Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54590.1
JCVISYN3A_0039
Membrane anchored AAA+ protease.
M. mycoides homolog: Q6MUJ2.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 345
Unique PROST Go: 49
Unique BLAST Go: 123
Unique Foldseek Go: 9
Total Homologs: 2028
Unique PROST Homologs: 0
Unique BLAST Homologs: 992
Unique Foldseek Homologs: 506
Literature
Danchin and Fang [1]: membrane protease involved in cell division|PPG conserved in ATP binding site
Yang and Tsui [2]: ATP-dependent zinc metalloprotease FtsH
Antczak et al. [3]: ftsH; ATP-dependent zinc-binding metallopeptidase FtsH
Zhang et al. [4]: GO:0030554|adenyl nucleotide binding
Bianchi et al. [5]: ftsH peptidase
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q0TTK8
(ATP-dependent zinc metalloprotease FtsH) with a FATCAT P-Value: 0 and RMSD of 2.31 angstrom. The sequence alignment identity is 36.6%.
Structural alignment shown in left. Query protein AVX54590.1 colored as red in alignment, homolog Q0TTK8 colored as blue.
Query protein AVX54590.1 is also shown in right top, homolog Q0TTK8 showed in right bottom. They are colored based on secondary structures.
AVX54590.1 MNKKKK--KSTFWFWIIL--IVGFIILLSVISITSRGTTQNL---TIEQLNSLFDQGKPFNNVVLQRNNIQG--IDIITGWYNNGSGWTKFTVNTNPNAI 91 Q0TTK8 MFKDKKMLK-----YIVIYSIIAFGILLTFNMVKDEMLYEKVDYSTFMQM--L-DK-KEVKSV-----NFSGNQIEITPSDSSNLKG--KILYTTNP-AV 83 AVX54590.1 NGFS--DAFKNF----VWRSNTTRYTESSWFSLLSSLLPM-----LILILFYIGLFYF--M-AK-GGAAGAGANGLFGMGKNKAR---REKSNVKFSDVA 173 Q0TTK8 AGITQPELIKDLTVAGV-EFNVTK-PEN--YQLL-GLL-MSWVFPLILI-FFVGRMMFSKMNNKMGG-------GVMSFGKNNAKLYAENETGITFKDVA 169 AVX54590.1 GIEEEKSELVELVDYLKQPAKYASAGARAPKGVLMEGPPGTGKTLLAKAVAGEANVSFFSIAGSEFEEMFVGVGASRVREMFNEAKKAAPAIIFIDEIDA 273 Q0TTK8 GQDEAKESLVEIVDFLHDTRKYVEIGAKLPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSMSGSDFVEMFVGMGAARVRDLFKQAEEKAPCIVFIDEIDA 269 AVX54590.1 VGRKRNSAI-GTGTNEQTLNQLLVELDGFETNSGIIVMAATNRVDVLDPALLRPGRFDRVIQVSLPDIKEREQILKLHARNKKI--DPSIDWHRIAERTP 370 Q0TTK8 IGKSRDGAIQGNDEREQTLNQLLTEMDGFDSSKGVVILAATNRPEVLDKALLRPGRFDRRIIVDRPDLIGREEILKVHSRDVKLSDDVSLE--EIAKSTP 367 AVX54590.1 GFSGAQLENVLNEAAILMVREGKTVIGINE-IDEAIDRVVGGPAKKSRAMTMHDKEIVSYHESGHALIGLKLESASKVQKVTIIPR--GNAGGYTIMTPK 467 Q0TTK8 GAVGADLANIVNEAALRAVKHGRKFV-IQEDLDEAVEVIIAGQEKRDRILSPKEKKIVAYHEVGHALVAALLNNTDPVHKITIVPRTMG-ALGYTMQLPE 465 AVX54590.1 DETLFSSKTDLYAMIAGYLGGRAAEEIKFGKDNVTTGAHDDFDKATAIARRMVMQFGMSELGITKFLTMADEA----Y--GKTEGSYSEKTAAKIDAEVE 561 Q0TTK8 EEKYLVSKEEMIDQISVMLGGRAAEEVVF--NSITTGASNDIERATQSARNMITIYGMSE----RFDMMALEAMSNRYLDGRPVRNCSETTAAIADEEVL 559 AVX54590.1 RILEESYKLAIKVISENMETLELLAESLRVL---ETITAEQIDYINKNKKLPEAVIYEK--EKYKQEQEKINSGKIIDLDINDVKEE---EDKDK----- 648 Q0TTK8 QVIKKAHEKSIKILIENR---ELLDEITGVLLDKETIMGD--EFM--------EIVYGKYPEK-READEK--AKK----EIQSLREQALAKRKEKEEAIK 639 AVX54590.1 ------------------------------------------------------------------------------ 648 Q0TTK8 KAREEALRLEEEQRKQDELKAMIEAQEEAAKLARANNEANNDALDSSKENEEVKSNVNDGATEEKKDDSSTNNKVDGE 717
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0004176 | ATP-dependent peptidase activity |
| 1. PBF | GO:0005811 | lipid droplet |
| 1. PBF | GO:0106300 | protein-DNA covalent cross-linking repair |
| 1. PBF | GO:0000502 | proteasome complex |
| 1. PBF | GO:0051228 | mitotic spindle disassembly |
| 1. PBF | GO:1904115 | axon cytoplasm |
| 1. PBF | GO:0034098 | VCP-NPL4-UFD1 AAA ATPase complex |
| 1. PBF | GO:0004222 | metalloendopeptidase activity |
| 1. PBF | GO:0035617 | stress granule disassembly |
| 1. PBF | GO:0007409 | axonogenesis |
| 1. PBF | GO:0019985 | translesion synthesis |
| 1. PBF | GO:0140603 | obsolete ATP hydrolysis activity |
| 1. PBF | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0034214 | protein hexamerization |
| 1. PBF | GO:0008089 | anterograde axonal transport |
| 1. PBF | GO:0032510 | endosome to lysosome transport via multivesicular body sorting pathway |
| 1. PBF | GO:0071712 | ER-associated misfolded protein catabolic process |
| 1. PBF | GO:0008270 | zinc ion binding |
| 1. PBF | GO:0016887 | ATP hydrolysis activity |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0030970 | retrograde protein transport, ER to cytosol |
| 1. PBF | GO:1903843 | cellular response to arsenite ion |
| 1. PBF | GO:0061857 | endoplasmic reticulum stress-induced pre-emptive quality control |
| 1. PBF | GO:1905634 | regulation of protein localization to chromatin |
| 1. PBF | GO:0036503 | ERAD pathway |
| 1. PBF | GO:0009579 | thylakoid |
| 1. PBF | GO:0097352 | autophagosome maturation |
| 1. PBF | GO:0010498 | proteasomal protein catabolic process |
| 1. PBF | GO:0030163 | protein catabolic process |
| 1. PBF | GO:0036297 | interstrand cross-link repair |
| 1. PBF | GO:0006508 | proteolysis |
| 2. PF | GO:0005739 | mitochondrion |
| 2. PF | GO:0016021 | integral component of membrane |
| 3. BF | GO:0016558 | protein import into peroxisome matrix |
| 3. BF | GO:0009378 | four-way junction helicase activity |
| 3. BF | GO:0003677 | DNA binding |
| 3. BF | GO:0051082 | unfolded protein binding |
| 3. BF | GO:1900074 | negative regulation of neuromuscular synaptic transmission |
| 3. BF | GO:0005819 | spindle |
| 3. BF | GO:0009570 | chloroplast stroma |
| 3. BF | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 3. BF | GO:0048487 | beta-tubulin binding |
| 3. BF | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. BF | GO:0005778 | peroxisomal membrane |
| 3. BF | GO:0031468 | nuclear membrane reassembly |
| 3. BF | GO:0045834 | positive regulation of lipid metabolic process |
| 3. BF | GO:0032506 | cytokinetic process |
| 3. BF | GO:0010458 | exit from mitosis |
| 3. BF | GO:0022624 | proteasome accessory complex |
| 3. BF | GO:0008344 | adult locomotory behavior |
| 3. BF | GO:0022623 | proteasome-activating nucleotidase complex |
| 3. BF | GO:0035099 | hemocyte migration |
| 3. BF | GO:0007026 | negative regulation of microtubule depolymerization |
| 3. BF | GO:0031117 | positive regulation of microtubule depolymerization |
| 3. BF | GO:0045887 | positive regulation of synaptic assembly at neuromuscular junction |
| 3. BF | GO:0006355 | regulation of transcription, DNA-templated |
| 3. BF | GO:0031531 | thyrotropin-releasing hormone receptor binding |
| 3. BF | GO:0045899 | positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| 3. BF | GO:0140545 | protein disaggregase activity |
| 3. BF | GO:0031595 | nuclear proteasome complex |
| 3. BF | GO:0042645 | mitochondrial nucleoid |
| 3. BF | GO:0035494 | SNARE complex disassembly |
| 3. BF | GO:2000331 | regulation of terminal button organization |
| 3. BF | GO:0000281 | mitotic cytokinesis |
| 3. BF | GO:0005634 | nucleus |
| 3. BF | GO:0140567 | transmembrane protein dislocase activity |
| 3. BF | GO:0097431 | mitotic spindle pole |
| 3. BF | GO:0043195 | terminal bouton |
| 3. BF | GO:0043335 | protein unfolding |
| 3. BF | GO:0051261 | protein depolymerization |
| 3. BF | GO:0036402 | proteasome-activating activity |
| 3. BF | GO:0046872 | metal ion binding |
| 3. BF | GO:0031122 | cytoplasmic microtubule organization |
| 3. BF | GO:0016562 | protein import into peroxisome matrix, receptor recycling |
| 3. BF | GO:0031597 | cytosolic proteasome complex |
| 3. BF | GO:0046863 | ribulose-1,5-bisphosphate carboxylase/oxygenase activator activity |
| 3. BF | GO:0046983 | protein dimerization activity |
| 3. BF | GO:0000922 | spindle pole |
| 3. BF | GO:0005874 | microtubule |
| 3. BF | GO:0008540 | proteasome regulatory particle, base subcomplex |
| 3. BF | GO:0031594 | neuromuscular junction |
| 3. BF | GO:0016853 | isomerase activity |
| 3. BF | GO:0008017 | microtubule binding |
| 3. BF | GO:0000022 | mitotic spindle elongation |
| 3. BF | GO:0006457 | protein folding |
| 3. BF | GO:0090148 | membrane fission |
| 3. BF | GO:0007079 | mitotic chromosome movement towards spindle pole |
| 3. BF | GO:1900075 | positive regulation of neuromuscular synaptic transmission |
| 3. BF | GO:0003689 | DNA clamp loader activity |
| 3. BF | GO:0007031 | peroxisome organization |
| 3. BF | GO:0008021 | synaptic vesicle |
| 3. BF | GO:0000287 | magnesium ion binding |
| 3. BF | GO:0005813 | centrosome |
| 3. BF | GO:0008568 | microtubule-severing ATPase activity |
| 3. BF | GO:0140296 | general transcription initiation factor binding |
| 3. BF | GO:0019896 | axonal transport of mitochondrion |
| 3. BF | GO:0001578 | microtubule bundle formation |
| 3. BF | GO:0030496 | midbody |
| 3. BF | GO:0051013 | microtubule severing |
| 3. BF | GO:0019941 | modification-dependent protein catabolic process |
| 3. BF | GO:0048691 | positive regulation of axon extension involved in regeneration |
| 3. BF | GO:0043014 | alpha-tubulin binding |
| 3. BF | GO:0017025 | TBP-class protein binding |
| 3. BF | GO:0015630 | microtubule cytoskeleton |
| 3. BF | GO:0140570 | extraction of mislocalized protein from mitochondrial outer membrane |
| 4. PB | GO:0031969 | chloroplast membrane |
| 4. PB | GO:0034605 | cellular response to heat |
| 4. PB | GO:0021675 | nerve development |
| 4. PB | GO:1990730 | VCP-NSFL1C complex |
| 4. PB | GO:0046034 | ATP metabolic process |
| 4. PB | GO:0010205 | photoinhibition |
| 4. PB | GO:0010304 | PSII associated light-harvesting complex II catabolic process |
| 4. PB | GO:0010206 | photosystem II repair |
| 4. PB | GO:1903715 | regulation of aerobic respiration |
| 4. PB | GO:0009534 | chloroplast thylakoid |
| 4. PB | GO:1902686 | mitochondrial outer membrane permeabilization involved in programmed cell death |
| 4. PB | GO:0042288 | MHC class I protein binding |
| 4. PB | GO:0008053 | mitochondrial fusion |
| 4. PB | GO:0031942 | i-AAA complex |
| 4. PB | GO:0005757 | mitochondrial permeability transition pore complex |
| 4. PB | GO:1990171 | SCF complex disassembly in response to cadmium stress |
| 4. PB | GO:2001171 | positive regulation of ATP biosynthetic process |
| 4. PB | GO:0065003 | protein-containing complex assembly |
| 4. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 4. PB | GO:0016485 | protein processing |
| 4. PB | GO:0060013 | righting reflex |
| 4. PB | GO:1904288 | BAT3 complex binding |
| 4. PB | GO:0036266 | Cdc48p-Npl4p-Vms1p AAA ATPase complex |
| 4. PB | GO:0042407 | cristae formation |
| 4. PB | GO:0010918 | positive regulation of mitochondrial membrane potential |
| 4. PB | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 4. PB | GO:0051560 | mitochondrial calcium ion homeostasis |
| 4. PB | GO:0036435 | K48-linked polyubiquitin modification-dependent protein binding |
| 4. PB | GO:0031593 | polyubiquitin modification-dependent protein binding |
| 4. PB | GO:1904949 | ATPase complex |
| 4. PB | GO:0035861 | site of double-strand break |
| 4. PB | GO:0035694 | mitochondrial protein catabolic process |
| 4. PB | GO:0005743 | mitochondrial inner membrane |
| 4. PB | GO:1903006 | positive regulation of protein K63-linked deubiquitination |
| 4. PB | GO:0034982 | mitochondrial protein processing |
| 4. PB | GO:1903862 | positive regulation of oxidative phosphorylation |
| 4. PB | GO:0045732 | positive regulation of protein catabolic process |
| 4. PB | GO:0009524 | phragmoplast |
| 4. PB | GO:0045879 | negative regulation of smoothened signaling pathway |
| 4. PB | GO:0016236 | macroautophagy |
| 4. PB | GO:0036444 | calcium import into the mitochondrion |
| 4. PB | GO:0006302 | double-strand break repair |
| 4. PB | GO:0062091 | Ycf2/FtsHi complex |
| 4. PB | GO:0005576 | extracellular region |
| 4. PB | GO:0036513 | Derlin-1 retrotranslocation complex |
| 4. PB | GO:1903007 | positive regulation of Lys63-specific deubiquitinase activity |
| 4. PB | GO:0009941 | chloroplast envelope |
| 4. PB | GO:0033619 | membrane protein proteolysis |
| 4. PB | GO:0046902 | regulation of mitochondrial membrane permeability |
| 4. PB | GO:0007005 | mitochondrion organization |
| 4. PB | GO:0097002 | mitochondrial inner boundary membrane |
| 4. PB | GO:0070842 | aggresome assembly |
| 4. PB | GO:0035800 | deubiquitinase activator activity |
| 4. PB | GO:0016464 | chloroplast protein-transporting ATPase activity |
| 4. PB | GO:0072389 | flavin adenine dinucleotide catabolic process |
| 4. PB | GO:0005745 | m-AAA complex |
| 4. PB | GO:0034622 | |
| 4. PB | GO:0045037 | protein import into chloroplast stroma |
| 5. P | GO:0034517 | ribophagy |
| 5. P | GO:0055001 | muscle cell development |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0019903 | protein phosphatase binding |
| 5. P | GO:0009535 | chloroplast thylakoid membrane |
| 5. P | GO:0010494 | cytoplasmic stress granule |
| 5. P | GO:0006974 | cellular response to DNA damage stimulus |
| 5. P | GO:0045977 | positive regulation of mitotic cell cycle, embryonic |
| 5. P | GO:0000837 | Doa10p ubiquitin ligase complex |
| 5. P | GO:0098796 | membrane protein complex |
| 5. P | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 5. P | GO:0008289 | lipid binding |
| 5. P | GO:0048564 | photosystem I assembly |
| 5. P | GO:0031977 | thylakoid lumen |
| 5. P | GO:2000060 | positive regulation of ubiquitin-dependent protein catabolic process |
| 5. P | GO:0016320 | endoplasmic reticulum membrane fusion |
| 5. P | GO:1904780 | negative regulation of protein localization to centrosome |
| 5. P | GO:1990112 | RQC complex |
| 5. P | GO:0007279 | pole cell formation |
| 5. P | GO:1990116 | ribosome-associated ubiquitin-dependent protein catabolic process |
| 5. P | GO:0043934 | sporulation |
| 5. P | GO:0042552 | myelination |
| 5. P | GO:0043624 | |
| 5. P | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 5. P | GO:0120174 | stress-induced homeostatically regulated protein degradation pathway |
| 5. P | GO:0097212 | lysosomal membrane organization |
| 5. P | GO:0040014 | regulation of multicellular organism growth |
| 5. P | GO:0035096 | larval midgut cell programmed cell death |
| 5. P | GO:0031134 | sister chromatid biorientation |
| 5. P | GO:0006465 | signal peptide processing |
| 5. P | GO:0006914 | autophagy |
| 5. P | GO:0006734 | NADH metabolic process |
| 5. P | GO:0019079 | viral genome replication |
| 5. P | GO:0000836 | Hrd1p ubiquitin ligase complex |
| 5. P | GO:0008237 | metallopeptidase activity |
| 5. P | GO:0044389 | ubiquitin-like protein ligase binding |
| 5. P | GO:0050807 | regulation of synapse organization |
| 5. P | GO:0061163 | endoplasmic reticulum polarization |
| 5. P | GO:0035103 | sterol regulatory element binding protein cleavage |
| 5. P | GO:2001168 | positive regulation of histone H2B ubiquitination |
| 5. P | GO:0009536 | plastid |
| 5. P | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 5. P | GO:0007528 | neuromuscular junction development |
| 5. P | GO:0031334 | positive regulation of protein-containing complex assembly |
| 5. P | GO:0016567 | protein ubiquitination |
| 5. P | GO:2000058 | regulation of ubiquitin-dependent protein catabolic process |
| 5. P | GO:1990381 | ubiquitin-specific protease binding |
| 5. P | GO:0045169 | fusome |
| 5. P | GO:0016540 | protein autoprocessing |
| 6. F | GO:0009432 | SOS response |
| 6. F | GO:0003688 | DNA replication origin binding |
| 6. F | GO:0006281 | DNA repair |
| 6. F | GO:0005829 | cytosol |
| 6. F | GO:0016020 | membrane |
| 6. F | GO:0051116 | cobaltochelatase activity |
| 6. F | GO:0006310 | DNA recombination |
| 6. F | GO:0006270 | DNA replication initiation |
| 6. F | GO:0006275 | regulation of DNA replication |
| 7. B | GO:0006625 | protein targeting to peroxisome |
| 7. B | GO:0035255 | ionotropic glutamate receptor binding |
| 7. B | GO:0032042 | mitochondrial DNA metabolic process |
| 7. B | GO:0034058 | endosomal vesicle fusion |
| 7. B | GO:0010044 | response to aluminum ion |
| 7. B | GO:0005777 | peroxisome |
| 7. B | GO:0007130 | synaptonemal complex assembly |
| 7. B | GO:0006891 | intra-Golgi vesicle-mediated transport |
| 7. B | GO:0033993 | response to lipid |
| 7. B | GO:0003924 | GTPase activity |
| 7. B | GO:0002092 | positive regulation of receptor internalization |
| 7. B | GO:0035266 | meristem growth |
| 7. B | GO:1904903 | ESCRT III complex disassembly |
| 7. B | GO:0001921 | positive regulation of receptor recycling |
| 7. B | GO:0009838 | abscission |
| 7. B | GO:1903902 | positive regulation of viral life cycle |
| 7. B | GO:0016197 | endosomal transport |
| 7. B | GO:0032467 | positive regulation of cytokinesis |
| 7. B | GO:0090261 | positive regulation of inclusion body assembly |
| 7. B | GO:0032979 | protein insertion into mitochondrial inner membrane from matrix |
| 7. B | GO:0010091 | trichome branching |
| 7. B | GO:0009368 | endopeptidase Clp complex |
| 7. B | GO:1990621 | ESCRT IV complex |
| 7. B | GO:0043273 | CTPase activity |
| 7. B | GO:0048477 | oogenesis |
| 7. B | GO:0005887 | integral component of plasma membrane |
| 7. B | GO:1903724 | positive regulation of centriole elongation |
| 7. B | GO:0032367 | intracellular cholesterol transport |
| 7. B | GO:0140374 | antiviral innate immune response |
| 7. B | GO:0070651 | nonfunctional rRNA decay |
| 7. B | GO:0007283 | spermatogenesis |
| 7. B | GO:0039702 | viral budding via host ESCRT complex |
| 7. B | GO:0005759 | mitochondrial matrix |
| 7. B | GO:0009841 | mitochondrial endopeptidase Clp complex |
| 7. B | GO:0051973 | positive regulation of telomerase activity |
| 7. B | GO:0072319 | vesicle uncoating |
| 7. B | GO:0008233 | peptidase activity |
| 7. B | GO:0007084 | mitotic nuclear membrane reassembly |
| 7. B | GO:0007131 | reciprocal meiotic recombination |
| 7. B | GO:0034599 | cellular response to oxidative stress |
