.77e-04 | 0.5926 |
| 1. PBF | P66852 | Single-stranded DNA-binding protein | 4.87e-09 | 1.25e-36 | 7.99e-14 | 0.7082 |
| 1. PBF | Q6GF73 | Single-stranded DNA-binding protein | 0.00e+00 | 4.46e-51 | 5.23e-21 | 0.7337 |
| 1. PBF | P28045 | Plasmid-derived single-stranded DNA-binding protein | 1.91e-08 | 3.44e-26 | 1.32e-06 | 0.6532 |
| 1. PBF | Q932A8 | Single-stranded DNA-binding protein 2 | 4.07e-12 | 1.12e-44 | 1.96e-19 | 0.7123 |
| 1. PBF | Q9PKZ4 | Single-stranded DNA-binding protein | 1.69e-05 | 1.89e-39 | 1.02e-04 | 0.6426 |
| 1. PBF | C0SPB6 | Single-stranded DNA-binding protein B | 1.11e-16 | 1.64e-03 | 3.08e-17 | 0.8768 |
| 1. PBF | Q9ZJY2 | Single-stranded DNA-binding protein | 2.30e-10 | 4.65e-27 | 3.35e-10 | 0.6863 |
| 1. PBF | Q8FLP9 | Single-stranded DNA-binding protein | 3.65e-09 | 4.59e-07 | 1.21e-04 | 0.6007 |
| 1. PBF | Q8P2H3 | Single-stranded DNA-binding protein 1 | 2.61e-14 | 1.91e-21 | 2.00e-14 | 0.8064 |
| 1. PBF | P66854 | Single-stranded DNA-binding protein | 5.34e-10 | 4.69e-47 | 4.48e-13 | 0.7086 |
| 1. PBF | Q9X8U3 | Single-stranded DNA-binding protein 2 | 1.58e-08 | 3.80e-12 | 4.81e-04 | 0.5906 |
| 1. PBF | P59931 | Single-stranded DNA-binding protein | 2.24e-12 | 6.36e-32 | 8.21e-08 | 0.697 |
| 1. PBF | P59928 | Single-stranded DNA-binding protein | 1.30e-12 | 9.16e-22 | 1.55e-06 | 0.6806 |
| 1. PBF | Q8Y4X1 | Single-stranded DNA-binding protein 2 | 4.51e-11 | 2.02e-43 | 1.17e-20 | 0.7402 |
| 1. PBF | Q8KB47 | Single-stranded DNA-binding protein 1 | 2.81e-10 | 5.82e-34 | 1.87e-08 | 0.7053 |
| 1. PBF | O66475 | Single-stranded DNA-binding protein | 6.37e-09 | 5.98e-40 | 6.74e-07 | 0.7761 |
| 1. PBF | P0A2F7 | Single-stranded DNA-binding protein 1 | 4.65e-12 | 5.93e-22 | 8.14e-07 | 0.6991 |
| 1. PBF | Q2YPX7 | Single-stranded DNA-binding protein | 9.16e-10 | 5.21e-24 | 0.005 | 0.6944 |
| 1. PBF | Q928X8 | Single-stranded DNA-binding protein 3 | 4.96e-09 | 1.59e-47 | 2.12e-21 | 0.746 |
| 1. PBF | Q8GAN5 | Single-stranded DNA-binding protein | 7.39e-09 | 3.93e-30 | 3.48e-07 | 0.6001 |
| 1. PBF | P59932 | Single-stranded DNA-binding protein | 3.73e-11 | 4.02e-33 | 1.19e-11 | 0.684 |
| 1. PBF | Q814G6 | Single-stranded DNA-binding protein | 4.19e-11 | 1.75e-36 | 2.37e-23 | 0.731 |
| 1. PBF | Q5HIS8 | Single-stranded DNA-binding protein 1 | 1.26e-11 | 5.88e-33 | 9.84e-18 | 0.6802 |
| 1. PBF | Q8ZJ06 | Single-stranded DNA-binding protein | 2.18e-09 | 3.40e-21 | 3.45e-08 | 0.6719 |
| 1. PBF | Q9RY51 | Single-stranded DNA-binding protein | 1.05e-06 | 9.18e-03 | 3.00e-07 | 0.6386 |
| 1. PBF | Q6GCA6 | Single-stranded DNA-binding protein 2 | 5.96e-12 | 5.88e-33 | 9.84e-18 | 0.68 |