| 7. B | GO:0007080 | mitotic metaphase plate congression |
| 7. B | GO:0006997 | nucleus organization |
| 7. B | GO:0034551 | mitochondrial respiratory chain complex III assembly |
| 7. B | GO:0006622 | protein targeting to lysosome |
| 7. B | GO:0043565 | sequence-specific DNA binding |
| 7. B | GO:0097255 | R2TP complex |
| 7. B | GO:0090543 | Flemming body |
| 7. B | GO:0009376 | HslUV protease complex |
| 7. B | GO:0098527 | neuromuscular junction of somatic muscle |
| 7. B | GO:0061952 | midbody abscission |
| 7. B | GO:0051260 | protein homooligomerization |
| 7. B | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition |
| 7. B | GO:0051880 | G-quadruplex DNA binding |
| 7. B | GO:0044877 | protein-containing complex binding |
| 7. B | GO:1903774 | positive regulation of viral budding via host ESCRT complex |
| 7. B | GO:0090736 | MATH domain binding |
| 7. B | GO:0070682 | proteasome regulatory particle assembly |
| 7. B | GO:0030894 | replisome |
| 7. B | GO:0070407 | oxidation-dependent protein catabolic process |
| 7. B | GO:0003723 | RNA binding |
| 7. B | GO:0001556 | oocyte maturation |
| 7. B | GO:0098794 | postsynapse |
| 7. B | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization |
| 7. B | GO:0090611 | ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway |
| 7. B | GO:1901800 | positive regulation of proteasomal protein catabolic process |
| 7. B | GO:0033687 | osteoblast proliferation |
| 7. B | GO:0061738 | late endosomal microautophagy |
| 7. B | GO:1903542 | negative regulation of exosomal secretion |
| 7. B | GO:0051301 | cell division |
| 7. B | GO:0001824 | blastocyst development |
| 7. B | GO:0031445 | regulation of heterochromatin assembly |
| 7. B | GO:0051598 | meiotic recombination checkpoint signaling |
| 7. B | GO:1903543 | positive regulation of exosomal secretion |
| 7. B | GO:0016561 | protein import into peroxisome matrix, translocation |
| 7. B | GO:0000932 | P-body |
| 7. B | GO:0036258 | multivesicular body assembly |
| 7. B | GO:0016234 | inclusion body |
| 7. B | GO:0044878 | mitotic cytokinesis checkpoint signaling |
| 7. B | GO:0050804 | modulation of chemical synaptic transmission |
| 7. B | GO:0048211 | Golgi vesicle docking |
| 7. B | GO:0005838 | proteasome regulatory particle |
| 7. B | GO:0048471 | perinuclear region of cytoplasm |
| 7. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 7. B | GO:0007141 | male meiosis I |
| 7. B | GO:0010756 | positive regulation of plasminogen activation |
| 7. B | GO:1901673 | regulation of mitotic spindle assembly |
| 7. B | GO:0001673 | male germ cell nucleus |
| 7. B | GO:0051131 | chaperone-mediated protein complex assembly |
| 7. B | GO:0030164 | protein denaturation |
| 7. B | GO:0007144 | female meiosis I |
| 7. B | GO:0080093 | regulation of photorespiration |
| 7. B | GO:0017116 | single-stranded DNA helicase activity |
| 7. B | GO:0005795 | Golgi stack |
| 7. B | GO:0000228 | nuclear chromosome |
| 7. B | GO:1904749 | regulation of protein localization to nucleolus |
| 7. B | GO:0017075 | syntaxin-1 binding |
| 7. B | GO:0043001 | Golgi to plasma membrane protein transport |
| 7. B | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 7. B | GO:0000262 | mitochondrial chromosome |
| 7. B | GO:1901858 | regulation of mitochondrial DNA metabolic process |
| 7. B | GO:0043162 | ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
| 7. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 7. B | GO:0060152 | microtubule-based peroxisome localization |
| 7. B | GO:0048232 | male gamete generation |
| 7. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 7. B | GO:0032466 | negative regulation of cytokinesis |
| 7. B | GO:1904896 | ESCRT complex disassembly |
| 7. B | GO:0001094 | TFIID-class transcription factor complex binding |
| 7. B | GO:0004252 | serine-type endopeptidase activity |
| 7. B | GO:0002090 | regulation of receptor internalization |
| 7. B | GO:1990275 | preribosome binding |
| 7. B | GO:1902120 | negative regulation of meiotic spindle elongation |
| 7. B | GO:0005694 | chromosome |
| 7. B | GO:0032984 | protein-containing complex disassembly |
| 7. B | GO:0097733 | photoreceptor cell cilium |
| 7. B | GO:0001018 | mitochondrial promoter sequence-specific DNA binding |
| 7. B | GO:2000269 | regulation of fibroblast apoptotic process |
| 7. B | GO:0007033 | vacuole organization |
| 7. B | GO:0031936 | obsolete negative regulation of chromatin silencing |
| 7. B | GO:0008022 | protein C-terminus binding |
| 7. B | GO:0140035 | ubiquitination-like modification-dependent protein binding |
| 7. B | GO:0043921 | modulation by host of viral transcription |
| 7. B | GO:1902188 | obsolete positive regulation of viral release from host cell |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004176 | ATP-dependent peptidase activity |
| GO:0008233 | peptidase activity |
| GO:0008270 | zinc ion binding |
| GO:0005886 | plasma membrane |
| GO:0016021 | integral component of membrane |
| GO:0016887 | ATP hydrolysis activity |
| GO:0006508 | proteolysis |
| GO:0016020 | membrane |
| GO:0005524 | ATP binding |
| GO:0008237 | metallopeptidase activity |
| GO:0030163 | protein catabolic process |
| GO:0004222 | metalloendopeptidase activity |
| GO:0016787 | hydrolase activity |
| GO:0046872 | metal ion binding |
| GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A9BJK3 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 4.67e-65 | 3.19e-151 | 0.718 |
| 1. PBF | C5J6A7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.95e-41 | 3.62e-175 | 0.7566 |
| 1. PBF | Q5SI82 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.20e-70 | 3.07e-144 | 0.7384 |
| 1. PBF | D1J722 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.94e-44 | 1.96e-132 | 0.6867 |
| 1. PBF | P0AAI4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.63e-58 | 9.22e-155 | 0.7345 |
| 1. PBF | A9NE17 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.02e-55 | 8.72e-171 | 0.7127 |
| 1. PBF | D3F124 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 9.80e-59 | 2.46e-152 | 0.7486 |
| 1. PBF | Q4A5F0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.16e-62 | 0.0 | 0.7382 |
| 1. PBF | Q96372 | Cell division cycle protein 48 homolog | 1.89e-05 | 1.30e-02 | 1.22e-52 | 0.699 |
| 1. PBF | A9KIG5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.53e-49 | 4.74e-116 | 0.7551 |
| 1. PBF | Q3A579 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.03e-61 | 7.20e-135 | 0.7235 |
| 1. PBF | Q03Z46 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.02e-57 | 4.26e-143 | 0.7594 |
| 1. PBF | Q8YMZ8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 9.36e-38 | 2.56e-161 | 0.722 |
| 1. PBF | P46469 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.21e-65 | 1.94e-170 | 0.8161 |
| 1. PBF | D5D8E3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.26e-32 | 6.31e-127 | 0.8305 |
| 1. PBF | B3R057 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 3.43e-40 | 1.42e-163 | 0.7274 |
| 1. PBF | P0A4V9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.67e-16 | 2.00e-137 | 0.7123 |
| 1. PBF | B3PNH3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.12e-55 | 0.0 | 0.7319 |
| 1. PBF | Q83XX3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.26e-54 | 2.05e-141 | 0.8266 |
| 1. PBF | Q3JEE4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.09e-53 | 5.46e-133 | 0.7138 |
| 1. PBF | Q83FV7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.35e-61 | 4.60e-147 | 0.7464 |
| 1. PBF | Q4UN68 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.10e-72 | 1.25e-156 | 0.7242 |
| 1. PBF | B2JVU2 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.01e-60 | 4.33e-146 | 0.7575 |
| 1. PBF | Q6M2F0 | ATP-dependent zinc metalloprotease FtsH | 4.44e-16 | 4.24e-04 | 8.96e-140 | 0.7111 |
| 1. PBF | D3FFN2 | ATP-dependent zinc metalloprotease FtsH | 3.33e-16 | 4.17e-35 | 0.0 | 0.7535 |
| 1. PBF | B2UE66 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 9.40e-31 | 1.91e-147 | 0.7245 |
| 1. PBF | A1URA3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.04e-11 | 2.54e-152 | 0.7393 |
| 1. PBF | Q92JJ9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.04e-70 | 6.90e-158 | 0.7309 |
| 1. PBF | Q9ZEA2 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.67e-70 | 9.65e-158 | 0.7147 |
| 1. PBF | D0LWB8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.60e-58 | 4.02e-135 | 0.7059 |
| 1. PBF | Q68XR9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.86e-69 | 1.47e-157 | 0.7136 |
| 1. PBF | A9FDV9 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 7.33e-54 | 4.06e-121 | 0.7232 |
| 1. PBF | O32617 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 7.12e-57 | 8.96e-137 | 0.7252 |
| 1. PBF | Q8K9G8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.53e-60 | 1.45e-146 | 0.7642 |
| 1. PBF | B0K657 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 2.85e-32 | 2.26e-132 | 0.806 |
| 1. PBF | Q3JMH0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.69e-58 | 4.45e-137 | 0.733 |
| 1. PBF | B2UMY1 | ATP-dependent zinc metalloprotease FtsH | 5.13e-13 | 5.51e-23 | 3.82e-152 | 0.6825 |
| 1. PBF | Q7URM7 | ATP-dependent zinc metalloprotease FtsH 2 | 2.22e-16 | 1.07e-37 | 1.15e-133 | 0.7167 |
| 1. PBF | B7T1V0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.83e-53 | 2.96e-144 | 0.7198 |
| 1. PBF | B0B970 | ATP-dependent zinc metalloprotease FtsH | 7.98e-14 | 4.86e-07 | 6.43e-142 | 0.7816 |
| 1. PBF | Q2LUQ1 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.37e-29 | 4.47e-139 | 0.719 |
| 1. PBF | A9BFL9 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 3.53e-60 | 1.90e-146 | 0.7375 |
| 1. PBF | Q8X9L0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.23e-59 | 1.05e-154 | 0.7401 |
| 1. PBF | D1C2C6 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 5.46e-56 | 4.48e-127 | 0.7648 |
| 1. PBF | Q3B6R3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.62e-50 | 7.93e-137 | 0.7756 |
| 1. PBF | P71377 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.62e-60 | 1.07e-142 | 0.726 |
| 1. PBF | Q98PE4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.78e-53 | 0.0 | 0.7345 |
| 1. PBF | B9KXV3 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 2.16e-67 | 8.77e-151 | 0.7042 |
| 1. PBF | P59652 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.29e-57 | 1.94e-176 | 0.8171 |
| 1. PBF | P9WQN2 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.57e-16 | 3.13e-137 | 0.7263 |
| 1. PBF | D1BLD0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.40e-65 | 2.20e-155 | 0.7509 |
| 1. PBF | D5H7Z5 | ATP-dependent zinc metalloprotease FtsH 1 | 1.11e-16 | 1.32e-46 | 6.36e-121 | 0.695 |
| 1. PBF | B8J992 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.12e-56 | 3.10e-145 | 0.7811 |
| 1. PBF | A9EXK6 | ATP-dependent zinc metalloprotease FtsH 4 | 0.00e+00 | 7.11e-67 | 7.71e-152 | 0.7171 |
| 1. PBF | C8WEG0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.15e-61 | 4.94e-141 | 0.7198 |
| 1. PBF | A6LD25 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.68e-54 | 1.42e-137 | 0.7848 |
| 1. PBF | A9GAW6 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 1.36e-50 | 7.72e-123 | 0.6978 |
| 1. PBF | C6V4R9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.09e-74 | 1.97e-145 | 0.6915 |
| 1. PBF | A8ZNZ4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.67e-60 | 8.61e-135 | 0.6972 |
| 1. PBF | O69076 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.39e-56 | 2.17e-176 | 0.8107 |
| 1. PBF | C8W731 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.83e-61 | 3.58e-140 | 0.723 |
| 1. PBF | B3DY14 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 5.08e-49 | 9.30e-153 | 0.7449 |
| 1. PBF | Q9BAE0 | ATP-dependent zinc metalloprotease FTSH, chloroplastic | 0.00e+00 | 5.09e-08 | 7.04e-141 | 0.7445 |
| 1. PBF | Q6GL04 | Transitional endoplasmic reticulum ATPase | 1.35e-05 | 6.17e-03 | 5.28e-51 | 0.6866 |
| 1. PBF | Q1LLA9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.08e-66 | 2.00e-156 | 0.8139 |
| 1. PBF | Q55700 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 4.75e-57 | 7.93e-160 | 0.772 |
| 1. PBF | Q6LUJ8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.53e-49 | 1.75e-147 | 0.7514 |
| 1. PBF | Q6KHA4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.31e-63 | 0.0 | 0.7812 |
| 1. PBF | D2NQQ7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.13e-33 | 3.02e-146 | 0.7261 |
| 1. PBF | D0MGU8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.10e-47 | 2.72e-138 | 0.7811 |
| 1. PBF | Q6F0E5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.90e-80 | 0.0 | 0.8253 |
| 1. PBF | P47695 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 7.10e-50 | 0.0 | 0.7763 |
| 1. PBF | C0ZPK5 | ATP-dependent zinc metalloprotease FtsH | 2.22e-15 | 1.87e-04 | 3.43e-144 | 0.7361 |
| 1. PBF | B8G4Q6 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.00e-68 | 1.29e-151 | 0.7074 |
| 1. PBF | B3DV46 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 4.82e-48 | 4.73e-144 | 0.77 |
| 1. PBF | A8F7F7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 9.34e-64 | 5.67e-148 | 0.7383 |
| 1. PBF | D4HA34 | ATP-dependent zinc metalloprotease FtsH | 1.11e-16 | 2.59e-28 | 2.82e-154 | 0.7155 |
| 1. PBF | Q9TJ83 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.40e-49 | 1.39e-151 | 0.8103 |
| 1. PBF | Q1D491 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.74e-63 | 5.41e-139 | 0.7449 |
| 1. PBF | Q2SF13 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.14e-47 | 3.92e-111 | 0.7878 |
| 1. PBF | D1C8C0 | ATP-dependent zinc metalloprotease FtsH 4 | 0.00e+00 | 1.29e-41 | 7.35e-142 | 0.7081 |
| 1. PBF | Q67JH0 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 2.10e-67 | 2.71e-153 | 0.7539 |
| 1. PBF | O67077 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.85e-68 | 1.43e-134 | 0.709 |
| 1. PBF | O19922 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.07e-47 | 4.01e-146 | 0.7724 |
| 1. PBF | P57462 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.30e-60 | 8.35e-151 | 0.7532 |
| 1. PBF | Q7UUZ7 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 6.87e-59 | 1.97e-127 | 0.7233 |
| 1. PBF | Q1AV13 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.52e-45 | 9.68e-149 | 0.699 |
| 1. PBF | Q0TTK8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.82e-33 | 2.21e-138 | 0.7017 |
| 1. PBF | B2XTF7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.35e-36 | 2.24e-131 | 0.6943 |
| 1. PBF | P63344 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.68e-59 | 3.50e-153 | 0.7329 |
| 1. PBF | B9L3S8 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.80e-23 | 2.18e-138 | 0.7624 |
| 1. PBF | Q2NIN5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.59e-48 | 1.93e-157 | 0.7055 |
| 1. PBF | Q9CD58 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.53e-11 | 1.51e-136 | 0.7198 |
| 1. PBF | P73179 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 1.96e-27 | 1.05e-155 | 0.7503 |
| 1. PBF | B7J0N5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.87e-64 | 1.42e-136 | 0.767 |
| 1. PBF | C7N914 | ATP-dependent zinc metalloprotease FtsH | 2.78e-15 | 1.62e-29 | 4.18e-142 | 0.7281 |
| 1. PBF | D2QZ34 | ATP-dependent zinc metalloprotease FtsH | 3.33e-16 | 5.47e-46 | 1.76e-136 | 0.7258 |
| 1. PBF | A0PXM8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.21e-52 | 8.48e-167 | 0.7239 |
| 1. PBF | B3QZS3 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.58e-34 | 4.16e-160 | 0.7149 |
| 1. PBF | B8D065 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.98e-72 | 4.74e-163 | 0.7362 |
| 1. PBF | B0K5A3 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 5.21e-61 | 4.63e-173 | 0.7476 |
| 1. PBF | A5U8T5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.67e-16 | 2.00e-137 | 0.7445 |
| 1. PBF | A6TSZ1 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 2.57e-50 | 1.09e-116 | 0.7426 |
| 1. PBF | B1GZK7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.64e-70 | 5.40e-155 | 0.7305 |
| 1. PBF | C1F8X6 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.86e-69 | 3.49e-150 | 0.7189 |
| 1. PBF | A1TZE0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.08e-46 | 1.66e-128 | 0.7473 |
| 1. PBF | D1AXT4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.89e-28 | 5.42e-141 | 0.7809 |
| 1. PBF | Q2KJI7 | AFG3-like protein 2 | 2.11e-15 | 5.91e-17 | 7.85e-133 | 0.6909 |
| 1. PBF | Q1RGP0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.97e-67 | 1.53e-145 | 0.738 |
| 1. PBF | P23787 | Transitional endoplasmic reticulum ATPase | 1.09e-02 | 3.83e-03 | 3.19e-50 | 0.6914 |
| 1. PBF | D1C1U7 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 1.43e-67 | 1.35e-155 | 0.7451 |
| 1. PBF | Q88Z31 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.08e-33 | 8.26e-159 | 0.7679 |
| 1. PBF | Q6MJV1 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.12e-56 | 3.07e-139 | 0.7371 |
| 1. PBF | P37476 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.63e-72 | 0.0 | 0.7343 |
| 1. PBF | B2A3Q4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.95e-24 | 1.26e-163 | 0.7189 |
| 1. PBF | B9MPK5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.01e-52 | 1.10e-155 | 0.7367 |
| 1. PBF | Q10ZF7 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.83e-38 | 1.75e-135 | 0.697 |
| 1. PBF | P51327 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.43e-51 | 2.26e-157 | 0.7562 |
| 1. PBF | A0LN68 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.91e-52 | 9.00e-145 | 0.7527 |
| 1. PBF | Q89AF2 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.21e-62 | 3.49e-152 | 0.7263 |
| 1. PBF | P72991 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 9.08e-61 | 5.07e-161 | 0.7284 |
| 1. PBF | C6VKW6 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.08e-33 | 8.26e-159 | 0.7611 |
| 1. PBF | Q2JNP0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.48e-63 | 1.23e-156 | 0.7233 |
| 1. PBF | D5HA94 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 5.59e-57 | 3.59e-139 | 0.7741 |
| 1. PBF | B3R0R7 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 8.90e-34 | 1.79e-160 | 0.76 |
| 1. PBF | C7N1I1 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 6.95e-21 | 5.29e-156 | 0.8177 |
| 1. PBF | P46508 | ATP-dependent zinc metalloprotease YME1 homolog | 2.59e-14 | 5.60e-18 | 2.38e-113 | 0.8224 |
| 1. PBF | B1ZMG6 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.46e-43 | 6.13e-127 | 0.7673 |
| 1. PBF | B8I4B9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.60e-61 | 4.22e-156 | 0.7253 |
| 1. PBF | O78516 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.11e-55 | 8.08e-160 | 0.7612 |
| 1. PBF | O82150 | ATP-dependent zinc metalloprotease FTSH, chloroplastic | 0.00e+00 | 8.08e-11 | 9.65e-144 | 0.7578 |
| 1. PBF | Q6MDI5 | ATP-dependent zinc metalloprotease FtsH | 3.66e-14 | 1.11e-05 | 8.68e-143 | 0.818 |
| 1. PBF | P94304 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.10e-57 | 6.03e-179 | 0.7455 |
| 1. PBF | B8H444 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.06e-59 | 3.44e-150 | 0.7334 |
| 1. PBF | A6QBN8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.19e-69 | 9.63e-129 | 0.7231 |
| 1. PBF | A9GRC9 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 4.41e-56 | 3.82e-133 | 0.6852 |
| 1. PBF | P03974 | Transitional endoplasmic reticulum ATPase | 3.74e-05 | 4.49e-03 | 3.47e-50 | 0.6876 |
| 1. PBF | C7MC16 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.38e-37 | 3.37e-147 | 0.7262 |
| 1. PBF | Q39444 | ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) | 0.00e+00 | 3.23e-17 | 5.74e-142 | 0.7613 |
| 1. PBF | A5W382 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.67e-60 | 3.18e-127 | 0.7142 |
| 1. PBF | P73437 | ATP-dependent zinc metalloprotease FtsH 4 | 0.00e+00 | 1.90e-50 | 4.86e-138 | 0.7039 |
| 1. PBF | C5CES8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.75e-70 | 5.89e-160 | 0.7245 |
| 1. PBF | Q4L3G8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 5.13e-23 | 5.96e-174 | 0.7852 |
| 1. PBF | Q9MUP8 | Protein Ycf2 | 6.54e-06 | 1.69e-14 | 1.34e-48 | 0.4009 |
| 1. PBF | O83746 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.29e-52 | 1.82e-144 | 0.7705 |
| 1. PBF | P75120 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.67e-52 | 0.0 | 0.7902 |
| 1. PBF | Q60AK1 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.29e-42 | 4.88e-133 | 0.7172 |
| 1. PBF | C5BVA6 | Proteasome-associated ATPase | 3.15e-04 | 1.05e-02 | 4.77e-27 | 0.4234 |
| 1. PBF | Q6MLS7 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 5.57e-71 | 3.33e-155 | 0.7036 |
| 1. PBF | C7M0M0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 7.35e-58 | 3.06e-133 | 0.7071 |
| 1. PBF | Q9WZ49 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.19e-56 | 5.51e-149 | 0.758 |
| 1. PBF | Q8EUA6 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.32e-18 | 0.0 | 0.8875 |
| 1. PBF | A0LR74 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.97e-54 | 1.68e-119 | 0.7114 |
| 1. PBF | Q67LC0 | ATP-dependent zinc metalloprotease FtsH 1 | 0.00e+00 | 5.49e-54 | 5.29e-117 | 0.7391 |
| 1. PBF | D1BS23 | Proteasome-associated ATPase | 1.20e-04 | 4.55e-02 | 1.07e-28 | 0.4434 |
| 1. PBF | A9BHD3 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 3.17e-64 | 1.80e-149 | 0.7242 |
| 1. PBF | A2SHH9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.65e-58 | 2.56e-134 | 0.7126 |
| 1. PBF | A1AT11 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.19e-54 | 1.43e-129 | 0.7172 |
| 1. PBF | D3FA80 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.28e-30 | 1.19e-130 | 0.7517 |
| 1. PBF | D3EZK2 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 2.77e-29 | 1.27e-116 | 0.72 |
| 1. PBF | D1CDT8 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.07e-42 | 3.02e-149 | 0.7324 |
| 1. PBF | Q67T82 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.67e-51 | 3.02e-154 | 0.7612 |
| 1. PBF | A0L4S0 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.05e-43 | 7.49e-148 | 0.7465 |
| 1. PBF | B4SCV5 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.91e-36 | 1.77e-138 | 0.7326 |
| 1. PBF | Q9ZM66 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.52e-60 | 1.33e-138 | 0.7366 |
| 1. PBF | Q3ZBT1 | Transitional endoplasmic reticulum ATPase | 3.67e-05 | 5.12e-03 | 3.57e-50 | 0.6947 |
| 1. PBF | B4U7U4 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.80e-66 | 2.70e-144 | 0.7375 |
| 1. PBF | Q04Q03 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.84e-59 | 2.26e-139 | 0.7429 |
| 1. PBF | P63343 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 4.68e-59 | 3.50e-153 | 0.7364 |
| 1. PBF | D1C4U5 | ATP-dependent zinc metalloprotease FtsH 3 | 0.00e+00 | 1.02e-13 | 4.86e-133 | 0.8658 |
| 1. PBF | Q1XDF9 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.16e-51 | 5.66e-155 | 0.7585 |
| 1. PBF | P49825 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 9.06e-42 | 5.22e-148 | 0.7538 |
| 1. PBF | A6TWP7 | ATP-dependent zinc metalloprotease FtsH 2 | 0.00e+00 | 1.61e-43 | 3.64e-161 | 0.7068 |
| 1. PBF | P71408 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 1.65e-59 | 2.20e-138 | 0.7498 |
| 2. PF | B1AI94 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 2.30e-43 | NA | 0.767 |
| 3. BF | A0PQT9 | Proteasome-associated ATPase | 4.18e-04 | NA | 5.30e-29 | 0.3823 |
| 3. BF | C9Z319 | Proteasome-associated ATPase | 2.06e-04 | NA | 2.16e-26 | 0.4129 |
| 3. BF | C4KIR6 | Proteasome-activating nucleotidase | 2.24e-09 | NA | 1.41e-71 | 0.6313 |
| 3. BF | B4K799 | Spastin | 6.26e-05 | NA | 6.89e-31 | 0.7535 |
| 3. BF | O05209 | VCP-like ATPase | 3.41e-06 | NA | 7.18e-59 | 0.9391 |
| 3. BF | A7T395 | Spastin | 7.87e-05 | NA | 3.31e-10 | 0.73 |
| 3. BF | A7ZEJ3 | Lon protease | 3.32e-03 | NA | 0.006 | 0.37 |
| 3. BF | P54814 | 26S proteasome regulatory subunit 8 | 3.22e-08 | NA | 4.00e-56 | 0.6103 |
| 3. BF | B3DRN4 | AAA ATPase forming ring-shaped complexes | 5.21e-06 | NA | 7.29e-29 | 0.4476 |
| 3. BF | Q6NVR9 | ATPase family AAA domain-containing protein 3 | 4.68e-06 | NA | 1.20e-10 | 0.5919 |
| 3. BF | P63346 | Proteasome-associated ATPase | 1.67e-04 | NA | 2.96e-29 | 0.3889 |
| 3. BF | F6QV99 | Outer mitochondrial transmembrane helix translocase | 8.86e-10 | NA | 1.52e-36 | 0.6311 |
| 3. BF | B0SMF0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.36e-03 | NA | 2.49e-04 | 0.4523 |
| 3. BF | P9WQN4 | Proteasome-associated ATPase | 4.65e-04 | NA | 2.96e-29 | 0.3879 |
| 3. BF | Q5E9H5 | Mitochondrial chaperone BCS1 | 2.97e-05 | NA | 9.52e-11 | 0.63 |
| 3. BF | A0JWY3 | Proteasome-associated ATPase | 4.21e-04 | NA | 1.58e-29 | 0.5909 |
| 3. BF | Q0VD48 | Vacuolar protein sorting-associated protein 4B | 7.05e-06 | NA | 1.70e-31 | 0.5568 |
| 3. BF | A3Q196 | Proteasome-associated ATPase | 2.01e-04 | NA | 1.48e-29 | 0.3778 |
| 3. BF | Q6FYP6 | Holliday junction ATP-dependent DNA helicase RuvB | 4.17e-04 | NA | 0.003 | 0.6146 |
| 3. BF | Q57BH8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.25e-03 | NA | 0.047 | 0.6408 |
| 3. BF | P36966 | Peroxisomal biogenesis factor 6 | 4.86e-04 | NA | 8.14e-40 | 0.5911 |
| 3. BF | P55530 | Uncharacterized AAA family ATPase y4kL | 1.25e-06 | NA | 7.88e-17 | 0.7612 |
| 3. BF | Q8WHW9 | Protein Ycf2 | 1.04e-02 | NA | 1.47e-05 | 0.4475 |
| 3. BF | C7MWW2 | Proteasome-associated ATPase | 8.30e-05 | NA | 8.07e-29 | 0.4768 |
| 3. BF | B4NBP4 | Spastin | 1.35e-04 | NA | 7.56e-31 | 0.7569 |
| 3. BF | P09975 | Protein Ycf2 | 2.50e-02 | NA | 6.82e-10 | 0.3973 |
| 3. BF | C3PI25 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.51e-03 | NA | 0.030 | 0.4406 |
| 3. BF | Q72L14 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.59e-03 | NA | 0.030 | 0.4965 |
| 3. BF | Q6DDU8 | Fidgetin-like protein 1 | 3.67e-06 | NA | 5.53e-28 | 0.7733 |
| 3. BF | D2S6D9 | Proteasome-associated ATPase | 4.13e-05 | NA | 3.57e-28 | 0.4119 |
| 3. BF | B2SMI2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.33e-03 | NA | 5.05e-04 | 0.4949 |
| 3. BF | A9RA82 | Katanin p60 ATPase-containing subunit A-like 1 | 9.17e-06 | NA | 2.07e-35 | 0.7162 |
| 3. BF | C6AHX0 | AAA ATPase forming ring-shaped complexes | 1.38e-05 | NA | 2.18e-32 | 0.4443 |
| 3. BF | O34703 | Uncharacterized ATPase YjoB | 5.25e-06 | NA | 9.71e-19 | 0.5342 |
| 3. BF | P42811 | Putative 26S proteasome regulatory subunit homolog MTBMA_c13930 | 2.43e-09 | NA | 1.12e-31 | 0.8405 |
| 3. BF | P78578 | 26S proteasome regulatory subunit 6B homolog | 5.38e-08 | NA | 5.17e-50 | 0.5638 |
| 3. BF | P46472 | 26S proteasome regulatory subunit 7 | 1.05e-06 | NA | 1.14e-57 | 0.5628 |
| 3. BF | Q0VA52 | Spermatogenesis-associated protein 5-like protein 1 | 2.33e-05 | NA | 2.15e-35 | 0.741 |
| 3. BF | Q8SQK0 | 26S proteasome regulatory subunit 8 homolog | 2.56e-08 | NA | 5.54e-54 | 0.6091 |
| 3. BF | Q9V287 | Proteasome-activating nucleotidase | 3.12e-07 | NA | 2.19e-68 | 0.614 |
| 3. BF | C6DPU6 | Proteasome-associated ATPase | 4.38e-04 | NA | 2.96e-29 | 0.3948 |
| 3. BF | A4FBX6 | Proteasome-associated ATPase | 1.16e-04 | NA | 3.52e-29 | 0.4718 |
| 3. BF | Q85B60 | Protein Ycf2 | 5.40e-03 | NA | 0.003 | 0.4899 |
| 3. BF | Q135W8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.44e-03 | NA | 0.025 | 0.5061 |
| 3. BF | Q2GHE3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.67e-05 | NA | 0.020 | 0.6085 |
| 3. BF | C7PVU9 | Proteasome-associated ATPase | 3.36e-05 | NA | 3.22e-28 | 0.4138 |
| 3. BF | Q7X999 | Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic | 1.42e-04 | NA | 0.008 | 0.5955 |
| 3. BF | Q9X5N1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.38e-03 | NA | 0.003 | 0.4879 |
| 3. BF | A7YSY2 | Spermatogenesis-associated protein 5-like protein 1 | 3.00e-05 | NA | 1.06e-38 | 0.7836 |
| 3. BF | Q8TI88 | Proteasome-activating nucleotidase | 1.29e-09 | NA | 4.78e-61 | 0.5685 |
| 3. BF | Q25544 | 26S proteasome regulatory subunit 8 homolog | 3.68e-08 | NA | 7.58e-54 | 0.587 |
| 3. BF | P49541 | Uncharacterized AAA domain-containing protein ycf46 | 4.67e-07 | NA | 4.33e-23 | 0.8672 |
| 3. BF | Q0IIR9 | Katanin p60 ATPase-containing subunit A1 | 8.32e-06 | NA | 7.70e-34 | 0.7179 |
| 3. BF | B4PL32 | Spastin | 1.10e-04 | NA | 1.97e-29 | 0.78 |
| 3. BF | P18708 | Vesicle-fusing ATPase | 7.20e-05 | NA | 8.29e-30 | 0.4597 |
| 3. BF | Q8SR13 | 26S proteasome regulatory subunit 6A | 2.81e-11 | NA | 4.57e-60 | 0.6127 |
| 3. BF | A4QE83 | AAA ATPase forming ring-shaped complexes | 5.75e-06 | NA | 5.25e-31 | 0.4363 |
| 3. BF | C0ZZV2 | Proteasome-associated ATPase | 6.18e-05 | NA | 1.34e-28 | 0.5757 |
| 3. BF | C1AQ31 | Proteasome-associated ATPase | 1.60e-04 | NA | 2.96e-29 | 0.422 |
| 3. BF | Q3YSQ2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.71e-03 | NA | 0.027 | 0.4766 |
| 3. BF | D1A2S5 | Proteasome-associated ATPase | 9.75e-08 | NA | 5.67e-28 | 0.4152 |
| 3. BF | Q8U4H3 | Proteasome-activating nucleotidase | 2.68e-09 | NA | 9.98e-68 | 0.6243 |
| 3. BF | C3L704 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.03e-03 | NA | 0.002 | 0.4524 |
| 3. BF | Q2YRD2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.29e-03 | NA | 0.047 | 0.6402 |
| 3. BF | B8D805 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.47e-03 | NA | 4.29e-04 | 0.5119 |
| 3. BF | Q07590 | Protein SAV | 1.52e-05 | NA | 1.17e-53 | 0.5264 |
| 3. BF | C3N7K8 | Proteasome-activating nucleotidase | 8.73e-09 | NA | 1.41e-71 | 0.631 |
| 3. BF | Q8RHJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.53e-03 | NA | 0.011 | 0.4477 |
| 3. BF | B7PXE3 | Spastin | 2.19e-05 | NA | 6.18e-31 | 0.7685 |
| 3. BF | Q9RJ58 | Proteasome-associated ATPase | 7.22e-05 | NA | 2.63e-26 | 0.4106 |
| 3. BF | Q298L4 | Spastin | 4.62e-05 | NA | 3.31e-31 | 0.7211 |
| 3. BF | P46507 | 26S proteasome regulatory subunit 6B | 1.12e-11 | NA | 7.37e-50 | 0.5865 |
| 3. BF | O64982 | 26S proteasome regulatory subunit 7 | 5.18e-07 | NA | 5.58e-55 | 0.9426 |
| 3. BF | Q5RDX4 | ATPase family AAA domain-containing protein 2 | 3.69e-04 | NA | 4.63e-38 | 0.5452 |
| 3. BF | P51189 | Uncharacterized AAA domain-containing protein ycf46 | 1.56e-06 | NA | 2.41e-19 | 0.8607 |
| 3. BF | Q817Q2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.91e-03 | NA | 0.002 | 0.4835 |
| 3. BF | Q9HNP9 | Proteasome-activating nucleotidase 2 | 5.29e-09 | NA | 1.47e-61 | 0.5962 |
| 3. BF | B7NZ88 | Katanin p60 ATPase-containing subunit A-like 1 | 6.82e-06 | NA | 2.44e-34 | 0.7177 |
| 3. BF | Q64NW3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.99e-03 | NA | 0.023 | 0.4521 |
| 3. BF | O28303 | Proteasome-activating nucleotidase | 1.55e-08 | NA | 6.66e-65 | 0.6181 |
| 3. BF | B2G6E8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.27e-04 | NA | 0.021 | 0.6323 |
| 3. BF | O26824 | Proteasome-activating nucleotidase | 1.68e-07 | NA | 1.16e-63 | 0.5883 |
| 3. BF | C3MY47 | Proteasome-activating nucleotidase | 1.57e-08 | NA | 1.41e-71 | 0.6329 |
| 3. BF | D3Q568 | Proteasome-associated ATPase | 1.32e-04 | NA | 3.96e-27 | 0.4096 |
| 3. BF | Q0P3N5 | Uncharacterized protein OtCpg00170 | 1.10e-03 | NA | 2.09e-21 | 0.3346 |
| 3. BF | Q9F316 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.78e-03 | NA | 4.51e-04 | 0.4255 |
| 3. BF | Q3B8D5 | Katanin p60 ATPase-containing subunit A-like 2 | 6.42e-05 | NA | 1.54e-21 | 0.6451 |
| 3. BF | A4X741 | Proteasome-associated ATPase | 5.15e-05 | NA | 8.99e-29 | 0.4092 |
| 3. BF | B4U6S1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.19e-03 | NA | 7.36e-04 | 0.5023 |
| 3. BF | A0JMA9 | Katanin p60 ATPase-containing subunit A-like 2 | 9.68e-06 | NA | 8.98e-28 | 0.7482 |
| 3. BF | C3MQ13 | Replication factor C large subunit | 1.11e-04 | NA | 0.002 | 0.4197 |
| 3. BF | C6A7B2 | AAA ATPase forming ring-shaped complexes | 1.41e-05 | NA | 2.18e-32 | 0.4385 |
| 3. BF | Q6NFU7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.09e-02 | NA | 0.021 | 0.444 |
| 3. BF | D2Q4G5 | Proteasome-associated ATPase | 6.79e-05 | NA | 1.04e-26 | 0.6054 |
| 3. BF | Q4R7L3 | 26S proteasome regulatory subunit 6B | 7.94e-10 | NA | 5.54e-51 | 0.5917 |
| 3. BF | D0LDS6 | Proteasome-associated ATPase | 2.62e-05 | NA | 3.98e-28 | 0.6594 |
| 3. BF | Q9UVU5 | Peroxisomal biogenesis factor 6 | 3.23e-04 | NA | 8.57e-44 | 0.6483 |
| 3. BF | P46463 | Peroxisome biosynthesis protein PAS1 | 1.04e-05 | NA | 1.45e-44 | 0.5468 |
| 3. BF | Q6BS73 | Peroxisomal biogenesis factor 6 | 1.09e-03 | NA | 2.34e-37 | 0.727 |
| 3. BF | Q2KIW6 | 26S proteasome regulatory subunit 10B | 1.09e-07 | NA | 4.78e-54 | 0.6009 |
| 3. BF | Q9HG03 | Peroxisomal biogenesis factor 6 | 1.54e-04 | NA | 2.32e-41 | 0.6459 |
| 3. BF | Q2GFT9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.48e-03 | NA | 0.025 | 0.5018 |
| 3. BF | C3NE95 | Replication factor C large subunit | 1.41e-04 | NA | 0.002 | 0.4183 |
| 3. BF | C3NFW6 | Proteasome-activating nucleotidase | 8.59e-09 | NA | 2.88e-71 | 0.6248 |
| 3. BF | Q74Z13 | Peroxisomal biogenesis factor 6 | 1.13e-03 | NA | 6.89e-43 | 0.7362 |
| 3. BF | P85200 | 26S proteasome regulatory subunit 6B homolog | 2.63e-11 | NA | 5.46e-49 | 0.5806 |
| 3. BF | Q1B795 | Proteasome-associated ATPase | 1.05e-04 | NA | 1.48e-29 | 0.3838 |
| 3. BF | Q5GT33 | Holliday junction ATP-dependent DNA helicase RuvB | 1.87e-04 | NA | 0.005 | 0.6385 |
| 3. BF | Q05AS3 | Spastin | 1.63e-07 | NA | 2.75e-29 | 0.7639 |
| 3. BF | B7HEA4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.89e-03 | NA | 0.002 | 0.4206 |
| 3. BF | B4F6J6 | Outer mitochondrial transmembrane helix translocase | 8.64e-10 | NA | 6.52e-36 | 0.8209 |
| 3. BF | Q2J9Q0 | Proteasome-associated ATPase | 6.51e-05 | NA | 5.17e-28 | 0.4019 |
| 3. BF | A3CV35 | Proteasome-activating nucleotidase | 3.41e-07 | NA | 2.23e-59 | 0.5849 |
| 3. BF | C3NHF4 | Replication factor C large subunit | 1.04e-04 | NA | 8.11e-04 | 0.4263 |
| 3. BF | A1TAQ3 | Proteasome-associated ATPase | 4.28e-04 | NA | 4.29e-29 | 0.582 |
| 3. BF | B4JII0 | Spastin | 2.32e-05 | NA | 6.33e-32 | 0.7326 |
| 3. BF | Q20EZ8 | ATP-dependent zinc metalloprotease FtsH homolog | 2.57e-02 | NA | 5.71e-20 | 0.4147 |
| 3. BF | B0SEC2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.90e-03 | NA | 2.49e-04 | 0.4635 |
| 3. BF | B3M301 | Spastin | 1.58e-04 | NA | 4.68e-32 | 0.7591 |
| 3. BF | Q90732 | 26S proteasome regulatory subunit 4 | 1.98e-06 | NA | 1.97e-49 | 0.5453 |
| 3. BF | B3P8A3 | Spastin | 1.66e-04 | NA | 1.97e-29 | 0.734 |
| 3. BF | Q045Q2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.14e-04 | NA | 0.006 | 0.6425 |
| 3. BF | B8ZRF0 | Proteasome-associated ATPase | 2.64e-05 | NA | 5.25e-29 | 0.3819 |
| 3. BF | C7MCZ0 | AAA ATPase forming ring-shaped complexes | 3.56e-05 | NA | 5.37e-29 | 0.4384 |
| 3. BF | P61539 | Holliday junction ATP-dependent DNA helicase RuvB | 8.44e-04 | NA | 0.009 | 0.5495 |
| 3. BF | O64981 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 1.15e-04 | NA | 0.007 | 0.6081 |
| 3. BF | C4LIL2 | AAA ATPase forming ring-shaped complexes | 4.74e-05 | NA | 1.41e-31 | 0.4271 |
| 3. BF | P62197 | 26S proteasome regulatory subunit 8 | 3.47e-08 | NA | 7.90e-55 | 0.6037 |