| 1. PBF | Q889U1 | Single-stranded DNA-binding protein | 2.40e-08 | 1.14e-18 | 2.60e-07 | 0.6644 |
| 1. PBF | Q97HT8 | Single-stranded DNA-binding protein 2 | 1.78e-15 | 1.82e-30 | 2.19e-17 | 0.8774 |
| 1. PBF | P0A611 | Single-stranded DNA-binding protein | 1.50e-08 | 2.19e-31 | 8.17e-07 | 0.5784 |
| 1. PBF | Q88QK5 | Single-stranded DNA-binding protein | 3.18e-08 | 3.53e-20 | 3.63e-06 | 0.6635 |
| 1. PBF | P0DF77 | Single-stranded DNA-binding protein | 6.41e-10 | 1.25e-36 | 7.99e-14 | 0.6653 |
| 1. PBF | Q8DCJ0 | Single-stranded DNA-binding protein | 8.10e-11 | 1.73e-17 | 1.43e-07 | 0.7037 |
| 1. PBF | Q8EWT6 | Single-stranded DNA-binding protein | 2.25e-08 | 1.78e-20 | 5.82e-13 | 0.681 |
| 1. PBF | Q8NVN2 | Single-stranded DNA-binding protein | 5.01e-10 | 3.66e-52 | 1.32e-20 | 0.7609 |
| 1. PBF | P66846 | Single-stranded DNA-binding protein | 9.09e-11 | 6.80e-23 | 1.63e-06 | 0.692 |
| 1. PBF | Q8NZJ0 | Single-stranded DNA-binding protein 2 | 9.51e-10 | 6.02e-37 | 1.17e-13 | 0.6739 |
| 1. PBF | Q9CGS5 | Single-stranded DNA-binding protein 1 | 7.50e-12 | 3.98e-45 | 2.25e-15 | 0.7883 |
| 1. PBF | Q8RE26 | Single-stranded DNA-binding protein | 5.59e-10 | 2.41e-54 | 4.82e-11 | 0.687 |
| 1. PBF | Q8F052 | Single-stranded DNA-binding protein | 6.23e-13 | 9.67e-03 | 0.003 | 0.88 |
| 1. PBF | Q81JI3 | Single-stranded DNA-binding protein | 1.41e-12 | 1.13e-33 | 2.42e-23 | 0.743 |
| 1. PBF | Q8E220 | Single-stranded DNA-binding protein 2 | 5.55e-16 | 1.65e-22 | 2.47e-07 | 0.7218 |
| 1. PBF | Q8CX55 | Single-stranded DNA-binding protein | 5.78e-10 | 2.74e-42 | 5.35e-20 | 0.6903 |
| 1. PBF | Q87LA3 | Single-stranded DNA-binding protein | 1.47e-10 | 1.84e-21 | 1.79e-08 | 0.6504 |
| 1. PBF | P59930 | Single-stranded DNA-binding protein | 1.94e-10 | 4.70e-25 | 1.21e-08 | 0.7109 |
| 1. PBF | Q55499 | Single-stranded DNA-binding protein 1 | 7.77e-16 | 3.54e-09 | 8.27e-08 | 0.9192 |
| 1. PBF | Q8UF87 | Single-stranded DNA-binding protein | 6.53e-10 | 1.16e-21 | 5.95e-04 | 0.6116 |
| 1. PBF | Q99SQ9 | Single-stranded DNA-binding protein | 0.00e+00 | 2.36e-51 | 3.33e-21 | 0.7442 |
| 1. PBF | Q9ZAQ8 | Single-stranded DNA-binding protein | 1.73e-09 | 6.24e-26 | 7.33e-08 | 0.6803 |
| 1. PBF | P28044 | Plasmid-derived single-stranded DNA-binding protein | 2.58e-10 | 2.03e-27 | 4.41e-07 | 0.6441 |
| 1. PBF | Q9RHF4 | Single-stranded DNA-binding protein 2 | 6.11e-11 | 3.20e-24 | 1.92e-06 | 0.698 |
| 1. PBF | Q98PV9 | Single-stranded DNA-binding protein | 1.33e-08 | 6.23e-30 | 1.35e-08 | 0.6265 |
| 1. PBF | Q82S98 | Single-stranded DNA-binding protein | 9.57e-11 | 1.06e-30 | 1.11e-08 | 0.7056 |
| 1. PBF | Q8DIU1 | Single-stranded DNA-binding protein | 4.44e-15 | 6.71e-12 | 3.61e-05 | 0.8214 |
| 1. PBF | P77953 | Single-stranded DNA-binding protein | 1.75e-08 | 3.40e-07 | 5.64e-07 | 0.6718 |
| 1. PBF | Q4UJW3 | Single-stranded DNA-binding protein | 1.60e-11 | 1.01e-29 | 5.78e-08 | 0.6512 |
| 1. PBF | P0C118 | Single-stranded DNA-binding protein | 9.76e-10 | 5.21e-24 | 0.005 | 0.69 |
| 1. PBF | P66855 | Single-stranded DNA-binding protein | 8.00e-09 | 4.69e-47 | 4.48e-13 | 0.6901 |
| 1. PBF | Q5HJ26 | Single-stranded DNA-binding protein 2 | 3.01e-12 | 2.89e-41 | 1.06e-17 | 0.7312 |
| 1. PBF | O25841 | Single-stranded DNA-binding protein | 1.74e-10 | 2.07e-28 | 1.74e-09 | 0.6806 |
| 1. PBF | Q899R2 | Single-stranded DNA-binding protein | 2.27e-10 | 5.61e-48 | 3.08e-19 | 0.7135 |
| 1. PBF | P0AGE1 | Single-stranded DNA-binding protein | 6.02e-10 | 3.90e-22 | 8.25e-07 | 0.6825 |
| 1. PBF | Q9K5N9 | Single-stranded DNA-binding protein | 6.20e-12 | 2.25e-38 | 4.76e-22 | 0.671 |
| 1. PBF | Q8Y2B4 | Single-stranded DNA-binding protein | 3.83e-09 | 3.88e-21 | 5.47e-05 | 0.6683 |
| 1. PBF | P9WGD4 | Single-stranded DNA-binding protein | 4.16e-08 | 2.19e-31 | 8.17e-07 | 0.5781 |
| 1. PBF | P0DF76 | Single-stranded DNA-binding protein | 5.38e-09 | 1.25e-36 | 7.99e-14 | 0.678 |
| 1. PBF | P66847 | Single-stranded DNA-binding protein | 9.28e-11 | 6.80e-23 | 1.63e-06 | 0.6903 |
| 1. PBF | Q823K0 | Single-stranded DNA-binding protein | 4.26e-06 | 2.72e-38 | 8.27e-04 | 0.5983 |
| 1. PBF | Q9KUW2 | Single-stranded DNA-binding protein | 2.90e-12 | 2.88e-19 | 6.69e-11 | 0.7039 |
| 1. PBF | Q8XH44 | Single-stranded DNA-binding protein | 4.60e-08 | 5.36e-45 | 1.32e-14 | 0.6442 |
| 1. PBF | P40947 | Single-stranded DNA-binding protein | 5.89e-10 | 8.30e-30 | 2.65e-07 | 0.6636 |
| 2. PF | Q9KYI9 | Single-stranded DNA-binding protein 1 | 5.89e-07 | 9.43e-21 | NA | 0.5415 |
| 2. PF | Q83NU2 | Single-stranded DNA-binding protein 1 | 2.51e-10 | 1.79e-27 | NA | 0.6158 |
| 2. PF | P66857 | Single-stranded DNA-binding protein 2 | 2.15e-06 | 3.21e-16 | NA | 0.5606 |
| 2. PF | P49536 | Putative single-stranded DNA-binding protein ycf41 | 8.85e-09 | 4.44e-02 | NA | 0.7618 |
| 2. PF | P73145 | Thylakoid-associated single-stranded DNA-binding protein slr1034 | 3.53e-11 | 1.36e-30 | NA | 0.7972 |
| 2. PF | Q8ZSD2 | Single-stranded DNA-binding protein 2 | 4.06e-11 | 1.71e-15 | NA | 0.7345 |
| 2. PF | Q8P778 | Single-stranded DNA-binding protein | 3.55e-11 | 6.57e-23 | NA | 0.707 |
| 2. PF | P47337 | Single-stranded DNA-binding protein | 1.73e-07 | 5.59e-34 | NA | 0.8064 |
| 2. PF | Q8PIJ2 | Single-stranded DNA-binding protein | 1.51e-10 | 9.58e-20 | NA | 0.7125 |