| 3. BF | A5VS58 | Holliday junction ATP-dependent DNA helicase RuvB | 1.63e-03 | NA | 0.047 | 0.6335 |
| 3. BF | Q4R4R0 | 26S proteasome regulatory subunit 7 | 1.08e-06 | NA | 2.75e-57 | 0.5588 |
| 3. BF | Q6AZT2 | Spastin | 8.75e-08 | NA | 9.32e-30 | 0.7962 |
| 3. BF | P85190 | ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) | 0.00e+00 | NA | 2.54e-69 | 0.9001 |
| 3. BF | C8XAR0 | Proteasome-associated ATPase | 1.82e-05 | NA | 5.44e-28 | 0.4102 |
| 3. BF | A1UHT0 | Proteasome-associated ATPase | 4.53e-04 | NA | 1.48e-29 | 0.3824 |
| 3. BF | Q6PAX2 | ATPase family AAA domain-containing protein 3-B | 5.16e-07 | NA | 7.54e-11 | 0.6089 |
| 3. BF | Q633X2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.18e-03 | NA | 0.002 | 0.4062 |
| 3. BF | B8E5E8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.19e-02 | NA | 6.15e-04 | 0.5143 |
| 3. BF | Q5YUW4 | Proteasome-associated ATPase | 2.17e-04 | NA | 2.88e-29 | 0.5941 |
| 3. BF | Q8NQD8 | AAA ATPase forming ring-shaped complexes | 6.12e-06 | NA | 5.25e-31 | 0.441 |
| 3. BF | B8H8L3 | Proteasome-associated ATPase | 4.79e-05 | NA | 6.54e-31 | 0.6125 |
| 3. BF | Q4JVP5 | AAA ATPase forming ring-shaped complexes | 4.19e-05 | NA | 3.95e-33 | 0.4549 |
| 3. BF | Q6B952 | Uncharacterized AAA domain-containing protein ycf46 | 4.66e-07 | NA | 2.44e-28 | 0.8487 |
| 3. BF | Q6CPV1 | Peroxisomal biogenesis factor 6 | 1.17e-05 | NA | 4.46e-41 | 0.7657 |
| 3. BF | Q719N1 | Spastin | 4.75e-07 | NA | 1.49e-30 | 0.7397 |
| 3. BF | B1W303 | Proteasome-associated ATPase | 1.70e-04 | NA | 1.82e-26 | 0.4147 |
| 3. BF | Q98F76 | Holliday junction ATP-dependent DNA helicase RuvB | 5.08e-05 | NA | 0.035 | 0.5982 |
| 3. BF | C7LYP4 | Proteasome-associated ATPase | 1.33e-04 | NA | 8.41e-28 | 0.6272 |
| 3. BF | Q60QD1 | Fidgetin-like protein 1 | 5.00e-06 | NA | 9.53e-30 | 0.752 |
| 3. BF | C3MVD2 | Replication factor C large subunit | 1.04e-04 | NA | 0.008 | 0.4225 |
| 3. BF | D4GUJ7 | Proteasome-activating nucleotidase 1 | 1.87e-08 | NA | 8.68e-61 | 0.6009 |
| 3. BF | A1KKF8 | Proteasome-associated ATPase | 4.41e-04 | NA | 2.96e-29 | 0.4112 |
| 3. BF | A4TB65 | Proteasome-associated ATPase | 3.84e-04 | NA | 1.12e-28 | 0.5826 |
| 3. BF | Q8A128 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.04e-03 | NA | 0.020 | 0.4554 |
| 3. BF | Q5R8D7 | 26S proteasome regulatory subunit 7 | 7.23e-07 | NA | 5.94e-58 | 0.6216 |
| 3. BF | A1A0U4 | AAA ATPase forming ring-shaped complexes | 1.54e-05 | NA | 8.67e-33 | 0.4534 |
| 3. BF | A9WWH9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.50e-03 | NA | 0.047 | 0.634 |
| 3. BF | Q03ER0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.01e-03 | NA | 0.036 | 0.6541 |
| 3. BF | A9IYK5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.96e-04 | NA | 0.006 | 0.594 |
| 3. BF | Q1HGK7 | Katanin p60 ATPase-containing subunit A1 | 1.36e-05 | NA | 6.02e-34 | 0.7242 |
| 3. BF | B4HGG6 | Spastin | 1.49e-04 | NA | 2.03e-29 | 0.7796 |
| 3. BF | B2S7D9 | Holliday junction ATP-dependent DNA helicase RuvB | 5.23e-05 | NA | 0.047 | 0.6415 |
| 3. BF | Q8SRH0 | 26S proteasome regulatory subunit 4 homolog | 2.40e-12 | NA | 9.84e-51 | 0.5691 |
| 3. BF | Q47NX7 | Proteasome-associated ATPase | 1.60e-04 | NA | 3.26e-28 | 0.4237 |
| 3. BF | C1ASQ2 | Proteasome-associated ATPase | 5.55e-05 | NA | 1.18e-28 | 0.4095 |
| 3. BF | B1VDV2 | AAA ATPase forming ring-shaped complexes | 1.46e-05 | NA | 2.61e-31 | 0.4393 |
| 3. BF | P54778 | 26S proteasome regulatory subunit 6B homolog | 1.35e-09 | NA | 3.75e-48 | 0.5993 |
| 3. BF | C6WIC8 | Proteasome-associated ATPase | 9.00e-05 | NA | 2.27e-28 | 0.4161 |
| 3. BF | C5CBU4 | AAA ATPase forming ring-shaped complexes | 1.68e-04 | NA | 1.28e-31 | 0.4358 |
| 3. BF | Q41365 | 26S proteasome regulatory subunit 7 | 8.11e-07 | NA | 1.03e-54 | 0.9378 |
| 3. BF | A8QFF6 | Probable spastin homolog Bm1_53365 | 1.39e-07 | NA | 7.07e-26 | 0.8225 |
| 3. BF | Q3T030 | 26S proteasome regulatory subunit 6B | 8.93e-10 | NA | 5.54e-51 | 0.5957 |
| 3. BF | Q5ZK92 | Spastin | 2.48e-06 | NA | 6.32e-31 | 0.7258 |
| 3. BF | Q58E76 | ATPase family AAA domain-containing protein 3-A | 1.37e-05 | NA | 1.10e-10 | 0.6107 |
| 3. BF | B2HFW2 | Proteasome-associated ATPase | 1.44e-04 | NA | 4.79e-29 | 0.3908 |
| 3. BF | O61577 | Katanin p60 ATPase-containing subunit A1 | 1.58e-05 | NA | 6.90e-36 | 0.7793 |
| 3. BF | D2ATX1 | Proteasome-associated ATPase | 8.51e-05 | NA | 4.73e-28 | 0.425 |
| 3. BF | Q975U2 | Proteasome-activating nucleotidase | 2.77e-09 | NA | 1.90e-69 | 0.6249 |
| 3. BF | P62194 | 26S proteasome regulatory subunit 8 | 1.75e-08 | NA | 7.90e-55 | 0.6034 |
| 3. BF | A6WLQ2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.37e-02 | NA | 6.47e-04 | 0.4513 |
| 3. BF | Q0AJI3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.49e-03 | NA | 6.54e-04 | 0.4208 |
| 3. BF | Q821L9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.03e-03 | NA | 0.012 | 0.4493 |
| 3. BF | A4G0S4 | Proteasome-activating nucleotidase | 1.02e-06 | NA | 4.13e-64 | 0.5975 |
| 3. BF | B4G437 | Spastin | 1.05e-04 | NA | 3.00e-31 | 0.7568 |
| 3. BF | A7I8B8 | Proteasome-activating nucleotidase | 1.92e-12 | NA | 5.95e-62 | 0.5605 |
| 3. BF | P54776 | 26S proteasome regulatory subunit 6A homolog | 3.95e-08 | NA | 6.06e-60 | 0.9201 |
| 3. BF | Q0RLU1 | Proteasome-associated ATPase | 4.09e-04 | NA | 5.94e-28 | 0.4218 |
| 3. BF | P56369 | ATP-dependent zinc metalloprotease FtsH homolog | 8.13e-04 | NA | 3.64e-25 | 0.5282 |
| 3. BF | B4USW8 | Katanin p60 ATPase-containing subunit A-like 1 | 5.27e-06 | NA | 1.33e-34 | 0.7167 |
| 3. BF | A6W963 | Proteasome-associated ATPase | 1.23e-04 | NA | 9.93e-28 | 0.4215 |
| 3. BF | Q5R410 | Vesicle-fusing ATPase | 5.60e-05 | NA | 6.01e-30 | 0.457 |
| 3. BF | Q2FQ56 | Proteasome-activating nucleotidase | 4.60e-08 | NA | 6.52e-59 | 0.5831 |
| 3. BF | Q975D4 | Replication factor C large subunit | 1.01e-04 | NA | 0.005 | 0.3904 |
| 3. BF | B4M0H8 | Spastin | 5.82e-05 | NA | 1.02e-30 | 0.7543 |
| 3. BF | A1VE84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.25e-03 | NA | 0.014 | 0.5071 |
| 3. BF | C5A6P8 | Proteasome-activating nucleotidase | 6.61e-07 | NA | 6.42e-69 | 0.6148 |
| 3. BF | B3R0J0 | Holliday junction ATP-dependent DNA helicase RuvB | 5.34e-05 | NA | 0.030 | 0.6277 |
| 3. BF | P46470 | 26S proteasome regulatory subunit 8 | 2.83e-07 | NA | 1.07e-54 | 0.5675 |
| 3. BF | Q5E9F9 | 26S proteasome regulatory subunit 7 | 3.07e-07 | NA | 2.75e-57 | 0.5624 |
| 3. BF | Q5R658 | Vacuolar protein sorting-associated protein 4B | 7.84e-06 | NA | 2.91e-31 | 0.5567 |
| 3. BF | A6VHR1 | Proteasome-activating nucleotidase | 8.34e-07 | NA | 3.73e-65 | 0.5981 |
| 3. BF | A8LH57 | Proteasome-associated ATPase | 3.22e-04 | NA | 1.35e-27 | 0.3977 |
| 3. BF | Q6FW67 | Peroxisomal biogenesis factor 6 | 5.35e-04 | NA | 1.22e-42 | 0.7415 |
| 3. BF | A5VIX2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.25e-04 | NA | 0.021 | 0.6335 |
| 3. BF | Q72ZV4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.23e-03 | NA | 0.002 | 0.3884 |
| 3. BF | B4QSF0 | Spastin | 1.68e-04 | NA | 6.58e-29 | 0.769 |
| 3. BF | O42587 | 26S proteasome regulatory subunit 6A-A | 2.65e-08 | NA | 1.63e-60 | 0.8774 |
| 3. BF | Q6NH92 | AAA ATPase forming ring-shaped complexes | 3.39e-05 | NA | 8.55e-33 | 0.4516 |
| 3. BF | C3MZI6 | Proteasome-activating nucleotidase | 5.00e-08 | NA | 1.41e-71 | 0.6315 |
| 3. BF | Q7NUZ0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 0.002 | 0.4377 |
| 3. BF | D0FH76 | Vacuolar protein sorting-associated protein 4 | 6.10e-06 | NA | 2.23e-32 | 0.4981 |
| 3. BF | Q6LWR0 | Proteasome-activating nucleotidase | 9.78e-07 | NA | 1.46e-64 | 0.5977 |
| 3. BF | A1RWU6 | Replication factor C large subunit | 1.04e-04 | NA | 0.013 | 0.4171 |
| 3. BF | A8M2A0 | Proteasome-associated ATPase | 5.75e-05 | NA | 2.04e-28 | 0.4112 |
| 3. BF | Q8TX03 | Proteasome-activating nucleotidase | 3.90e-13 | NA | 2.00e-68 | 0.571 |
| 3. BF | B2GIP2 | AAA ATPase forming ring-shaped complexes | 9.91e-05 | NA | 8.96e-29 | 0.7314 |
| 3. BF | O57940 | Proteasome-activating nucleotidase | 8.93e-07 | NA | 1.17e-68 | 0.6095 |
| 3. BF | B3CMH5 | Holliday junction ATP-dependent DNA helicase RuvB | 5.45e-04 | NA | 0.003 | 0.5874 |
| 3. BF | O42586 | 26S proteasome regulatory subunit 6A-B | 1.70e-08 | NA | 3.18e-61 | 0.9159 |
| 3. BF | P61533 | Holliday junction ATP-dependent DNA helicase RuvB | 2.51e-04 | NA | 0.004 | 0.67 |
| 3. BF | P33289 | Peroxisomal biogenesis factor 6 | 1.43e-04 | NA | 2.25e-39 | 0.6303 |
| 3. BF | A0QZ54 | Proteasome-associated ATPase | 3.93e-04 | NA | 5.99e-29 | 0.5941 |
| 3. BF | O23894 | 26S proteasome regulatory subunit 6A homolog | 4.04e-08 | NA | 3.18e-60 | 0.5746 |
| 3. BF | A9A916 | Proteasome-activating nucleotidase | 1.99e-07 | NA | 1.25e-64 | 0.5957 |
| 3. BF | Q3YRD9 | Holliday junction ATP-dependent DNA helicase RuvB | 4.52e-04 | NA | 0.020 | 0.6207 |
| 3. BF | D1BHU2 | Proteasome-associated ATPase | 8.99e-05 | NA | 1.13e-25 | 0.4193 |
| 3. BF | A9WSI4 | Proteasome-associated ATPase | 1.66e-05 | NA | 2.67e-28 | 0.6166 |
| 3. BF | Q60C67 | ATP-dependent Clp protease ATP-binding subunit ClpX 1 | 9.89e-03 | NA | 0.005 | 0.4648 |
| 3. BF | Q9HRW6 | Proteasome-activating nucleotidase 1 | 2.78e-08 | NA | 2.74e-58 | 0.6046 |
| 3. BF | P62335 | 26S proteasome regulatory subunit 10B | 4.23e-08 | NA | 2.38e-54 | 0.6146 |
| 3. BF | Q5JHS5 | Proteasome-activating nucleotidase | 1.79e-09 | NA | 2.75e-68 | 0.6179 |
| 3. BF | A2VDN5 | Spastin | 1.37e-06 | NA | 7.32e-30 | 0.7797 |
| 3. BF | Q9HPF0 | Protein CdcH | 2.30e-06 | NA | 9.31e-55 | 0.9423 |
| 3. BF | Q5HBX4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.028 | 0.4462 |
| 3. BF | Q8FTE3 | AAA ATPase forming ring-shaped complexes | 6.06e-06 | NA | 1.40e-31 | 0.4283 |
| 3. BF | A4IHT0 | Fidgetin-like protein 1 | 4.78e-05 | NA | 1.70e-28 | 0.7533 |
| 3. BF | A9M7K0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.56e-03 | NA | 0.047 | 0.6417 |
| 3. BF | D2NT89 | AAA ATPase forming ring-shaped complexes | 3.62e-05 | NA | 5.39e-24 | 0.3894 |
| 3. BF | P75242 | Holliday junction ATP-dependent DNA helicase RuvB | 1.76e-05 | NA | 0.044 | 0.5916 |
| 3. BF | Q7SGP2 | Peroxisomal biogenesis factor 6 | 2.46e-03 | NA | 2.69e-38 | 0.6507 |
| 3. BF | F2Z6D2 | Cell division protein C | 9.15e-08 | NA | 4.81e-29 | 0.7645 |
| 3. BF | Q980M1 | Proteasome-activating nucleotidase | 1.88e-08 | NA | 3.96e-74 | 0.6139 |
| 3. BF | A0QFB2 | Proteasome-associated ATPase | 4.28e-04 | NA | 2.28e-29 | 0.3819 |
| 3. BF | B7GUP3 | AAA ATPase forming ring-shaped complexes | 6.04e-06 | NA | 2.77e-29 | 0.4479 |
| 3. BF | Q828J2 | Proteasome-associated ATPase | 2.07e-04 | NA | 3.38e-26 | 0.4159 |
| 3. BF | Q8SQI9 | 26S proteasome regulatory subunit 6B homolog | 6.00e-10 | NA | 5.50e-50 | 0.6322 |
| 3. BF | B7HQN2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.21e-03 | NA | 0.002 | 0.4056 |
| 3. BF | C0R4X2 | Holliday junction ATP-dependent DNA helicase RuvB | 4.37e-04 | NA | 0.009 | 0.6085 |
| 3. BF | Q8FN57 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.56e-03 | NA | 0.040 | 0.472 |
| 3. BF | Q5L4W6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.09e-02 | NA | 0.011 | 0.4508 |
| 3. BF | C3MRF1 | Proteasome-activating nucleotidase | 9.05e-09 | NA | 1.41e-71 | 0.6313 |
| 3. BF | Q5L8L7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.60e-03 | NA | 0.023 | 0.4507 |
| 3. BF | C3N5N1 | Replication factor C large subunit | 9.92e-05 | NA | 0.008 | 0.4215 |
| 3. BF | B3EX35 | Katanin p60 ATPase-containing subunit A-like 1 | 6.82e-06 | NA | 1.82e-34 | 0.711 |
| 3. BF | Q7ZTL7 | Mitochondrial chaperone BCS1 | 2.50e-05 | NA | 2.45e-13 | 0.4315 |
| 3. BF | Q8PY58 | Proteasome-activating nucleotidase | 2.79e-08 | NA | 2.54e-62 | 0.5766 |
| 3. BF | C3P9F7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.16e-03 | NA | 0.002 | 0.3713 |
| 3. BF | Q8G3G6 | AAA ATPase forming ring-shaped complexes | 9.77e-05 | NA | 3.58e-29 | 0.4473 |
| 3. BF | B1MAH2 | Proteasome-associated ATPase | 7.98e-05 | NA | 9.97e-30 | 0.6914 |
| 3. BF | Q8CXB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.81e-03 | NA | 7.17e-04 | 0.4889 |
| 3. BF | Q9C1E9 | Peroxisomal biogenesis factor 6 | 1.21e-03 | NA | 2.83e-42 | 0.7682 |
| 3. BF | Q7QBW0 | Spastin | 1.35e-06 | NA | 4.31e-32 | 0.7778 |
| 3. BF | B5X3X5 | Katanin p60 ATPase-containing subunit A1 | 1.12e-05 | NA | 2.34e-34 | 0.7037 |
| 3. BF | C3PGA0 | AAA ATPase forming ring-shaped complexes | 4.93e-05 | NA | 1.97e-31 | 0.4519 |
| 3. BF | A8X0L9 | Tat-binding homolog 7 | 8.71e-04 | NA | 3.89e-37 | 0.6453 |
| 3. BF | A1R6Q4 | Proteasome-associated ATPase | 6.71e-05 | NA | 5.61e-29 | 0.6188 |
| 3. BF | P46509 | Proteasome-associated ATPase | 2.50e-05 | NA | 5.25e-29 | 0.3817 |
| 3. BF | P34732 | Vesicular-fusion protein SEC18 | 3.57e-04 | NA | 5.48e-28 | 0.4525 |
| 3. BF | A7YWC4 | ATPase family AAA domain-containing protein 3 | 3.60e-05 | NA | 4.35e-09 | 0.6069 |
| 3. BF | Q0SIF4 | Proteasome-associated ATPase | 3.77e-04 | NA | 1.30e-28 | 0.5958 |
| 3. BF | D3R4I7 | AAA ATPase forming ring-shaped complexes | 6.45e-06 | NA | 2.32e-32 | 0.4365 |
| 3. BF | O78439 | Uncharacterized AAA domain-containing protein ycf46 | 1.18e-06 | NA | 1.10e-29 | 0.8691 |
| 3. BF | B2V6N0 | Lon protease | 4.83e-03 | NA | 0.004 | 0.3977 |
| 3. BF | Q0W257 | Proteasome-activating nucleotidase | 4.91e-07 | NA | 2.76e-64 | 0.5859 |
| 3. BF | Q8SSJ5 | Cell division control protein 48 | 7.79e-05 | NA | 3.55e-54 | 0.8075 |
| 3. BF | Q9PUL2 | Katanin p60 ATPase-containing subunit A1 (Fragment) | 1.92e-05 | NA | 9.27e-34 | 0.7132 |
| 3. BF | B8GGN4 | Proteasome-activating nucleotidase | 3.60e-07 | NA | 1.14e-61 | 0.5896 |
| 3. BF | P61243 | Protein Ycf2 | 1.10e-02 | NA | 4.77e-05 | 0.4061 |
| 3. BF | A6UQT3 | Proteasome-activating nucleotidase | 5.94e-07 | NA | 9.22e-63 | 0.5994 |
| 3. BF | A5CR08 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.87e-02 | NA | 0.008 | 0.4392 |
| 3. BF | C7R400 | Proteasome-associated ATPase | 8.86e-05 | NA | 1.33e-28 | 0.4484 |
| 3. BF | D2Q9C6 | AAA ATPase forming ring-shaped complexes | 1.32e-05 | NA | 1.01e-32 | 0.4512 |
| 3. BF | A1WUM6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.68e-03 | NA | 0.001 | 0.432 |
| 3. BF | Q1XDU8 | Uncharacterized AAA domain-containing protein ycf46 | 1.49e-06 | NA | 7.38e-22 | 0.8496 |
| 3. BF | O28972 | Cell division cycle protein 48 homolog AF_1297 | 1.50e-05 | NA | 1.33e-59 | 0.4048 |
| 3. BF | Q81LB9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.21e-03 | NA | 0.002 | 0.3855 |
| 3. BF | A1SK07 | Proteasome-associated ATPase | 1.46e-04 | NA | 8.07e-28 | 0.4068 |
| 3. BF | C4LJV6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.37e-02 | NA | 0.017 | 0.442 |
| 3. BF | B0U5N2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.82e-03 | NA | 6.36e-04 | 0.4123 |
| 3. BF | Q9YAC7 | Proteasome-activating nucleotidase | 3.02e-07 | NA | 1.55e-67 | 0.5858 |
| 3. BF | Q5AWS6 | Cell division control protein 48 | 9.07e-05 | NA | 6.31e-52 | 0.8011 |
| 3. BF | Q8FZ02 | Holliday junction ATP-dependent DNA helicase RuvB | 1.63e-03 | NA | 0.047 | 0.6402 |
| 3. BF | A0LU46 | Proteasome-associated ATPase | 5.74e-08 | NA | 5.75e-29 | 0.5957 |
| 3. BF | O50202 | Proteasome-associated ATPase | 1.73e-04 | NA | 1.34e-28 | 0.4013 |
| 3. BF | A8XV40 | Probable spastin homolog spas-1 | 3.07e-06 | NA | 1.67e-30 | 0.6341 |
| 3. BF | Q4R407 | Katanin p60 ATPase-containing subunit A1 | 5.82e-07 | NA | 7.53e-34 | 0.7752 |
| 3. BF | Q03YJ6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.56e-03 | NA | 0.031 | 0.6503 |
| 3. BF | O27092 | Putative 26S proteasome regulatory subunit homolog MTH_1011 | 1.67e-10 | NA | 7.53e-31 | 0.8567 |
| 3. BF | A5U4E1 | Proteasome-associated ATPase | 2.39e-04 | NA | 2.96e-29 | 0.38 |
| 3. BF | B8DTX4 | AAA ATPase forming ring-shaped complexes | 1.53e-06 | NA | 2.18e-32 | 0.4384 |
| 3. BF | A5WP89 | Proteasome-associated ATPase | 4.58e-04 | NA | 2.96e-29 | 0.3948 |
| 3. BF | Q5UT56 | Proteasome-activating nucleotidase 2 | 6.74e-08 | NA | 9.75e-60 | 0.5804 |
| 3. BF | B6YXR2 | Proteasome-activating nucleotidase | 2.21e-10 | NA | 5.67e-67 | 0.6139 |
| 3. BF | Q859W7 | Protein Ycf2 | 1.34e-02 | NA | 6.19e-14 | 0.4529 |
| 3. BF | B9IZ47 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.55e-03 | NA | 0.002 | 0.4033 |
| 4. PB | P54811 | Transitional endoplasmic reticulum ATPase homolog 1 | 1.57e-04 | 1.09e-02 | 4.90e-49 | NA |
| 4. PB | O59824 | ATP-dependent zinc metalloprotease YME1 homolog | 2.22e-16 | 4.38e-07 | 7.97e-125 | NA |
| 4. PB | Q67WJ2 | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic | 1.11e-16 | 1.61e-20 | 3.78e-138 | NA |
| 4. PB | P54812 | Transitional endoplasmic reticulum ATPase homolog 2 | 2.53e-04 | 1.34e-02 | 2.32e-53 | NA |
| 4. PB | Q8VZI8 | ATP-dependent zinc metalloprotease FTSH 10, mitochondrial | 1.11e-16 | 8.42e-14 | 1.02e-126 | NA |
| 4. PB | Q9FH02 | ATP-dependent zinc metalloprotease FTSH 5, chloroplastic | 0.00e+00 | 1.23e-07 | 8.76e-144 | NA |
| 4. PB | Q39102 | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic | 0.00e+00 | 5.02e-04 | 2.60e-142 | NA |
| 4. PB | Q6H6R9 | ATP-dependent zinc metalloprotease FTSH 7, chloroplastic | 3.83e-13 | 1.25e-03 | 6.56e-104 | NA |
| 4. PB | P0AAI3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 3.63e-58 | 9.22e-155 | NA |
| 4. PB | Q9N3T5 | AFG3-like protein spg-7 | 0.00e+00 | 4.74e-16 | 1.12e-121 | NA |
| 4. PB | P32795 | Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 | 6.66e-16 | 3.72e-09 | 5.52e-116 | NA |