| 2. PF | P51237 | Putative single-stranded DNA-binding protein ycf41 | 2.58e-04 | 1.69e-03 | NA | 0.6686 |
| 2. PF | Q83N34 | Single-stranded DNA-binding protein 1 | 4.10e-09 | 2.45e-28 | NA | 0.6162 |
| 2. PF | P75542 | Single-stranded DNA-binding protein | 7.65e-11 | 2.38e-34 | NA | 0.6429 |
| 2. PF | P66856 | Single-stranded DNA-binding protein 2 | 1.89e-06 | 3.21e-16 | NA | 0.562 |
| 2. PF | Q82CI4 | Single-stranded DNA-binding protein 2 | 1.94e-07 | 1.02e-22 | NA | 0.5105 |
| 3. BF | Q5SLP9 | Single-stranded DNA-binding protein | 2.34e-08 | NA | 3.53e-04 | 0.8354 |
| 3. BF | Q97KH4 | Single-stranded DNA-binding protein 1 | 2.13e-14 | NA | 2.26e-15 | 0.8878 |
| 3. BF | Q5RDQ0 | Single-stranded DNA-binding protein, mitochondrial | 5.19e-13 | NA | 0.027 | 0.7168 |
| 3. BF | O85824 | Single-stranded DNA-binding protein | 2.27e-07 | NA | 3.49e-04 | 0.7272 |
| 3. BF | Q9KH06 | Single-stranded DNA-binding protein | 3.83e-06 | NA | 0.001 | 0.7843 |
| 3. BF | P60471 | Single-stranded DNA-binding protein | 1.11e-16 | NA | 2.15e-10 | 0.8912 |
| 4. PB | P9WGD5 | Single-stranded DNA-binding protein | 1.62e-08 | 2.19e-31 | 8.17e-07 | NA |
| 4. PB | Q9XJG4 | Single-stranded DNA-binding protein | NA | 6.11e-32 | 1.59e-06 | NA |
| 4. PB | P0AGE0 | Single-stranded DNA-binding protein | 9.73e-12 | 3.90e-22 | 8.25e-07 | NA |
| 5. P | O31908 | SPbeta prophage-derived uncharacterized protein YorF | 1.11e-03 | 8.94e-03 | NA | NA |
| 5. P | Q5FVP2 | SOSS complex subunit B2 | 1.86e-04 | 5.80e-04 | NA | NA |
| 5. P | Q8BGW5 | SOSS complex subunit B2 | 6.29e-04 | 3.93e-03 | NA | NA |
| 5. P | O21902 | SSB protein | NA | 6.06e-10 | NA | NA |
| 5. P | Q97W73 | Single-stranded DNA binding protein Ssb | 4.86e-04 | 7.17e-05 | NA | NA |
| 5. P | Q54X41 | SOSS complex subunit B homolog | 2.60e-03 | 2.64e-03 | NA | NA |
| 5. P | Q9D7K2 | CST complex subunit TEN1 | 4.00e-04 | 6.93e-03 | NA | NA |
| 5. P | O45595 | Protection of telomeres homolog 2 | 7.11e-02 | 7.12e-03 | NA | NA |
| 5. P | Q6JM09 | SSB protein | NA | 8.66e-10 | NA | NA |
| 5. P | Q9SX99 | Protein OSB1, mitochondrial | 3.31e-06 | 1.31e-03 | NA | NA |
| 5. P | O14087 | Single-stranded DNA-binding protein rim1, mitochondrial | 4.07e-07 | 2.64e-02 | NA | NA |
| 6. F | P67676 | Primosomal replication protein N | 8.92e-09 | NA | NA | 0.7147 |
| 6. F | Q9PQB4 | DNA polymerase III PolC-type | 5.89e-01 | NA | NA | 0.6109 |
| 6. F | Q57GJ0 | Primosomal replication protein N | 1.15e-08 | NA | NA | 0.7128 |
| 6. F | A7MM77 | Primosomal replication protein N | 1.45e-08 | NA | NA | 0.7126 |
| 6. F | Q3YUE6 | Primosomal replication protein N | 9.51e-09 | NA | NA | 0.7144 |
| 6. F | Q7VMD6 | Primosomal replication protein N | 2.19e-08 | NA | NA | 0.6455 |
| 6. F | A9MFL0 | Primosomal replication protein N | 1.28e-08 | NA | NA | 0.7107 |
| 6. F | Q8EAH3 | Primosomal replication protein N | 8.99e-09 | NA | NA | 0.7252 |
| 6. F | P75224 | Uncharacterized protein MG376 homolog | 2.29e-07 | NA | NA | 0.7024 |
| 6. F | B5BKL0 | Primosomal replication protein N | 1.15e-08 | NA | NA | 0.7127 |
| 6. F | A7ZV72 | Primosomal replication protein N | 8.99e-09 | NA | NA | 0.7144 |
| 6. F | Q9CLN9 | Primosomal replication protein N | 7.25e-08 | NA | NA | 0.7157 |
| 6. F | B1KHY9 | Primosomal replication protein N | 8.57e-09 | NA | NA | 0.741 |
| 6. F | P67674 | Primosomal replication protein N | 2.52e-09 | NA | NA | 0.7411 |
| 6. F | B3GY58 | Primosomal replication protein N | 5.30e-08 | NA | NA | 0.6542 |
| 6. F | C6DE14 | Primosomal replication protein N | 1.83e-08 | NA | NA | 0.7109 |
| 6. F | Q7MH89 | Primosomal replication protein N | 3.86e-08 | NA | NA | 0.7704 |
| 6. F | B5R9E9 | Primosomal replication protein N | 1.17e-08 | NA | NA | 0.7124 |
| 6. F | A4Y3F1 | Primosomal replication protein N | 1.31e-08 | NA | NA | 0.7232 |
| 6. F | B5F3B8 | Primosomal replication protein N | 1.41e-08 | NA | NA | 0.7111 |
| 6. F | P09380 | Single-stranded DNA-binding protein 1-A, mitochondrial | 2.01e-12 | NA | NA | 0.7681 |
| 6. F | Q0T9J2 | Primosomal replication protein N | 9.90e-09 | NA | NA | 0.7151 |
| 6. F | B5FSA2 | Primosomal replication protein N | 1.15e-08 | NA | NA | 0.7125 |
| 6. F | A1JIS9 | Primosomal replication protein N | 1.78e-08 | NA | NA | 0.71 |
| 6. F | Q31TD2 | Primosomal replication protein N | 8.46e-09 | NA | NA | 0.7145 |
| 6. F | P67673 | Primosomal replication protein N | 5.83e-09 | NA | NA | 0.7359 |
| 6. F | Q8DCL5 | Primosomal replication protein N | 5.42e-08 | NA | NA | 0.7705 |
| 6. F | Q8ZB82 | Primosomal replication protein N | 2.07e-08 | NA | NA | 0.7079 |
| 6. F | A8FR96 | Primosomal replication protein N | 1.35e-08 | NA | NA | 0.7364 |
| 6. F | Q6D136 | Primosomal replication protein N | 1.64e-08 | NA | NA | 0.7113 |
| 6. F | A8A7U7 | Primosomal replication protein N | 9.05e-09 | NA | NA | 0.7145 |
| 6. F | A1AJA6 | Primosomal replication protein N | 9.30e-09 | NA | NA | 0.7147 |
| 6. F | Q9JZ30 | Primosomal replication protein N | 6.47e-08 | NA | NA | 0.6792 |
| 6. F | B0BQB2 | Primosomal replication protein N | 3.95e-08 | NA | NA | 0.6507 |
| 6. F | B8E9N7 | Primosomal replication protein N | 1.01e-08 | NA | NA | 0.715 |
| 6. F | Q32PB0 | Single-stranded DNA-binding protein, mitochondrial | 5.79e-12 | NA | NA | 0.7061 |
| 6. F | Q328J8 | Primosomal replication protein N | 3.24e-09 | NA | NA | 0.725 |