| 4. PB | Q0DHL4 | ATP-dependent zinc metalloprotease FTSH 8, mitochondrial | 4.44e-16 | 8.70e-10 | 2.25e-131 | NA |
| 4. PB | Q8S2A7 | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial | 0.00e+00 | 1.76e-08 | 4.10e-128 | NA |
| 4. PB | Q655S1 | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic | 0.00e+00 | 2.88e-23 | 2.38e-150 | NA |
| 4. PB | Q01853 | Transitional endoplasmic reticulum ATPase | 6.77e-06 | 5.07e-03 | 3.97e-50 | NA |
| 4. PB | Q58556 | Cell division cycle protein 48 homolog MJ1156 | 4.58e-05 | 2.15e-02 | 7.24e-61 | NA |
| 4. PB | O88967 | ATP-dependent zinc metalloprotease YME1L1 | 3.38e-14 | 2.50e-05 | 7.66e-127 | NA |
| 4. PB | P25694 | Cell division control protein 48 | 4.34e-04 | 2.43e-03 | 2.00e-51 | NA |
| 4. PB | P40341 | Mitochondrial respiratory chain complexes assembly protein YTA12 | 8.88e-16 | 1.35e-09 | 2.45e-126 | NA |
| 4. PB | Q3ULF4 | Paraplegin | 0.00e+00 | 3.91e-09 | 1.81e-122 | NA |
| 4. PB | Q7TT47 | Paraplegin | 0.00e+00 | 7.36e-10 | 2.21e-122 | NA |
| 4. PB | Q9SAJ3 | ATP-dependent zinc metalloprotease FTSH 12, chloroplastic | 1.59e-10 | 5.57e-03 | 4.04e-58 | NA |
| 4. PB | Q9SD67 | ATP-dependent zinc metalloprotease FTSH 7, chloroplastic | 7.38e-14 | 4.48e-07 | 1.58e-107 | NA |
| 4. PB | Q9Y4W6 | AFG3-like protein 2 | 1.55e-15 | 6.38e-14 | 3.87e-134 | NA |
| 4. PB | Q9P3A7 | Cell division cycle protein 48 | 4.65e-03 | 3.56e-02 | 4.05e-51 | NA |
| 4. PB | Q8JZQ2 | AFG3-like protein 2 | 0.00e+00 | 5.35e-14 | 5.08e-134 | NA |
| 4. PB | P54813 | ATP-dependent zinc metalloprotease YME1 homolog | 1.17e-13 | 1.68e-18 | 1.86e-122 | NA |
| 4. PB | P46462 | Transitional endoplasmic reticulum ATPase | 3.12e-05 | 4.79e-03 | 4.09e-50 | NA |
| 4. PB | Q5Z974 | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic | 0.00e+00 | 2.79e-14 | 1.67e-142 | NA |
| 4. PB | Q9UQ90 | Paraplegin | 0.00e+00 | 1.08e-13 | 1.39e-120 | NA |
| 4. PB | Q925S8 | ATP-dependent zinc metalloprotease YME1L1 | 4.30e-13 | 7.40e-05 | 3.07e-124 | NA |
| 4. PB | P55072 | Transitional endoplasmic reticulum ATPase | 1.95e-05 | 5.07e-03 | 3.97e-50 | NA |
| 4. PB | Q7ZU99 | Transitional endoplasmic reticulum ATPase | 4.15e-05 | 6.05e-03 | 4.39e-51 | NA |
| 4. PB | O80860 | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic | 0.00e+00 | 2.74e-18 | 6.50e-149 | NA |
| 4. PB | P39925 | Mitochondrial respiratory chain complexes assembly protein AFG3 | 0.00e+00 | 2.13e-10 | 7.66e-132 | NA |
| 4. PB | O80983 | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial | 3.11e-15 | 2.35e-17 | 3.00e-118 | NA |
| 4. PB | Q1PDW5 | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic | 0.00e+00 | 1.41e-16 | 3.42e-150 | NA |
| 4. PB | Q9HGM3 | Mitochondrial respiratory chain complexes assembly protein rca1 | 1.11e-16 | 5.18e-10 | 3.08e-125 | NA |
| 4. PB | P9WQN3 | ATP-dependent zinc metalloprotease FtsH | 0.00e+00 | 8.67e-16 | 2.00e-137 | NA |
| 4. PB | Q8LQJ9 | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial | 2.78e-15 | 3.42e-21 | 4.00e-120 | NA |
| 4. PB | Q9FIM2 | ATP-dependent zinc metalloprotease FTSH 9, chloroplastic | 2.66e-13 | 1.95e-09 | 5.17e-107 | NA |
| 4. PB | Q920A7 | AFG3-like protein 1 | 1.11e-16 | 4.22e-14 | 4.66e-131 | NA |
| 4. PB | Q9LZF6 | Cell division control protein 48 homolog E | 1.23e-05 | 2.65e-03 | 3.50e-51 | NA |
| 4. PB | Q84WU8 | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial | 8.99e-15 | 3.93e-15 | 8.77e-121 | NA |
| 4. PB | Q8W585 | ATP-dependent zinc metalloprotease FTSH 8, chloroplastic | 0.00e+00 | 1.89e-22 | 1.08e-148 | NA |
| 4. PB | P54609 | Cell division control protein 48 homolog A | 1.40e-05 | 2.13e-02 | 2.00e-51 | NA |
| 4. PB | F4KF14 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic | 1.86e-11 | 3.54e-08 | 4.67e-74 | NA |
| 4. PB | Q7KN62 | Transitional endoplasmic reticulum ATPase TER94 | 9.52e-03 | 4.49e-03 | 4.10e-53 | NA |
| 4. PB | Q8LQJ8 | ATP-dependent zinc metalloprotease FTSH 5, mitochondrial | 2.22e-16 | 5.16e-15 | 8.89e-122 | NA |
| 4. PB | P54774 | Cell division cycle protein 48 homolog | 2.79e-05 | 1.06e-02 | 1.52e-53 | NA |
| 4. PB | Q9SCN8 | Cell division control protein 48 homolog D | 8.04e-06 | 1.43e-02 | 4.51e-52 | NA |
| 6. F | C1KVH9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.98e-03 | NA | NA | 0.6295 |
| 6. F | Q475R8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.43e-04 | NA | NA | 0.6378 |
| 6. F | C5CM03 | Holliday junction ATP-dependent DNA helicase RuvB | 1.03e-03 | NA | NA | 0.509 |
| 6. F | C3LNE8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.27e-03 | NA | NA | 0.6461 |
| 6. F | Q82XP4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.27e-03 | NA | NA | 0.5319 |
| 6. F | Q1CJG5 | Holliday junction ATP-dependent DNA helicase RuvB | 8.99e-05 | NA | NA | 0.6401 |
| 6. F | Q5HNR0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.28e-04 | NA | NA | 0.6011 |
| 6. F | Q46IJ6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.38e-04 | NA | NA | 0.5301 |
| 6. F | A0K4L4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.23e-04 | NA | NA | 0.6374 |
| 6. F | A6U2A9 | Holliday junction ATP-dependent DNA helicase RuvB | 8.37e-04 | NA | NA | 0.6369 |
| 6. F | A4J537 | Holliday junction ATP-dependent DNA helicase RuvB | 6.06e-05 | NA | NA | 0.6288 |
| 6. F | Q5JHP1 | Replication factor C large subunit | 2.66e-04 | NA | NA | 0.315 |
| 6. F | Q2NTI8 | Holliday junction ATP-dependent DNA helicase RuvB | 9.89e-05 | NA | NA | 0.6155 |
| 6. F | B8JF05 | Holliday junction ATP-dependent DNA helicase RuvB | 2.12e-05 | NA | NA | 0.6293 |
| 6. F | B7USN7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-04 | NA | NA | 0.6383 |
| 6. F | Q1GYS6 | Holliday junction ATP-dependent DNA helicase RuvB | 8.65e-04 | NA | NA | 0.6288 |
| 6. F | A7NFB8 | Chromosomal replication initiator protein DnaA | 6.58e-04 | NA | NA | 0.3914 |
| 6. F | Q8DWI4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.01e-04 | NA | NA | 0.6237 |
| 6. F | Q8E7U6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.05e-03 | NA | NA | 0.6695 |
| 6. F | Q2JD94 | Holliday junction ATP-dependent DNA helicase RuvB | 3.68e-04 | NA | NA | 0.6088 |
| 6. F | P66759 | Holliday junction ATP-dependent DNA helicase RuvB | 8.34e-04 | NA | NA | 0.6372 |
| 6. F | C4ZQE4 | Holliday junction ATP-dependent DNA helicase RuvB | 9.40e-05 | NA | NA | 0.635 |
| 6. F | P61534 | Holliday junction ATP-dependent DNA helicase RuvB | 1.93e-04 | NA | NA | 0.5708 |
| 6. F | Q8P6E7 | Holliday junction ATP-dependent DNA helicase RuvB | 9.78e-05 | NA | NA | 0.6352 |
| 6. F | A9N9A3 | Holliday junction ATP-dependent DNA helicase RuvB | 2.25e-03 | NA | NA | 0.6439 |
| 6. F | Q2P575 | Holliday junction ATP-dependent DNA helicase RuvB | 4.18e-04 | NA | NA | 0.6351 |
| 6. F | Q7N547 | Holliday junction ATP-dependent DNA helicase RuvB | 9.11e-05 | NA | NA | 0.6368 |
| 6. F | A8A160 | Holliday junction ATP-dependent DNA helicase RuvB | 7.90e-05 | NA | NA | 0.6354 |
| 6. F | Q83BE0 | Holliday junction ATP-dependent DNA helicase RuvB | 4.99e-04 | NA | NA | 0.599 |
| 6. F | Q5HT48 | Holliday junction ATP-dependent DNA helicase RuvB | 1.59e-05 | NA | NA | 0.5776 |
| 6. F | C1ESW4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.90e-04 | NA | NA | 0.628 |
| 6. F | P66756 | Holliday junction ATP-dependent DNA helicase RuvB | 9.47e-05 | NA | NA | 0.6455 |
| 6. F | Q8Q084 | Replication factor C large subunit | 1.62e-04 | NA | NA | 0.3549 |
| 6. F | Q3ZWZ9 | Holliday junction ATP-dependent DNA helicase RuvB | 9.34e-05 | NA | NA | 0.634 |
| 6. F | A7N1I0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.38e-03 | NA | NA | 0.6357 |
| 6. F | B9DSU1 | Holliday junction ATP-dependent DNA helicase RuvB | 3.47e-04 | NA | NA | 0.6582 |
| 6. F | C4K7I4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.44e-05 | NA | NA | 0.6223 |
| 6. F | A8AFI1 | Holliday junction ATP-dependent DNA helicase RuvB | 9.83e-05 | NA | NA | 0.6291 |
| 6. F | A1W0X9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.60e-05 | NA | NA | 0.5035 |
| 6. F | B4R9Z2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.91e-04 | NA | NA | 0.6158 |
| 6. F | A8ZUH7 | Holliday junction ATP-dependent DNA helicase RuvB | 3.37e-04 | NA | NA | 0.6315 |
| 6. F | Q28TS9 | Holliday junction ATP-dependent DNA helicase RuvB | 7.46e-04 | NA | NA | 0.6143 |
| 6. F | A4XJS3 | Holliday junction ATP-dependent DNA helicase RuvB | 5.96e-05 | NA | NA | 0.631 |
| 6. F | C1CPD4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.01e-04 | NA | NA | 0.6701 |
| 6. F | Q65GP6 | Holliday junction DNA helicase RuvB | 1.54e-05 | NA | NA | 0.6219 |
| 6. F | Q0HUZ1 | Holliday junction ATP-dependent DNA helicase RuvB | 9.86e-05 | NA | NA | 0.6231 |
| 6. F | Q4L6Y6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.64e-04 | NA | NA | 0.6361 |
| 6. F | A8YTI2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.65e-03 | NA | NA | 0.5469 |
| 6. F | P61531 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-04 | NA | NA | 0.6377 |
| 6. F | A9L3H7 | Holliday junction ATP-dependent DNA helicase RuvB | 8.43e-05 | NA | NA | 0.5991 |
| 6. F | A5D3G1 | Holliday junction ATP-dependent DNA helicase RuvB | 3.44e-04 | NA | NA | 0.5873 |
| 6. F | Q89U80 | Holliday junction ATP-dependent DNA helicase RuvB | 2.30e-04 | NA | NA | 0.637 |
| 6. F | B9DNE4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.42e-04 | NA | NA | 0.6342 |
| 6. F | A0KPA2 | Holliday junction ATP-dependent DNA helicase RuvB | 8.79e-05 | NA | NA | 0.6387 |
| 6. F | Q8E2I7 | Chromosomal replication initiator protein DnaA | 1.16e-04 | NA | NA | 0.4081 |
| 6. F | Q8Y236 | Holliday junction ATP-dependent DNA helicase RuvB | 1.88e-03 | NA | NA | 0.5876 |
| 6. F | Q0ALX9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.82e-03 | NA | NA | 0.5188 |
| 6. F | A0L4V5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.39e-05 | NA | NA | 0.6191 |
| 6. F | A2S594 | Holliday junction ATP-dependent DNA helicase RuvB | 1.07e-03 | NA | NA | 0.6379 |
| 6. F | B0UVK4 | Holliday junction ATP-dependent DNA helicase RuvB | 9.40e-05 | NA | NA | 0.6141 |
| 6. F | Q9PKE4 | Chromosomal replication initiator protein DnaA 1 | 7.48e-04 | NA | NA | 0.3948 |
| 6. F | Q1LRB7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.33e-04 | NA | NA | 0.6457 |
| 6. F | A9WHF8 | Holliday junction ATP-dependent DNA helicase RuvB | 4.56e-04 | NA | NA | 0.6061 |
| 6. F | A6SUQ4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.60e-03 | NA | NA | 0.6387 |
| 6. F | B9LBR4 | Holliday junction ATP-dependent DNA helicase RuvB | 4.86e-04 | NA | NA | 0.6056 |
| 6. F | B5YKE9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.34e-04 | NA | NA | 0.6474 |
| 6. F | Q87Y35 | Holliday junction ATP-dependent DNA helicase RuvB | 1.23e-03 | NA | NA | 0.6111 |
| 6. F | A2RC05 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-04 | NA | NA | 0.674 |
| 6. F | P44631 | Holliday junction ATP-dependent DNA helicase RuvB | 8.47e-05 | NA | NA | 0.5741 |
| 6. F | Q3K7W0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.58e-03 | NA | NA | 0.6108 |
| 6. F | B7VMI4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.36e-03 | NA | NA | 0.6292 |
| 6. F | Q8CS91 | Holliday junction ATP-dependent DNA helicase RuvB | 1.26e-04 | NA | NA | 0.601 |
| 6. F | Q9A3G8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.61e-05 | NA | NA | 0.6183 |
| 6. F | Q1G941 | Holliday junction ATP-dependent DNA helicase RuvB | 2.15e-04 | NA | NA | 0.6571 |
| 6. F | A8MHI3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.08e-04 | NA | NA | 0.6247 |
| 6. F | A8IMA7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.63e-03 | NA | NA | 0.5712 |
| 6. F | B8GUJ4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.13e-04 | NA | NA | 0.5817 |
| 6. F | Q2S3F9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.61e-04 | NA | NA | 0.6299 |
| 6. F | B2FRN4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.08e-04 | NA | NA | 0.5983 |
| 6. F | B1I8Y6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.05e-04 | NA | NA | 0.6714 |
| 6. F | Q20X11 | Holliday junction ATP-dependent DNA helicase RuvB | 2.21e-04 | NA | NA | 0.6415 |
| 6. F | P96115 | Holliday junction ATP-dependent DNA helicase RuvB | 5.46e-05 | NA | NA | 0.666 |
| 6. F | B6J507 | Holliday junction ATP-dependent DNA helicase RuvB | 5.64e-04 | NA | NA | 0.6432 |
| 6. F | Q04UI9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.48e-04 | NA | NA | 0.6062 |
| 6. F | B2SGL0 | Holliday junction ATP-dependent DNA helicase RuvB | 4.99e-05 | NA | NA | 0.6023 |
| 6. F | A2SCK0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.92e-04 | NA | NA | 0.63 |
| 6. F | Q1JP25 | Holliday junction ATP-dependent DNA helicase RuvB | 2.64e-04 | NA | NA | 0.5918 |
| 6. F | Q67Q97 | Holliday junction ATP-dependent DNA helicase RuvB | 3.25e-04 | NA | NA | 0.5965 |
| 6. F | Q03IE9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.59e-04 | NA | NA | 0.6752 |
| 6. F | Q2FQR4 | Replication factor C large subunit | 5.24e-05 | NA | NA | 0.3157 |
| 6. F | Q3K3X8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.81e-04 | NA | NA | 0.6182 |
| 6. F | A1ARF8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.95e-04 | NA | NA | 0.5751 |
| 6. F | B7K9M6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.89e-04 | NA | NA | 0.6169 |
| 6. F | B3WC56 | Holliday junction ATP-dependent DNA helicase RuvB | 2.32e-04 | NA | NA | 0.6611 |
| 6. F | A7NNH1 | Holliday junction ATP-dependent DNA helicase RuvB | 3.27e-04 | NA | NA | 0.6271 |
| 6. F | B1JD70 | Holliday junction ATP-dependent DNA helicase RuvB | 1.11e-04 | NA | NA | 0.6418 |
| 6. F | Q8YIV5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.60e-03 | NA | NA | 0.6345 |
| 6. F | Q2A3C8 | Holliday junction ATP-dependent DNA helicase RuvB | 5.38e-05 | NA | NA | 0.5992 |
| 6. F | Q66AT9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.00e-04 | NA | NA | 0.6296 |
| 6. F | Q124Q6 | Holliday junction ATP-dependent DNA helicase RuvB | 8.57e-04 | NA | NA | 0.6365 |
| 6. F | A4VNA3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-04 | NA | NA | 0.6152 |
| 6. F | Q21HN6 | Holliday junction ATP-dependent DNA helicase RuvB | 8.55e-05 | NA | NA | 0.6446 |
| 6. F | B3EH23 | Holliday junction ATP-dependent DNA helicase RuvB | 1.13e-03 | NA | NA | 0.5322 |
| 6. F | A1U1B9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.45e-05 | NA | NA | 0.6092 |
| 6. F | A4YMC8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.45e-04 | NA | NA | 0.6403 |
| 6. F | Q3IIJ2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.87e-05 | NA | NA | 0.6059 |
| 6. F | A4GGE1 | Protein Ycf2 | 2.32e-02 | NA | NA | 0.5505 |
| 6. F | Q1QHP7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.16e-04 | NA | NA | 0.5305 |
| 6. F | B2AH72 | Holliday junction ATP-dependent DNA helicase RuvB | 2.01e-04 | NA | NA | 0.5695 |
| 6. F | A4SJ26 | Holliday junction ATP-dependent DNA helicase RuvB | 8.55e-05 | NA | NA | 0.6043 |
| 6. F | B6JKW4 | Holliday junction ATP-dependent DNA helicase RuvB | 5.80e-05 | NA | NA | 0.605 |
| 6. F | A1TUY9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.49e-04 | NA | NA | 0.5881 |
| 6. F | Q5LXQ9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.66e-04 | NA | NA | 0.6743 |
| 6. F | Q8EEF3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.99e-05 | NA | NA | 0.6279 |
| 6. F | A6WNQ2 | Holliday junction ATP-dependent DNA helicase RuvB | 8.85e-05 | NA | NA | 0.6271 |
| 6. F | Q2GDJ0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.38e-04 | NA | NA | 0.609 |
| 6. F | A5V881 | Holliday junction ATP-dependent DNA helicase RuvB | 2.53e-04 | NA | NA | 0.5966 |
| 6. F | Q322E6 | Holliday junction ATP-dependent DNA helicase RuvB | 8.78e-05 | NA | NA | 0.5331 |
| 6. F | Q1I6E9 | Holliday junction ATP-dependent DNA helicase RuvB | 9.38e-05 | NA | NA | 0.6281 |
| 6. F | Q92BI2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.03e-03 | NA | NA | 0.6162 |
| 6. F | Q0BI83 | Holliday junction ATP-dependent DNA helicase RuvB | 3.16e-03 | NA | NA | 0.6343 |
| 6. F | A8EVP9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.13e-03 | NA | NA | 0.5315 |
| 6. F | Q2JP68 | Holliday junction ATP-dependent DNA helicase RuvB | 2.73e-04 | NA | NA | 0.5191 |
| 6. F | A7GZP9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.66e-05 | NA | NA | 0.6264 |
| 6. F | Q0A4X0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.51e-04 | NA | NA | 0.6299 |
| 6. F | Q40460 | Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic | 2.83e-04 | NA | NA | 0.5794 |
| 6. F | Q9X719 | Holliday junction ATP-dependent DNA helicase RuvB | 1.36e-05 | NA | NA | 0.6148 |
| 6. F | B9KHQ5 | Holliday junction ATP-dependent DNA helicase RuvB | 8.76e-06 | NA | NA | 0.499 |
| 6. F | P61537 | Holliday junction ATP-dependent DNA helicase RuvB | 3.64e-04 | NA | NA | 0.5425 |
| 6. F | Q4JAB1 | Replication factor C large subunit | 3.13e-04 | NA | NA | 0.3978 |
| 6. F | A5ERJ9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.25e-04 | NA | NA | 0.6407 |
| 6. F | B1KGX9 | Holliday junction ATP-dependent DNA helicase RuvB | 7.95e-04 | NA | NA | 0.6258 |
| 6. F | B9MRB3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.98e-05 | NA | NA | 0.6307 |
| 6. F | A1WZ65 | Holliday junction ATP-dependent DNA helicase RuvB | 1.01e-04 | NA | NA | 0.5923 |
| 6. F | B5E6T3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.04e-04 | NA | NA | 0.6701 |
| 6. F | A4Y6S9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.80e-05 | NA | NA | 0.6495 |