| 6. F | Q0I4E6 | Primosomal replication protein N | 4.23e-08 | NA | NA | 0.7039 |
| 6. F | B7M9G3 | Primosomal replication protein N | 9.23e-09 | NA | NA | 0.7144 |
| 6. F | B0TUU8 | Primosomal replication protein N | 1.34e-08 | NA | NA | 0.6669 |
| 6. F | Q9KUZ1 | Primosomal replication protein N | 1.02e-08 | NA | NA | 0.7708 |
| 6. F | Q1CBW5 | Primosomal replication protein N | 2.01e-08 | NA | NA | 0.7082 |
| 6. F | Q4QN02 | Primosomal replication protein N | 4.40e-08 | NA | NA | 0.7073 |
| 6. F | A7FMW4 | Primosomal replication protein N | 1.93e-08 | NA | NA | 0.7088 |
| 6. F | B6I2A7 | Primosomal replication protein N | 9.20e-09 | NA | NA | 0.7145 |
| 6. F | B5R0R9 | Primosomal replication protein N | 1.21e-08 | NA | NA | 0.7124 |
| 6. F | B4F276 | Primosomal replication protein N | 8.47e-09 | NA | NA | 0.7078 |
| 6. F | B4TFD6 | Primosomal replication protein N | 1.23e-08 | NA | NA | 0.7124 |
| 6. F | B7NGD5 | Primosomal replication protein N | 8.26e-09 | NA | NA | 0.715 |
| 6. F | A9LZQ2 | Primosomal replication protein N | 1.37e-07 | NA | NA | 0.6805 |
| 6. F | A6WJ80 | Primosomal replication protein N | 9.66e-09 | NA | NA | 0.7278 |
| 6. F | A1KUE9 | Primosomal replication protein N | 5.98e-08 | NA | NA | 0.6794 |
| 6. F | P44748 | Primosomal replication protein N | 4.50e-08 | NA | NA | 0.7109 |
| 6. F | A9L121 | Primosomal replication protein N | 1.07e-08 | NA | NA | 0.7246 |
| 6. F | Q6LM42 | Primosomal replication protein N | 3.71e-08 | NA | NA | 0.7574 |
| 6. F | Q5PJ57 | Primosomal replication protein N | 1.41e-08 | NA | NA | 0.7107 |
| 6. F | B7UQL0 | Primosomal replication protein N | 8.72e-09 | NA | NA | 0.7151 |
| 6. F | A4W5T0 | Primosomal replication protein N | 1.12e-08 | NA | NA | 0.7153 |
| 6. F | A3D8Q4 | Primosomal replication protein N | 9.04e-09 | NA | NA | 0.7394 |
| 6. F | Q1CEH1 | Primosomal replication protein N | 1.76e-08 | NA | NA | 0.7055 |
| 6. F | A8AMJ7 | Primosomal replication protein N | 1.01e-08 | NA | NA | 0.7125 |
| 6. F | C0Q6F9 | Primosomal replication protein N | 1.19e-08 | NA | NA | 0.7121 |
| 6. F | B7LLY3 | Primosomal replication protein N | 8.83e-09 | NA | NA | 0.7146 |
| 6. F | B7MT75 | Primosomal replication protein N | 9.47e-09 | NA | NA | 0.7143 |
| 6. F | Q5F924 | Primosomal replication protein N | 1.31e-07 | NA | NA | 0.7038 |
| 6. F | C4ZR78 | Primosomal replication protein N | 9.76e-09 | NA | NA | 0.7133 |
| 6. F | P67677 | Primosomal replication protein N | 9.53e-09 | NA | NA | 0.7143 |
| 6. F | A8H8L1 | Primosomal replication protein N | 1.19e-08 | NA | NA | 0.6671 |
| 6. F | Q57YG2 | Uncharacterized protein Tb927.8.680, mitochondrial | 5.38e-06 | NA | NA | 0.5963 |