| 6. F | A1WQ68 | Holliday junction ATP-dependent DNA helicase RuvB | 1.00e-03 | NA | NA | 0.6274 |
| 6. F | Q93LP2 | Holliday junction ATP-dependent DNA helicase RuvB | 3.17e-03 | NA | NA | 0.6371 |
| 6. F | A4SG11 | Holliday junction ATP-dependent DNA helicase RuvB | 2.51e-04 | NA | NA | 0.6208 |
| 6. F | Q8EPQ6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.20e-05 | NA | NA | 0.6282 |
| 6. F | A5I6F1 | Holliday junction ATP-dependent DNA helicase RuvB | 3.69e-04 | NA | NA | 0.6232 |
| 6. F | A5VZU7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-04 | NA | NA | 0.629 |
| 6. F | Q5SL87 | Holliday junction ATP-dependent DNA helicase RuvB | 2.05e-04 | NA | NA | 0.5578 |
| 6. F | B2UFL1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.83e-03 | NA | NA | 0.561 |
| 6. F | Q5X4Y6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.16e-04 | NA | NA | 0.6313 |
| 6. F | A2C638 | Holliday junction ATP-dependent DNA helicase RuvB | 2.27e-03 | NA | NA | 0.5435 |
| 6. F | B0S907 | Chromosomal replication initiator protein DnaA | 2.13e-04 | NA | NA | 0.4106 |
| 6. F | A6QHI3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.50e-04 | NA | NA | 0.6353 |
| 6. F | C4L523 | Holliday junction ATP-dependent DNA helicase RuvB | 2.75e-04 | NA | NA | 0.6123 |
| 6. F | Q17WP7 | Holliday junction ATP-dependent DNA helicase RuvB | 6.24e-05 | NA | NA | 0.6134 |
| 6. F | A0RJ26 | Holliday junction ATP-dependent DNA helicase RuvB | 2.81e-04 | NA | NA | 0.6218 |
| 6. F | Q820F3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.86e-04 | NA | NA | 0.5769 |
| 6. F | Q04GA1 | Holliday junction ATP-dependent DNA helicase RuvB | 2.62e-04 | NA | NA | 0.6407 |
| 6. F | Q40565 | Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic | 2.34e-04 | NA | NA | 0.5594 |
| 6. F | Q6D4A2 | Holliday junction ATP-dependent DNA helicase RuvB | 9.04e-05 | NA | NA | 0.6269 |
| 6. F | C0MC84 | Holliday junction ATP-dependent DNA helicase RuvB | 2.74e-04 | NA | NA | 0.5411 |
| 6. F | P23489 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 8.90e-05 | NA | NA | 0.5615 |
| 6. F | A3CK22 | Holliday junction ATP-dependent DNA helicase RuvB | 3.09e-04 | NA | NA | 0.6691 |
| 6. F | A5UVZ9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.46e-04 | NA | NA | 0.6048 |
| 6. F | A3MP72 | Holliday junction ATP-dependent DNA helicase RuvB | 1.53e-03 | NA | NA | 0.5981 |
| 6. F | Q1GWB6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.41e-04 | NA | NA | 0.5349 |
| 6. F | Q4A6N6 | Holliday junction ATP-dependent DNA helicase RuvB | 6.53e-05 | NA | NA | 0.5973 |
| 6. F | Q5WWK4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.12e-04 | NA | NA | 0.6408 |
| 6. F | Q49Y79 | Holliday junction ATP-dependent DNA helicase RuvB | 4.17e-05 | NA | NA | 0.6338 |
| 6. F | A0JXB1 | Holliday junction ATP-dependent DNA helicase RuvB | 2.16e-05 | NA | NA | 0.6303 |
| 6. F | A1V064 | Holliday junction ATP-dependent DNA helicase RuvB | 3.43e-03 | NA | NA | 0.6376 |
| 6. F | Q2SZ55 | Holliday junction ATP-dependent DNA helicase RuvB | 1.11e-03 | NA | NA | 0.5724 |
| 6. F | B3QHS4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.22e-04 | NA | NA | 0.6415 |
| 6. F | A2BL93 | Replication factor C large subunit | 1.64e-04 | NA | NA | 0.3745 |
| 6. F | Q1J1C7 | Holliday junction ATP-dependent DNA helicase RuvB | 4.59e-05 | NA | NA | 0.6342 |
| 6. F | B2ISI4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.06e-04 | NA | NA | 0.6722 |
| 6. F | A5EXH6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.19e-05 | NA | NA | 0.6346 |
| 6. F | Q1JE69 | Holliday junction ATP-dependent DNA helicase RuvB | 2.90e-04 | NA | NA | 0.6576 |
| 6. F | B5XJ28 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-04 | NA | NA | 0.6685 |
| 6. F | A4X5X3 | Holliday junction ATP-dependent DNA helicase RuvB | 9.10e-05 | NA | NA | 0.5215 |
| 6. F | Q40281 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 1.85e-04 | NA | NA | 0.5766 |
| 6. F | Q662Z0 | Holliday junction ATP-dependent DNA helicase RuvB | 8.89e-04 | NA | NA | 0.5676 |
| 6. F | A1K313 | Holliday junction ATP-dependent DNA helicase RuvB | 2.97e-03 | NA | NA | 0.5183 |
| 6. F | A0LGY6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.89e-04 | NA | NA | 0.6442 |
| 6. F | Q3K425 | Chromosomal replication initiator protein DnaA | 1.85e-04 | NA | NA | 0.4116 |
| 6. F | Q3Z8V1 | Holliday junction ATP-dependent DNA helicase RuvB | 8.52e-05 | NA | NA | 0.6398 |
| 6. F | Q7VIU8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.00e-04 | NA | NA | 0.5431 |
| 6. F | Q0T3U6 | Holliday junction ATP-dependent DNA helicase RuvB | 8.27e-05 | NA | NA | 0.6417 |
| 6. F | B5YR05 | Holliday junction ATP-dependent DNA helicase RuvB | 8.30e-05 | NA | NA | 0.6354 |
| 6. F | A5FRK7 | Holliday junction ATP-dependent DNA helicase RuvB | 9.72e-05 | NA | NA | 0.634 |
| 6. F | Q5FLX2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.67e-03 | NA | NA | 0.5837 |
| 6. F | Q8F7Y2 | Holliday junction ATP-dependent DNA helicase RuvB | 7.89e-04 | NA | NA | 0.5702 |
| 6. F | A1VC44 | Holliday junction ATP-dependent DNA helicase RuvB | 2.96e-04 | NA | NA | 0.637 |
| 6. F | C3L6U9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.72e-04 | NA | NA | 0.622 |
| 6. F | C1CB34 | Holliday junction ATP-dependent DNA helicase RuvB | 2.60e-04 | NA | NA | 0.6701 |
| 6. F | Q3Z2L8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.24e-04 | NA | NA | 0.635 |
| 6. F | Q1JJ71 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-04 | NA | NA | 0.6744 |
| 6. F | B7UXW5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.89e-03 | NA | NA | 0.6246 |
| 6. F | A6LG11 | Holliday junction ATP-dependent DNA helicase RuvB | 1.00e-04 | NA | NA | 0.6059 |
| 6. F | Q02441 | Denitrification regulatory protein NirQ | 1.26e-02 | NA | NA | 0.4567 |
| 6. F | C0M7R2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.93e-04 | NA | NA | 0.528 |
| 6. F | Q2KVY2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.63e-03 | NA | NA | 0.5113 |
| 6. F | Q5QYU5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.68e-03 | NA | NA | 0.569 |
| 6. F | A5F760 | Holliday junction ATP-dependent DNA helicase RuvB | 2.22e-03 | NA | NA | 0.6356 |
| 6. F | Q4A9R6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.71e-05 | NA | NA | 0.5911 |
| 6. F | A5FJE5 | Holliday junction ATP-dependent DNA helicase RuvB | 7.47e-04 | NA | NA | 0.65 |
| 6. F | Q3JES3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.06e-04 | NA | NA | 0.5987 |
| 6. F | B4EES7 | Holliday junction ATP-dependent DNA helicase RuvB | 3.04e-03 | NA | NA | 0.6373 |
| 6. F | P57892 | Holliday junction ATP-dependent DNA helicase RuvB | 9.63e-05 | NA | NA | 0.6192 |
| 6. F | Q0W3P4 | Replication factor C large subunit | 1.83e-04 | NA | NA | 0.3384 |
| 6. F | P61528 | Holliday junction ATP-dependent DNA helicase RuvB | 2.90e-04 | NA | NA | 0.6254 |
| 6. F | A2BZ00 | Holliday junction ATP-dependent DNA helicase RuvB | 1.51e-04 | NA | NA | 0.6008 |
| 6. F | B4TYR7 | Holliday junction ATP-dependent DNA helicase RuvB | 9.17e-05 | NA | NA | 0.6292 |
| 6. F | Q97SR6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.48e-04 | NA | NA | 0.6242 |
| 6. F | B0RPY7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.12e-04 | NA | NA | 0.6356 |
| 6. F | Q06716 | ATP-dependent Clp protease ATP-binding subunit ClpL | 3.27e-04 | NA | NA | 0.3499 |
| 6. F | Q07H98 | Holliday junction ATP-dependent DNA helicase RuvB | 2.22e-04 | NA | NA | 0.6418 |
| 6. F | C6E1S8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.95e-04 | NA | NA | 0.5851 |
| 6. F | B3CRA8 | Holliday junction ATP-dependent DNA helicase RuvB | 9.22e-04 | NA | NA | 0.6415 |
| 6. F | Q1CUB7 | Holliday junction ATP-dependent DNA helicase RuvB | 6.41e-05 | NA | NA | 0.6176 |
| 6. F | A5GQ68 | Holliday junction ATP-dependent DNA helicase RuvB | 1.05e-03 | NA | NA | 0.5769 |
| 6. F | Q4QNM6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.01e-04 | NA | NA | 0.5817 |
| 6. F | A8AUH0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.58e-04 | NA | NA | 0.6059 |
| 6. F | Q9V2G3 | Replication factor C large subunit | 1.49e-04 | NA | NA | 0.3435 |
| 6. F | A0LUK5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.33e-03 | NA | NA | 0.6555 |
| 6. F | Q1IWD8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.21e-03 | NA | NA | 0.5109 |
| 6. F | Q3ISA5 | Replication factor C large subunit | 1.98e-04 | NA | NA | 0.353 |
| 6. F | B9E5Q8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.91e-04 | NA | NA | 0.627 |
| 6. F | Q3V4Z0 | Protein Ycf2 | 2.50e-02 | NA | NA | 0.55 |
| 6. F | B8G5S6 | Holliday junction ATP-dependent DNA helicase RuvB | 4.17e-04 | NA | NA | 0.6065 |
| 6. F | P0DF50 | Holliday junction ATP-dependent DNA helicase RuvB | 2.64e-04 | NA | NA | 0.6283 |
| 6. F | Q0HIZ1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.08e-04 | NA | NA | 0.6284 |
| 6. F | P58555 | Ribulose bisphosphate carboxylase/oxygenase activase | 1.23e-04 | NA | NA | 0.469 |
| 6. F | Q1WT18 | Holliday junction ATP-dependent DNA helicase RuvB | 1.95e-04 | NA | NA | 0.6289 |
| 6. F | C6DFF2 | Holliday junction ATP-dependent DNA helicase RuvB | 9.36e-05 | NA | NA | 0.6246 |
| 6. F | B2SYK2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.48e-03 | NA | NA | 0.6376 |
| 6. F | B7IIT2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.78e-04 | NA | NA | 0.5779 |
| 6. F | Q048Y7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.37e-03 | NA | NA | 0.6525 |
| 6. F | Q7U9W7 | Holliday junction ATP-dependent DNA helicase RuvB | 9.51e-05 | NA | NA | 0.5908 |
| 6. F | A5CS06 | Holliday junction ATP-dependent DNA helicase RuvB | 2.04e-03 | NA | NA | 0.5744 |
| 6. F | Q04MI9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.47e-04 | NA | NA | 0.671 |
| 6. F | Q01587 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 2.37e-04 | NA | NA | 0.654 |
| 6. F | Q18GQ9 | Replication factor C large subunit | 3.13e-04 | NA | NA | 0.3308 |
| 6. F | Q3SP14 | Holliday junction ATP-dependent DNA helicase RuvB | 2.45e-04 | NA | NA | 0.5331 |
| 6. F | B9LZC4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.43e-03 | NA | NA | 0.5309 |
| 6. F | Q6AFB4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.98e-03 | NA | NA | 0.6526 |
| 6. F | Q9KR02 | Holliday junction ATP-dependent DNA helicase RuvB | 2.34e-03 | NA | NA | 0.6463 |
| 6. F | C0R250 | Holliday junction ATP-dependent DNA helicase RuvB | 9.10e-05 | NA | NA | 0.5212 |
| 6. F | B2UPI9 | Holliday junction ATP-dependent DNA helicase RuvB | 7.93e-05 | NA | NA | 0.6363 |
| 6. F | B4RLV8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.24e-03 | NA | NA | 0.6476 |
| 6. F | Q2N814 | Holliday junction ATP-dependent DNA helicase RuvB | 3.01e-04 | NA | NA | 0.6448 |
| 6. F | A1SSV6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.69e-04 | NA | NA | 0.6355 |
| 6. F | Q39JJ1 | Holliday junction ATP-dependent DNA helicase RuvB | 6.71e-04 | NA | NA | 0.6373 |
| 6. F | Q02VS7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.53e-04 | NA | NA | 0.6333 |
| 6. F | B0U2E3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.61e-04 | NA | NA | 0.6084 |
| 6. F | Q1C814 | Holliday junction ATP-dependent DNA helicase RuvB | 2.06e-05 | NA | NA | 0.64 |
| 6. F | B0K956 | Holliday junction ATP-dependent DNA helicase RuvB | 8.62e-05 | NA | NA | 0.6399 |
| 6. F | B9IYZ4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.85e-04 | NA | NA | 0.6265 |
| 6. F | A7X357 | Holliday junction ATP-dependent DNA helicase RuvB | 1.48e-04 | NA | NA | 0.6352 |
| 6. F | Q183N8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.63e-03 | NA | NA | 0.6262 |
| 6. F | Q13UC0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.41e-03 | NA | NA | 0.6346 |
| 6. F | A9LZC3 | Holliday junction ATP-dependent DNA helicase RuvB | 4.80e-04 | NA | NA | 0.5719 |
| 6. F | Q8VVE4 | Putative chaperone BssE | 3.10e-03 | NA | NA | 0.526 |
| 6. F | A6LN82 | Holliday junction ATP-dependent DNA helicase RuvB | 3.94e-05 | NA | NA | 0.655 |
| 6. F | Q9PC79 | Holliday junction ATP-dependent DNA helicase RuvB | 3.64e-04 | NA | NA | 0.6085 |
| 6. F | B7M2F1 | Holliday junction ATP-dependent DNA helicase RuvB | 9.41e-05 | NA | NA | 0.629 |
| 6. F | Q8ZEU5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.08e-04 | NA | NA | 0.634 |
| 6. F | A6KZW5 | Holliday junction ATP-dependent DNA helicase RuvB | 3.35e-04 | NA | NA | 0.6473 |
| 6. F | Q2GLG1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.24e-04 | NA | NA | 0.5276 |
| 6. F | Q5E699 | Holliday junction ATP-dependent DNA helicase RuvB | 1.30e-03 | NA | NA | 0.6172 |
| 6. F | A3D481 | Holliday junction ATP-dependent DNA helicase RuvB | 1.92e-05 | NA | NA | 0.5818 |
| 6. F | Q04YY5 | Holliday junction ATP-dependent DNA helicase RuvB | 7.39e-05 | NA | NA | 0.6383 |
| 6. F | Q0RNU6 | Holliday junction ATP-dependent DNA helicase RuvB | 4.78e-04 | NA | NA | 0.5808 |
| 6. F | A5ITG5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.02e-03 | NA | NA | 0.6368 |
| 6. F | A3MZ06 | Holliday junction ATP-dependent DNA helicase RuvB | 2.30e-05 | NA | NA | 0.6135 |
| 6. F | B3PYZ5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.90e-04 | NA | NA | 0.6444 |
| 6. F | Q5PBM1 | Holliday junction ATP-dependent DNA helicase RuvB | 8.09e-06 | NA | NA | 0.5469 |
| 6. F | Q30YX7 | Holliday junction ATP-dependent DNA helicase RuvB | 3.24e-04 | NA | NA | 0.6207 |
| 6. F | A0AIY1 | Holliday junction ATP-dependent DNA helicase RuvB | 2.10e-03 | NA | NA | 0.6277 |
| 6. F | Q02AG6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.56e-04 | NA | NA | 0.6185 |
| 6. F | A7H1X6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.60e-05 | NA | NA | 0.5035 |
| 6. F | Q2GBA2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.59e-04 | NA | NA | 0.6234 |
| 6. F | Q8P302 | Holliday junction ATP-dependent DNA helicase RuvB | 2.88e-04 | NA | NA | 0.6265 |
| 6. F | A8F5R0 | Holliday junction ATP-dependent DNA helicase RuvB | 4.87e-05 | NA | NA | 0.5941 |
| 6. F | Q48VY1 | Holliday junction ATP-dependent DNA helicase RuvB | 2.96e-04 | NA | NA | 0.6212 |
| 6. F | Q9RSZ6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.44e-03 | NA | NA | 0.4782 |
| 6. F | Q6LT48 | Holliday junction ATP-dependent DNA helicase RuvB | 1.06e-03 | NA | NA | 0.5875 |
| 6. F | A7I1C5 | Holliday junction ATP-dependent DNA helicase RuvB | 5.50e-05 | NA | NA | 0.6022 |
| 6. F | A7HUZ8 | Holliday junction ATP-dependent DNA helicase RuvB | 4.09e-04 | NA | NA | 0.5974 |
| 6. F | A8FUX0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.30e-03 | NA | NA | 0.5767 |
| 6. F | Q56214 | Holliday junction ATP-dependent DNA helicase RuvB | 2.04e-04 | NA | NA | 0.5588 |
| 6. F | B1JVV3 | Holliday junction ATP-dependent DNA helicase RuvB | 8.66e-04 | NA | NA | 0.6372 |
| 6. F | Q130V3 | Holliday junction ATP-dependent DNA helicase RuvB | 2.20e-04 | NA | NA | 0.6361 |
| 6. F | A3CTR4 | Replication factor C large subunit | 1.87e-04 | NA | NA | 0.3773 |
| 6. F | Q5NR72 | Holliday junction ATP-dependent DNA helicase RuvB | 2.21e-05 | NA | NA | 0.6251 |
| 6. F | Q8RE97 | Holliday junction ATP-dependent DNA helicase RuvB | 3.02e-04 | NA | NA | 0.6261 |
| 6. F | Q6G8S8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.48e-04 | NA | NA | 0.637 |
| 6. F | Q87QU7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.48e-03 | NA | NA | 0.6283 |
| 6. F | Q7VKV5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.23e-05 | NA | NA | 0.6321 |
| 6. F | B1Y8E2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.24e-04 | NA | NA | 0.5867 |
| 6. F | A6WY76 | Holliday junction ATP-dependent DNA helicase RuvB | 7.68e-04 | NA | NA | 0.634 |
| 6. F | B4U5F8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-04 | NA | NA | 0.6196 |
| 6. F | A0B6D7 | Replication factor C large subunit | 1.41e-05 | NA | NA | 0.3656 |
| 6. F | Q609L0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.15e-04 | NA | NA | 0.5252 |
| 6. F | Q88V03 | Holliday junction ATP-dependent DNA helicase RuvB | 1.02e-03 | NA | NA | 0.6688 |
| 6. F | Q4UXL7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-04 | NA | NA | 0.6375 |
| 6. F | A9AH73 | Holliday junction ATP-dependent DNA helicase RuvB | 3.75e-03 | NA | NA | 0.5727 |
| 6. F | B0U0B6 | Holliday junction ATP-dependent DNA helicase RuvB | 4.59e-05 | NA | NA | 0.6028 |
| 6. F | A7I4H6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.17e-04 | NA | NA | 0.6306 |
| 6. F | C5D5E8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.74e-04 | NA | NA | 0.6204 |
| 6. F | Q2JTM7 | Holliday junction ATP-dependent DNA helicase RuvB 1 | 6.68e-04 | NA | NA | 0.5698 |
| 6. F | B1WP72 | Holliday junction ATP-dependent DNA helicase RuvB | 6.43e-04 | NA | NA | 0.6216 |
| 6. F | C5B9T2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.19e-05 | NA | NA | 0.6309 |
| 6. F | A5UAH8 | Holliday junction ATP-dependent DNA helicase RuvB | 8.92e-05 | NA | NA | 0.6091 |
| 6. F | Q2IS53 | Holliday junction ATP-dependent DNA helicase RuvB | 2.43e-04 | NA | NA | 0.6301 |
| 6. F | A7ZEM1 | Holliday junction ATP-dependent DNA helicase RuvB | 7.80e-05 | NA | NA | 0.5942 |
| 6. F | Q0I1M3 | Holliday junction ATP-dependent DNA helicase RuvB | 9.25e-05 | NA | NA | 0.6142 |
| 6. F | Q8G6B7 | Holliday junction ATP-dependent DNA helicase RuvB | 6.70e-05 | NA | NA | 0.5377 |
| 6. F | Q8PHV2 | Holliday junction ATP-dependent DNA helicase RuvB | 4.38e-04 | NA | NA | 0.6348 |
| 6. F | B8DHL6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.03e-03 | NA | NA | 0.6265 |
| 6. F | Q1MC52 | Holliday junction ATP-dependent DNA helicase RuvB | 1.58e-04 | NA | NA | 0.6226 |