| 6. F | B4TT34 | Primosomal replication protein N | 1.04e-08 | NA | NA | 0.7128 |
| 6. F | B7IE30 | Aspartate--tRNA ligase | 3.41e-02 | NA | NA | 0.5362 |
| 6. F | Q1R359 | Primosomal replication protein N | 1.16e-08 | NA | NA | 0.7139 |
| 6. F | B7LCR2 | Primosomal replication protein N | 9.21e-09 | NA | NA | 0.7145 |
| 6. F | Q7MYU8 | Primosomal replication protein N | 8.96e-09 | NA | NA | 0.7112 |
| 6. F | B2TY74 | Primosomal replication protein N | 9.07e-09 | NA | NA | 0.7147 |
| 6. F | P47616 | Uncharacterized protein MG376 | 8.33e-08 | NA | NA | 0.6391 |
| 6. F | B4T3F2 | Primosomal replication protein N | 1.37e-08 | NA | NA | 0.7116 |
| 6. F | Q95KK4 | Single-stranded DNA-binding protein, mitochondrial | 4.30e-11 | NA | NA | 0.707 |
| 6. F | A1RNI8 | Primosomal replication protein N | 1.07e-08 | NA | NA | 0.7244 |
| 6. F | B1IT05 | Primosomal replication protein N | 8.92e-09 | NA | NA | 0.7146 |
| 6. F | A8G8W5 | Primosomal replication protein N | 1.90e-08 | NA | NA | 0.7109 |
| 6. F | B2VCW0 | Primosomal replication protein N | 9.71e-09 | NA | NA | 0.7126 |
| 6. F | Q82XQ7 | Primosomal replication protein N | 1.20e-07 | NA | NA | 0.7265 |
| 6. F | P67675 | Primosomal replication protein N | 6.06e-09 | NA | NA | 0.7373 |
| 6. F | A3N1H2 | Primosomal replication protein N | 4.87e-08 | NA | NA | 0.6503 |
| 6. F | B8CIQ2 | Primosomal replication protein N | 9.98e-09 | NA | NA | 0.7051 |
| 6. F | A6VMD5 | Primosomal replication protein N | 2.50e-08 | NA | NA | 0.7473 |
| 6. F | Q9JU25 | Primosomal replication protein N | 1.27e-07 | NA | NA | 0.7033 |
| 6. F | B7MLK6 | Primosomal replication protein N | 1.23e-08 | NA | NA | 0.7133 |
| 6. F | Q87L73 | Primosomal replication protein N | 2.40e-08 | NA | NA | 0.7251 |
| 6. F | Q66FA1 | Primosomal replication protein N | 1.88e-08 | NA | NA | 0.711 |
| 6. F | A5U9U9 | Primosomal replication protein N | 4.28e-08 | NA | NA | 0.7105 |
| 6. F | Q8Z164 | Primosomal replication protein N | 1.29e-08 | NA | NA | 0.7125 |
| 6. F | P09381 | Single-stranded DNA-binding protein 1-B, mitochondrial | 1.56e-11 | NA | NA | 0.7991 |
| 6. F | B0US44 | Primosomal replication protein N | 3.32e-08 | NA | NA | 0.7088 |
| 6. F | Q8ZK82 | Primosomal replication protein N | 1.19e-08 | NA | NA | 0.7124 |
| 7. B | P32445 | Single-stranded DNA-binding protein RIM1, mitochondrial | 2.86e-10 | NA | 0.009 | NA |
| 7. B | Q04837 | Single-stranded DNA-binding protein, mitochondrial | 7.48e-13 | NA | 0.023 | NA |
| 7. B | P34496 | Single-stranded DNA-binding protein, mitochondrial | 1.96e-08 | NA | 1.70e-04 | NA |
| 7. B | Q8GXH3 | Protein OSB2, chloroplastic | 4.49e-04 | NA | 0.011 | NA |