| 6. F | A4WBL8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.63e-04 | NA | NA | 0.6203 |
| 6. F | Q5HFC2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.49e-04 | NA | NA | 0.6367 |
| 6. F | A9BUG8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.28e-04 | NA | NA | 0.5229 |
| 6. F | B8FQV5 | Holliday junction ATP-dependent DNA helicase RuvB | 6.63e-05 | NA | NA | 0.5917 |
| 6. F | B1YTD9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.62e-03 | NA | NA | 0.5727 |
| 6. F | B4SDZ7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.34e-03 | NA | NA | 0.6494 |
| 6. F | Q7M879 | Holliday junction ATP-dependent DNA helicase RuvB | 4.73e-05 | NA | NA | 0.5998 |
| 6. F | B4ST32 | Holliday junction ATP-dependent DNA helicase RuvB | 1.01e-04 | NA | NA | 0.5995 |
| 6. F | Q7MJ78 | Holliday junction ATP-dependent DNA helicase RuvB | 2.50e-03 | NA | NA | 0.646 |
| 6. F | A1WC30 | Holliday junction ATP-dependent DNA helicase RuvB | 1.20e-03 | NA | NA | 0.632 |
| 6. F | A1JRJ5 | Holliday junction ATP-dependent DNA helicase RuvB | 1.98e-05 | NA | NA | 0.6438 |
| 6. F | B0SK31 | Chromosomal replication initiator protein DnaA | 3.74e-04 | NA | NA | 0.405 |
| 6. F | A1VJK5 | Holliday junction ATP-dependent DNA helicase RuvB | 6.27e-04 | NA | NA | 0.637 |
| 6. F | O98997 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 1.17e-04 | NA | NA | 0.6813 |
| 6. F | B7L7R3 | Holliday junction ATP-dependent DNA helicase RuvB | 8.82e-05 | NA | NA | 0.6315 |
| 6. F | Q5HAK4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.81e-05 | NA | NA | 0.6226 |
| 6. F | C0ZAN4 | Holliday junction ATP-dependent DNA helicase RuvB | 2.86e-04 | NA | NA | 0.6221 |
| 6. F | Q2RHT7 | Holliday junction ATP-dependent DNA helicase RuvB | 3.18e-04 | NA | NA | 0.5354 |
| 6. F | Q2JTJ1 | Holliday junction ATP-dependent DNA helicase RuvB 2 | 4.30e-05 | NA | NA | 0.5259 |
| 6. F | O31850 | Uncharacterized protein YojN | 2.05e-02 | NA | NA | 0.4136 |
| 6. F | C1CIE0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.97e-04 | NA | NA | 0.6717 |
| 6. F | Q92M92 | Holliday junction ATP-dependent DNA helicase RuvB | 1.35e-04 | NA | NA | 0.6244 |
| 6. F | A5N206 | Holliday junction ATP-dependent DNA helicase RuvB | 4.10e-04 | NA | NA | 0.6267 |
| 6. F | A9KP49 | Holliday junction ATP-dependent DNA helicase RuvB | 2.30e-05 | NA | NA | 0.6256 |
| 6. F | A5IC73 | Holliday junction ATP-dependent DNA helicase RuvB | 1.20e-04 | NA | NA | 0.6404 |
| 6. F | Q1MP36 | Holliday junction ATP-dependent DNA helicase RuvB | 3.67e-04 | NA | NA | 0.6743 |
| 6. F | C1D9W9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.61e-05 | NA | NA | 0.5714 |
| 6. F | Q71ZD8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.85e-03 | NA | NA | 0.6248 |
| 6. F | B2VJ95 | Holliday junction ATP-dependent DNA helicase RuvB | 2.04e-05 | NA | NA | 0.5828 |
| 6. F | Q2K4J8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.81e-04 | NA | NA | 0.6301 |
| 6. F | Q7NQC5 | Holliday junction ATP-dependent DNA helicase RuvB | 5.85e-05 | NA | NA | 0.5613 |
| 6. F | Q5FG39 | Holliday junction ATP-dependent DNA helicase RuvB | 1.83e-05 | NA | NA | 0.6142 |
| 6. F | A4TJK0 | Holliday junction ATP-dependent DNA helicase RuvB | 9.78e-05 | NA | NA | 0.6291 |
| 6. F | B4UFY1 | Holliday junction ATP-dependent DNA helicase RuvB | 8.71e-05 | NA | NA | 0.6258 |
| 6. F | Q7MWU9 | Holliday junction DNA helicase RuvB | 2.38e-03 | NA | NA | 0.6122 |
| 6. F | Q1J924 | Holliday junction ATP-dependent DNA helicase RuvB | 2.92e-04 | NA | NA | 0.6745 |
| 6. F | Q38YQ9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.16e-04 | NA | NA | 0.669 |
| 6. F | Q483C4 | Holliday junction ATP-dependent DNA helicase RuvB | 9.37e-05 | NA | NA | 0.6271 |
| 6. F | Q4A7W4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.73e-05 | NA | NA | 0.5921 |
| 6. F | O25699 | Holliday junction ATP-dependent DNA helicase RuvB | 8.31e-04 | NA | NA | 0.6245 |
| 6. F | Q839T5 | Holliday junction ATP-dependent DNA helicase RuvB | 9.09e-04 | NA | NA | 0.6483 |
| 6. F | Q2SCL3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.04e-04 | NA | NA | 0.6261 |
| 6. F | Q98PR1 | Holliday junction ATP-dependent DNA helicase RuvB | 4.91e-05 | NA | NA | 0.6309 |
| 6. F | A9MUX4 | Holliday junction ATP-dependent DNA helicase RuvB | 9.37e-05 | NA | NA | 0.6337 |
| 6. F | Q0KEC4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.44e-04 | NA | NA | 0.5701 |
| 6. F | P29933 | Aerobic cobaltochelatase subunit CobS | 1.31e-03 | NA | NA | 0.5271 |
| 6. F | A3NDF6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.66e-03 | NA | NA | 0.572 |
| 6. F | B7NBL1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.21e-04 | NA | NA | 0.6346 |
| 6. F | Q817W4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.93e-04 | NA | NA | 0.6256 |
| 6. F | Q62HA9 | Holliday junction ATP-dependent DNA helicase RuvB | 3.35e-03 | NA | NA | 0.6189 |
| 6. F | B5RLZ3 | Chromosomal replication initiator protein DnaA | 1.90e-04 | NA | NA | 0.4478 |
| 6. F | A6URV8 | Replication factor C large subunit | 3.63e-04 | NA | NA | 0.3485 |
| 6. F | B8H9D6 | Holliday junction ATP-dependent DNA helicase RuvB | 7.36e-05 | NA | NA | 0.5863 |
| 6. F | Q9UWR2 | Replication factor C large subunit | 9.75e-05 | NA | NA | 0.3339 |
| 6. F | Q40073 | Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic | 3.24e-04 | NA | NA | 0.5536 |
| 6. F | C0REW5 | Holliday junction ATP-dependent DNA helicase RuvB | 4.15e-05 | NA | NA | 0.6386 |
| 6. F | Q0TGX2 | Holliday junction ATP-dependent DNA helicase RuvB | 8.26e-05 | NA | NA | 0.6459 |
| 6. F | P66758 | Holliday junction ATP-dependent DNA helicase RuvB | 1.50e-04 | NA | NA | 0.601 |
| 6. F | B9JRX1 | Holliday junction ATP-dependent DNA helicase RuvB | 4.91e-04 | NA | NA | 0.6279 |
| 6. F | A4IXW0 | Holliday junction ATP-dependent DNA helicase RuvB | 7.80e-04 | NA | NA | 0.5986 |
| 6. F | Q11DH7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.64e-04 | NA | NA | 0.6315 |
| 6. F | B6IYU2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.95e-04 | NA | NA | 0.6038 |
| 6. F | Q3BQF5 | Holliday junction ATP-dependent DNA helicase RuvB | 4.19e-04 | NA | NA | 0.639 |
| 6. F | A0RN84 | Holliday junction ATP-dependent DNA helicase RuvB | 1.15e-04 | NA | NA | 0.608 |
| 6. F | Q87D00 | Holliday junction ATP-dependent DNA helicase RuvB | 3.48e-04 | NA | NA | 0.6205 |
| 6. F | A4XRS1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.18e-04 | NA | NA | 0.6295 |
| 6. F | A7FIC5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.18e-05 | NA | NA | 0.6346 |
| 6. F | A4VSD3 | Holliday junction ATP-dependent DNA helicase RuvB | 2.49e-04 | NA | NA | 0.6569 |
| 6. F | B9KDF4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.65e-05 | NA | NA | 0.5926 |
| 6. F | B6EGJ4 | Holliday junction ATP-dependent DNA helicase RuvB | 8.66e-04 | NA | NA | 0.6446 |
| 6. F | Q49425 | Holliday junction ATP-dependent DNA helicase RuvB | 2.49e-05 | NA | NA | 0.606 |
| 6. F | A9LYE4 | Protein Ycf2 | 2.82e-02 | NA | NA | 0.3993 |
| 6. F | Q88NJ0 | Holliday junction ATP-dependent DNA helicase RuvB | 1.04e-04 | NA | NA | 0.6288 |
| 6. F | B1IMF3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.63e-04 | NA | NA | 0.618 |
| 6. F | Q0SN72 | Chromosomal replication initiator protein DnaA | 3.19e-04 | NA | NA | 0.4108 |
| 6. F | A6TQM5 | Holliday junction ATP-dependent DNA helicase RuvB | 3.71e-04 | NA | NA | 0.6382 |
| 6. F | Q5XEE4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.02e-04 | NA | NA | 0.6326 |
| 6. F | Q32HA1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.23e-04 | NA | NA | 0.6316 |
| 6. F | Q081N9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.14e-05 | NA | NA | 0.6325 |
| 6. F | B7MBR9 | Holliday junction ATP-dependent DNA helicase RuvB | 9.19e-05 | NA | NA | 0.6344 |
| 6. F | A1QZM2 | Chromosomal replication initiator protein DnaA | 7.70e-04 | NA | NA | 0.4563 |
| 6. F | Q8A2M0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.46e-05 | NA | NA | 0.6428 |
| 6. F | Q600N3 | Holliday junction ATP-dependent DNA helicase RuvB | 3.78e-05 | NA | NA | 0.6103 |
| 6. F | A4FBA8 | Holliday junction ATP-dependent DNA helicase RuvB | 8.01e-04 | NA | NA | 0.6212 |
| 6. F | Q1IHV6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.61e-03 | NA | NA | 0.4775 |
| 6. F | A6Q1X7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.44e-05 | NA | NA | 0.6182 |
| 6. F | Q1B9Q9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.26e-04 | NA | NA | 0.5718 |
| 6. F | P66755 | Holliday junction ATP-dependent DNA helicase RuvB | 9.42e-05 | NA | NA | 0.6291 |
| 6. F | Q7VTT6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.77e-03 | NA | NA | 0.4862 |
| 6. F | Q8E2D9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.87e-04 | NA | NA | 0.6506 |
| 6. F | B2K324 | Holliday junction ATP-dependent DNA helicase RuvB | 9.92e-05 | NA | NA | 0.6344 |
| 6. F | A5GI46 | Holliday junction ATP-dependent DNA helicase RuvB | 5.44e-04 | NA | NA | 0.5537 |
| 6. F | A4VYM0 | Holliday junction ATP-dependent DNA helicase RuvB | 2.91e-04 | NA | NA | 0.6566 |
| 6. F | B8H454 | Holliday junction ATP-dependent DNA helicase RuvB | 1.62e-05 | NA | NA | 0.6182 |
| 6. F | Q0C5W2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.94e-04 | NA | NA | 0.5239 |
| 6. F | Q3APQ7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.91e-04 | NA | NA | 0.6433 |
| 6. F | Q03R36 | Holliday junction ATP-dependent DNA helicase RuvB | 3.07e-04 | NA | NA | 0.6096 |
| 6. F | B8EA75 | Holliday junction ATP-dependent DNA helicase RuvB | 9.10e-05 | NA | NA | 0.6208 |
| 6. F | B0TF70 | Holliday junction ATP-dependent DNA helicase RuvB | 9.92e-05 | NA | NA | 0.5871 |
| 6. F | A2C563 | Holliday junction ATP-dependent DNA helicase RuvB | 3.43e-04 | NA | NA | 0.5512 |
| 6. F | A0Q6B4 | Holliday junction ATP-dependent DNA helicase RuvB | 5.01e-05 | NA | NA | 0.6012 |
| 6. F | Q6HDA6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.98e-04 | NA | NA | 0.6254 |
| 6. F | B3PB59 | Holliday junction ATP-dependent DNA helicase RuvB | 7.24e-05 | NA | NA | 0.6645 |
| 6. F | C1CC50 | Holliday junction ATP-dependent DNA helicase RuvB | 3.48e-04 | NA | NA | 0.6698 |
| 6. F | Q5FQC4 | Holliday junction ATP-dependent DNA helicase RuvB | 3.08e-05 | NA | NA | 0.6285 |
| 6. F | P66757 | Holliday junction ATP-dependent DNA helicase RuvB | 1.48e-04 | NA | NA | 0.6003 |
| 6. F | A0LXR1 | Holliday junction ATP-dependent DNA helicase RuvB | 4.62e-04 | NA | NA | 0.6234 |
| 6. F | Q7WGB3 | Holliday junction ATP-dependent DNA helicase RuvB | 9.53e-04 | NA | NA | 0.4823 |
| 6. F | Q3JNS5 | Holliday junction ATP-dependent DNA helicase RuvB | 2.99e-03 | NA | NA | 0.598 |
| 6. F | B5ZAF5 | Holliday junction ATP-dependent DNA helicase RuvB | 6.28e-05 | NA | NA | 0.6025 |
| 6. F | A7I781 | Replication factor C large subunit | 1.34e-04 | NA | NA | 0.3447 |
| 6. F | A1R724 | Holliday junction ATP-dependent DNA helicase RuvB | 6.85e-05 | NA | NA | 0.641 |
| 6. F | B5XQ05 | Holliday junction ATP-dependent DNA helicase RuvB | 1.22e-04 | NA | NA | 0.6347 |
| 6. F | A5CW96 | Holliday junction ATP-dependent DNA helicase RuvB | 5.93e-04 | NA | NA | 0.6161 |
| 6. F | A3QEP3 | Holliday junction ATP-dependent DNA helicase RuvB | 5.10e-04 | NA | NA | 0.6267 |
| 6. F | A1RJQ2 | Holliday junction ATP-dependent DNA helicase RuvB | 1.07e-04 | NA | NA | 0.6356 |
| 6. F | A9QYX2 | Holliday junction ATP-dependent DNA helicase RuvB | 9.89e-05 | NA | NA | 0.6301 |
| 6. F | Q65UP0 | Holliday junction ATP-dependent DNA helicase RuvB | 9.82e-05 | NA | NA | 0.6096 |
| 6. F | B2IBR9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.87e-04 | NA | NA | 0.6356 |
| 6. F | Q42450 | Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic | 2.04e-04 | NA | NA | 0.5472 |
| 6. F | A9VIP6 | Holliday junction ATP-dependent DNA helicase RuvB | 2.61e-04 | NA | NA | 0.5753 |
| 6. F | B9E718 | Holliday junction ATP-dependent DNA helicase RuvB | 3.34e-04 | NA | NA | 0.6263 |
| 6. F | Q02IC9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.07e-03 | NA | NA | 0.6267 |
| 6. F | B0K0L8 | Holliday junction ATP-dependent DNA helicase RuvB | 8.77e-05 | NA | NA | 0.6394 |
| 6. F | C1A611 | Holliday junction ATP-dependent DNA helicase RuvB | 7.99e-05 | NA | NA | 0.5928 |
| 6. F | C3P9A7 | Holliday junction ATP-dependent DNA helicase RuvB | 2.83e-04 | NA | NA | 0.6265 |
| 6. F | Q81LG9 | Holliday junction ATP-dependent DNA helicase RuvB | 2.67e-04 | NA | NA | 0.5685 |
| 6. F | Q97BC2 | Replication factor C large subunit | 1.11e-03 | NA | NA | 0.4284 |
| 6. F | Q8Y6Z8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.06e-04 | NA | NA | 0.6155 |
| 6. F | P10871 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 2.03e-04 | NA | NA | 0.5325 |
| 6. F | A4JBL2 | Holliday junction ATP-dependent DNA helicase RuvB | 3.04e-03 | NA | NA | 0.6372 |
| 6. F | Q12N10 | Holliday junction ATP-dependent DNA helicase RuvB | 2.01e-05 | NA | NA | 0.5918 |
| 6. F | A3NZ67 | Holliday junction ATP-dependent DNA helicase RuvB | 3.69e-03 | NA | NA | 0.5725 |
| 6. F | Q9A1Y1 | Holliday junction ATP-dependent DNA helicase RuvB | 2.98e-04 | NA | NA | 0.6577 |
| 6. F | B2USM3 | Holliday junction ATP-dependent DNA helicase RuvB | 5.66e-05 | NA | NA | 0.6134 |
| 6. F | Q63QX5 | Holliday junction ATP-dependent DNA helicase RuvB | 3.47e-03 | NA | NA | 0.6374 |
| 6. F | A2SQR6 | Replication factor C large subunit | 1.01e-04 | NA | NA | 0.3498 |
| 6. F | B6ITI4 | Holliday junction ATP-dependent DNA helicase RuvB | 9.39e-05 | NA | NA | 0.6417 |
| 6. F | Q11Y53 | Holliday junction ATP-dependent DNA helicase RuvB | 6.71e-04 | NA | NA | 0.5445 |
| 6. F | Q1BZ36 | Holliday junction ATP-dependent DNA helicase RuvB | 7.96e-04 | NA | NA | 0.6375 |
| 6. F | B1AJ89 | Holliday junction ATP-dependent DNA helicase RuvB | 2.50e-05 | NA | NA | 0.5532 |
| 6. F | Q5P2U7 | Holliday junction ATP-dependent DNA helicase RuvB | 1.46e-03 | NA | NA | 0.6339 |
| 6. F | Q220I3 | Holliday junction ATP-dependent DNA helicase RuvB | 1.10e-03 | NA | NA | 0.4855 |
| 6. F | A9KF39 | Holliday junction ATP-dependent DNA helicase RuvB | 2.01e-04 | NA | NA | 0.5754 |
| 6. F | Q03B17 | Holliday junction ATP-dependent DNA helicase RuvB | 8.87e-05 | NA | NA | 0.666 |
| 6. F | Q2YT89 | Holliday junction ATP-dependent DNA helicase RuvB | 1.51e-04 | NA | NA | 0.6003 |
| 6. F | Q8CWU7 | Holliday junction ATP-dependent DNA helicase RuvB | 3.08e-04 | NA | NA | 0.67 |
| 6. F | Q2FPZ8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.86e-04 | NA | NA | 0.5526 |
| 6. F | Q8E7Z4 | Chromosomal replication initiator protein DnaA | 1.24e-04 | NA | NA | 0.4416 |
| 6. F | A9NF62 | Holliday junction ATP-dependent DNA helicase RuvB | 2.23e-04 | NA | NA | 0.6107 |
| 6. F | B8CNY1 | Holliday junction ATP-dependent DNA helicase RuvB | 9.62e-05 | NA | NA | 0.5942 |
| 6. F | Q7W4T6 | Holliday junction ATP-dependent DNA helicase RuvB | 9.41e-04 | NA | NA | 0.5885 |
| 6. F | B7LPI4 | Holliday junction ATP-dependent DNA helicase RuvB | 8.38e-05 | NA | NA | 0.6358 |
| 6. F | A6VQA3 | Holliday junction ATP-dependent DNA helicase RuvB | 9.83e-05 | NA | NA | 0.6287 |
| 6. F | A6QC28 | Holliday junction ATP-dependent DNA helicase RuvB | 9.13e-04 | NA | NA | 0.5433 |
| 6. F | B8EK46 | Holliday junction ATP-dependent DNA helicase RuvB | 3.51e-04 | NA | NA | 0.5242 |
| 6. F | Q83MZ8 | Holliday junction ATP-dependent DNA helicase RuvB | 3.46e-04 | NA | NA | 0.6287 |
| 6. F | B1J0M8 | Holliday junction ATP-dependent DNA helicase RuvB | 9.77e-05 | NA | NA | 0.6293 |
| 6. F | P61529 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-04 | NA | NA | 0.6197 |
| 6. F | Q9PQ42 | Holliday junction ATP-dependent DNA helicase RuvB | 2.24e-05 | NA | NA | 0.5733 |
| 6. F | Q57396 | Holliday junction ATP-dependent DNA helicase RuvB | 8.15e-04 | NA | NA | 0.6198 |
| 6. F | A0KWL9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.01e-04 | NA | NA | 0.6371 |
| 6. F | Q7X9A0 | Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic | 1.33e-04 | NA | NA | 0.5972 |
| 6. F | Q9ZM57 | Holliday junction ATP-dependent DNA helicase RuvB | 5.65e-05 | NA | NA | 0.6254 |
| 6. F | A1AC21 | Holliday junction ATP-dependent DNA helicase RuvB | 1.19e-04 | NA | NA | 0.6345 |
| 6. F | B7NS58 | Holliday junction ATP-dependent DNA helicase RuvB | 8.87e-05 | NA | NA | 0.6347 |
| 6. F | Q8U9K6 | Holliday junction ATP-dependent DNA helicase RuvB | 1.77e-04 | NA | NA | 0.6362 |
| 6. F | A7GTA2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.90e-04 | NA | NA | 0.6078 |
| 6. F | Q2FG86 | Holliday junction ATP-dependent DNA helicase RuvB | 1.49e-04 | NA | NA | 0.6008 |
| 6. F | A8LXW9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.03e-04 | NA | NA | 0.5306 |
| 6. F | B5FCQ2 | Holliday junction ATP-dependent DNA helicase RuvB | 7.78e-04 | NA | NA | 0.6176 |
| 6. F | P61536 | Holliday junction ATP-dependent DNA helicase RuvB | 2.14e-04 | NA | NA | 0.641 |
| 6. F | Q5M2B1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.94e-03 | NA | NA | 0.6753 |
| 6. F | P0DF51 | Holliday junction ATP-dependent DNA helicase RuvB | 2.93e-04 | NA | NA | 0.6686 |
| 6. F | B7MVZ1 | Holliday junction ATP-dependent DNA helicase RuvB | 9.35e-05 | NA | NA | 0.6348 |
| 6. F | Q5ZV64 | Holliday junction ATP-dependent DNA helicase RuvB | 1.18e-04 | NA | NA | 0.6408 |
| 6. F | Q15RN6 | Holliday junction ATP-dependent DNA helicase RuvB | 3.65e-04 | NA | NA | 0.6161 |
| 6. F | Q06721 | Ribulose bisphosphate carboxylase/oxygenase activase | 8.99e-05 | NA | NA | 0.5201 |
| 6. F | Q12TX1 | Replication factor C large subunit | 2.31e-04 | NA | NA | 0.3579 |
| 6. F | A8FN42 | Holliday junction ATP-dependent DNA helicase RuvB | 1.40e-05 | NA | NA | 0.5063 |
| 6. F | P0A813 | Holliday junction ATP-dependent DNA helicase RuvB | 9.53e-05 | NA | NA | 0.628 |
| 6. F | A8FFR2 | Holliday junction ATP-dependent DNA helicase RuvB | 2.49e-04 | NA | NA | 0.5473 |
| 6. F | O49074 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 1.66e-04 | NA | NA | 0.5788 |
| 6. F | Q24UN7 | Holliday junction ATP-dependent DNA helicase RuvB | 7.43e-05 | NA | NA | 0.5902 |
| 6. F | Q54316 | Hemolysin B | 1.43e-02 | NA | NA | 0.2986 |
| 6. F | Q2RVF5 | Holliday junction ATP-dependent DNA helicase RuvB | 3.14e-04 | NA | NA | 0.5627 |
| 6. F | Q0BT53 | Holliday junction ATP-dependent DNA helicase RuvB | 1.70e-04 | NA | NA | 0.6299 |
| 6. F | Q6GG63 | Holliday junction ATP-dependent DNA helicase RuvB | 1.85e-04 | NA | NA | 0.5913 |
| 6. F | A8Z2G9 | Holliday junction ATP-dependent DNA helicase RuvB | 1.58e-04 | NA | NA | 0.5997 |
| 6. F | Q0BLU4 | Holliday junction ATP-dependent DNA helicase RuvB | 7.87e-04 | NA | NA | 0.5985 |
| 7. B | B1XUS8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.06e-03 | NA | 2.46e-04 | NA |
| 7. B | Q9MAK9 | 26S proteasome regulatory subunit S10B homolog B | 5.02e-08 | NA | 2.26e-52 | NA |
| 7. B | A4QGA7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.13e-03 | NA | 0.011 | NA |
| 7. B | Q8Z8V1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.31e-02 | NA | 0.002 | NA |
| 7. B | Q1G9V4 | ATP-dependent protease ATPase subunit HslU | 6.20e-02 | NA | 0.008 | NA |
| 7. B | Q5WVJ1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.63e-02 | NA | 8.90e-04 | NA |
| 7. B | A2SBG4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.77e-03 | NA | 0.004 | NA |
| 7. B | Q2G3T4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.43e-03 | NA | 0.003 | NA |
| 7. B | Q54PJ1 | 26S proteasome regulatory subunit 10B | 2.93e-08 | NA | 7.83e-52 | NA |
| 7. B | Q4URL5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.60e-03 | NA | 6.38e-04 | NA |
| 7. B | A0Q2L0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.49e-03 | NA | 0.002 | NA |
| 7. B | B0RAS4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.05e-02 | NA | 0.007 | NA |
| 7. B | P0DA37 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.56e-03 | NA | 0.005 | NA |
| 7. B | A4S6Y4 | Lon protease homolog, mitochondrial | 4.59e-03 | NA | 0.030 | NA |
| 7. B | B9DNC0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.82e-03 | NA | 0.001 | NA |
| 7. B | Q55BV5 | 26S proteasome regulatory subunit 4 homolog | 7.57e-07 | NA | 3.01e-52 | NA |
| 7. B | Q6PL18 | ATPase family AAA domain-containing protein 2 | 6.01e-04 | NA | 7.91e-38 | NA |
| 7. B | Q1B601 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.80e-03 | NA | 0.002 | NA |
| 7. B | Q09769 | Lon protease homolog, mitochondrial | 1.27e-02 | NA | 2.24e-04 | NA |
| 7. B | C6DHM6 | ATP-dependent protease ATPase subunit HslU | 2.09e-02 | NA | 0.048 | NA |
| 7. B | Q9ERZ6 | Fidgetin | 2.45e-04 | NA | 4.67e-17 | NA |
| 7. B | Q67SJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.31e-03 | NA | 6.13e-04 | NA |
| 7. B | A1KLF3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.87e-03 | NA | 0.002 | NA |
| 7. B | Q9M895 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic | 1.53e-07 | NA | 9.89e-75 | NA |
| 7. B | Q47JL8 | ATP-dependent protease ATPase subunit HslU | 2.61e-02 | NA | 0.039 | NA |
| 7. B | C1AVQ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.24e-03 | NA | 0.002 | NA |
| 7. B | B0US05 | ATP-dependent protease ATPase subunit HslU | 2.23e-02 | NA | 0.022 | NA |
| 7. B | Q54HY8 | Probable mitochondrial chaperone BCS1-A | 5.39e-05 | NA | 4.09e-12 | NA |
| 7. B | Q63569 | 26S proteasome regulatory subunit 6A | 3.44e-08 | NA | 1.15e-60 | NA |
| 7. B | A8AKZ1 | ATP-dependent protease ATPase subunit HslU | 2.61e-02 | NA | 0.046 | NA |
| 7. B | A0R196 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.19e-03 | NA | 0.002 | NA |
| 7. B | A9MM22 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-02 | NA | 0.004 | NA |
| 7. B | Q7UA37 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.35e-02 | NA | 0.029 | NA |
| 7. B | Q5NNY7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.19e-03 | NA | 0.031 | NA |
| 7. B | O17071 | Probable 26S proteasome regulatory subunit 10B | 1.22e-07 | NA | 4.11e-54 | NA |
| 7. B | Q9DBY8 | Nuclear valosin-containing protein-like | 7.47e-05 | NA | 1.80e-46 | NA |
| 7. B | C1CLR8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.12e-03 | NA | 0.037 | NA |
| 7. B | P9WPB9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.96e-03 | NA | 0.002 | NA |
| 7. B | A4YVM3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.48e-03 | NA | 0.025 | NA |
| 7. B | Q9SS94 | Cell division control protein 48 homolog C | 1.75e-04 | NA | 3.70e-40 | NA |
| 7. B | Q73XN1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.34e-03 | NA | 0.002 | NA |
| 7. B | Q7MMG6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.50e-02 | NA | 0.009 | NA |
| 7. B | P60373 | Replication factor C large subunit | 8.19e-04 | NA | 0.018 | NA |
| 7. B | Q2L1D0 | ATP-dependent protease ATPase subunit HslU | 2.05e-02 | NA | 0.032 | NA |
| 7. B | A1SQW3 | ATP-dependent protease ATPase subunit HslU | 1.90e-02 | NA | 0.041 | NA |
| 7. B | B8D9Q3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.34e-03 | NA | 4.29e-04 | NA |
| 7. B | Q3Z4W5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.31e-02 | NA | 0.004 | NA |
| 7. B | Q043R3 | ATP-dependent protease ATPase subunit HslU | 5.46e-02 | NA | 0.037 | NA |
| 7. B | P46466 | 26S proteasome regulatory subunit 4 homolog | 2.33e-06 | NA | 3.80e-51 | NA |
| 7. B | P36776 | Lon protease homolog, mitochondrial | 5.50e-03 | NA | 0.004 | NA |
| 7. B | O14325 | Uncharacterized AAA domain-containing protein C16E9.10c | 7.12e-07 | NA | 3.28e-46 | NA |
| 7. B | P54816 | Tat-binding homolog 7 | 1.64e-03 | NA | 2.17e-38 | NA |
| 7. B | Q5U3S1 | Katanin p60 ATPase-containing subunit A-like 1 | 1.71e-06 | NA | 5.15e-32 | NA |
| 7. B | Q8D347 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.69e-03 | NA | 7.73e-05 | NA |
| 7. B | Q0VQ89 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.49e-03 | NA | 0.002 | NA |
| 7. B | Q5F8W5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.92e-02 | NA | 0.004 | NA |
| 7. B | P0A6H1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.40e-02 | NA | 0.004 | NA |
| 7. B | C1CFF2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.22e-03 | NA | 0.037 | NA |
| 7. B | Q2W3I0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.45e-03 | NA | 0.044 | NA |
| 7. B | A9QZQ2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.05e-02 | NA | 0.004 | NA |
| 7. B | Q9JTX8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.16e-02 | NA | 0.003 | NA |
| 7. B | C4K2L5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.89e-03 | NA | 0.002 | NA |
| 7. B | B2FQR3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.20e-03 | NA | 1.89e-04 | NA |
| 7. B | A4XAH9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.04e-03 | NA | 0.012 | NA |
| 7. B | A7GIH1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.40e-03 | NA | 0.002 | NA |
| 7. B | Q0HED0 | ATP-dependent protease ATPase subunit HslU | 2.77e-02 | NA | 0.036 | NA |
| 7. B | Q3YV47 | ATP-dependent protease ATPase subunit HslU | 2.94e-02 | NA | 0.042 | NA |
| 7. B | B5QTJ7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.31e-02 | NA | 0.004 | NA |
| 7. B | B3PHK5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.59e-03 | NA | 0.002 | NA |
| 7. B | C4Z1T5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.60e-03 | NA | 0.018 | NA |
| 7. B | Q3K9X0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.40e-03 | NA | 0.002 | NA |
| 7. B | B5RPV8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.97e-03 | NA | 0.001 | NA |
| 7. B | A5WC69 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.70e-02 | NA | 0.003 | NA |
| 7. B | Q48U22 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.30e-03 | NA | 0.005 | NA |
| 7. B | Q9VQN8 | Fidgetin-like protein 1 | 2.32e-06 | NA | 8.11e-31 | NA |
| 7. B | Q8DCP4 | ATP-dependent protease ATPase subunit HslU | 2.57e-02 | NA | 0.048 | NA |
| 7. B | C5BTX7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.66e-03 | NA | 8.37e-04 | NA |
| 7. B | Q1C4K9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.15e-02 | NA | 0.004 | NA |
| 7. B | B2ICL8 | ATP-dependent protease ATPase subunit HslU | 2.44e-02 | NA | 0.031 | NA |
| 7. B | Q4UMY8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.28e-02 | NA | 0.003 | NA |
| 7. B | O30911 | ATP-dependent protease ATPase subunit HslU | 2.55e-02 | NA | 0.043 | NA |
| 7. B | P62198 | 26S proteasome regulatory subunit 8 | 3.61e-08 | NA | 7.90e-55 | NA |
| 7. B | Q5AZT7 | Lon protease homolog, mitochondrial | 1.36e-02 | NA | 0.020 | NA |
| 7. B | B7N2S2 | ATP-dependent protease ATPase subunit HslU | 4.41e-02 | NA | 0.041 | NA |
| 7. B | B2VES3 | ATP-dependent protease ATPase subunit HslU | 3.11e-02 | NA | 0.018 | NA |
| 7. B | P46461 | Vesicle-fusing ATPase 1 | 8.78e-05 | NA | 3.30e-31 | NA |
| 7. B | Q3BWQ0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.29e-03 | NA | 5.51e-04 | NA |
| 7. B | Q6AFZ6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.94e-03 | NA | 0.007 | NA |
| 7. B | Q5ZUE0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.71e-02 | NA | 0.001 | NA |
| 7. B | B1YRZ4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.66e-03 | NA | 5.96e-04 | NA |
| 7. B | Q7W216 | ATP-dependent protease ATPase subunit HslU | 2.01e-02 | NA | 0.038 | NA |
| 7. B | Q9LET7 | Calmodulin-interacting protein 111 | 1.20e-04 | NA | 2.23e-46 | NA |
| 7. B | Q5WEN9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.31e-03 | NA | 0.002 | NA |
| 7. B | B7VLM7 | ATP-dependent protease ATPase subunit HslU | 2.42e-02 | NA | 0.036 | NA |
| 7. B | Q8Y7K9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.50e-03 | NA | 0.002 | NA |
| 7. B | B0BAG0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.47e-03 | NA | 0.014 | NA |
| 7. B | Q54CS8 | Peroxisomal biogenesis factor 6 | 1.07e-04 | NA | 1.75e-41 | NA |
| 7. B | B8ZRP1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.98e-03 | NA | 0.001 | NA |
| 7. B | Q793F9 | Vacuolar protein sorting-associated protein 4A | 5.73e-06 | NA | 1.53e-32 | NA |
| 7. B | Q3UMC0 | ATPase family protein 2 homolog | 1.90e-04 | NA | 1.11e-48 | NA |
| 7. B | Q5BL07 | Peroxisome biogenesis factor 1 | 7.19e-02 | NA | 2.33e-39 | NA |
| 7. B | A8GPK1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.25e-02 | NA | 0.003 | NA |
| 7. B | Q5PIR9 | ATP-dependent protease ATPase subunit HslU | 1.99e-02 | NA | 0.043 | NA |
| 7. B | A7ZX96 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.20e-02 | NA | 0.004 | NA |
| 7. B | Q8NW72 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.82e-03 | NA | 0.002 | NA |
| 7. B | Q82Y56 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.48e-03 | NA | 7.38e-04 | NA |
| 7. B | Q7N0L4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 0.003 | NA |
| 7. B | Q1J741 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.20e-03 | NA | 0.005 | NA |
| 7. B | Q47FB7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.92e-03 | NA | 2.34e-04 | NA |
| 7. B | P44838 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 1.88e-04 | NA |
| 7. B | Q9FNP1 | Peroxisome biogenesis protein 1 | 4.62e-04 | NA | 8.84e-43 | NA |
| 7. B | B7VHZ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.44e-02 | NA | 0.009 | NA |
| 7. B | Q99LC9 | Peroxisome assembly factor 2 | 2.15e-04 | NA | 1.29e-35 | NA |
| 7. B | Q5M0S4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.03e-03 | NA | 0.011 | NA |
| 7. B | C5CJT5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.80e-03 | NA | 0.003 | NA |
| 7. B | C1C8G0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.45e-03 | NA | 0.037 | NA |
| 7. B | Q6AS16 | Lon protease 1 | 3.30e-03 | NA | 2.15e-04 | NA |
| 7. B | B3E1Z3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.03e-03 | NA | 0.027 | NA |
| 7. B | Q9LH82 | AAA-ATPase At3g28540 | 1.71e-04 | NA | 2.27e-06 | NA |
| 7. B | Q550C8 | Lon protease homolog, mitochondrial 2 | 7.45e-03 | NA | 0.015 | NA |
| 7. B | B4T0T8 | ATP-dependent protease ATPase subunit HslU | 2.52e-02 | NA | 0.043 | NA |
| 7. B | B3ENA3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.77e-03 | NA | 0.003 | NA |
| 7. B | Q503S1 | Fidgetin | 7.08e-05 | NA | 7.85e-16 | NA |
| 7. B | C5A098 | ATP-dependent protease ATPase subunit HslU | 3.13e-02 | NA | 0.042 | NA |
| 7. B | Q8CDM1 | ATPase family AAA domain-containing protein 2 | 9.47e-05 | NA | 2.66e-38 | NA |
| 7. B | O42931 | 26S proteasome regulatory subunit 7 homolog | 5.84e-07 | NA | 1.48e-55 | NA |
| 7. B | Q09535 | Putative pachytene checkpoint protein 2 | 9.93e-05 | NA | 6.45e-04 | NA |
| 7. B | Q54PT2 | Vacuolar protein sorting-associated protein 4 | 1.79e-06 | NA | 3.95e-30 | NA |
| 7. B | O67356 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.39e-03 | NA | 0.003 | NA |
| 7. B | B1WUD2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.66e-02 | NA | 0.021 | NA |
| 7. B | B8I8F6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.99e-03 | NA | 0.001 | NA |
| 7. B | Q15R47 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.78e-03 | NA | 0.002 | NA |
| 7. B | B6HZP5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.30e-02 | NA | 0.004 | NA |
| 7. B | P55995 | Lon protease | 1.22e-02 | NA | 0.013 | NA |
| 7. B | B1XFM6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.42e-02 | NA | 0.004 | NA |
| 7. B | B8E291 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.64e-03 | NA | 0.013 | NA |
| 7. B | A1U1Q2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.05e-03 | NA | 0.001 | NA |
| 7. B | A4T2N8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.74e-03 | NA | 0.002 | NA |
| 7. B | Q9VEX6 | ATPase family AAA domain-containing protein 3A homolog | 8.05e-06 | NA | 4.82e-08 | NA |
| 7. B | B8FVI0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.66e-03 | NA | 0.001 | NA |
| 7. B | O14126 | 26S proteasome regulatory subunit 6A | 5.39e-08 | NA | 2.95e-60 | NA |
| 7. B | O13764 | Peroxisomal ATPase pex6 | 8.69e-05 | NA | 4.67e-43 | NA |
| 7. B | Q2IWZ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.16e-03 | NA | 0.024 | NA |
| 7. B | B5YI39 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.18e-03 | NA | 0.003 | NA |
| 7. B | Q6NW58 | Spastin | 4.38e-07 | NA | 6.43e-28 | NA |
| 7. B | E2R222 | Pachytene checkpoint protein 2 homolog | 7.06e-03 | NA | 1.18e-05 | NA |
| 7. B | P46468 | Putative cell division cycle ATPase | 2.32e-04 | NA | 3.06e-52 | NA |
| 7. B | Q9CBY6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.42e-03 | NA | 0.001 | NA |
| 7. B | O74941 | Peroxisomal ATPase pex1 | 1.56e-04 | NA | 5.00e-42 | NA |
| 7. B | B5E6L2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.50e-03 | NA | 0.036 | NA |
| 7. B | Q8XKK2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.19e-03 | NA | 0.002 | NA |
| 7. B | B1M5N6 | ATP-dependent protease ATPase subunit HslU | 2.38e-02 | NA | 0.017 | NA |
| 7. B | B8EIL3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.24e-03 | NA | 0.032 | NA |
| 7. B | B2S3A2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.23e-03 | NA | 0.008 | NA |
| 7. B | Q9PD94 | ATP-dependent protease ATPase subunit HslU | 2.27e-02 | NA | 0.041 | NA |
| 7. B | Q3A701 | Lon protease 1 | 2.38e-03 | NA | 0.020 | NA |
| 7. B | A6V718 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.00e-02 | NA | 7.70e-04 | NA |
| 7. B | P35998 | 26S proteasome regulatory subunit 7 | 1.39e-06 | NA | 2.75e-57 | NA |
| 7. B | Q5P160 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.97e-03 | NA | 0.001 | NA |
| 7. B | A1S2P4 | ATP-dependent protease ATPase subunit HslU | 2.82e-02 | NA | 0.039 | NA |
| 7. B | A4VGE9 | ATP-dependent protease ATPase subunit HslU | 6.27e-02 | NA | 0.047 | NA |
| 7. B | Q8KFC3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.12e-03 | NA | 0.009 | NA |
| 7. B | Q4X0Z7 | Lon protease homolog, mitochondrial | 1.32e-02 | NA | 0.027 | NA |
| 7. B | P0A6H6 | ATP-dependent protease ATPase subunit HslU | 3.33e-02 | NA | 0.042 | NA |
| 7. B | Q5NH46 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.39e-02 | NA | 4.75e-04 | NA |
| 7. B | Q2JW64 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.78e-02 | NA | 0.046 | NA |
| 7. B | C5BXF8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.24e-03 | NA | 0.001 | NA |
| 7. B | A3D306 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 6.15e-04 | NA |
| 7. B | A2C5R5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.54e-02 | NA | 0.041 | NA |
| 7. B | Q6D826 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.20e-02 | NA | 0.005 | NA |
| 7. B | Q63347 | 26S proteasome regulatory subunit 7 | 9.48e-07 | NA | 2.19e-57 | NA |
| 7. B | Q9C0W2 | Uncharacterized AAA domain-containing protein P22H7.05c | 1.27e-04 | NA | 7.77e-37 | NA |
| 7. B | B0B8T1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.72e-03 | NA | 0.014 | NA |
| 7. B | Q7M8U5 | ATP-dependent Clp protease ATP-binding subunit ClpX 2 | 1.28e-03 | NA | 0.002 | NA |
| 7. B | B0SZ62 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.10e-03 | NA | 0.011 | NA |
| 7. B | Q8E9U9 | ATP-dependent protease ATPase subunit HslU | 4.31e-02 | NA | 0.034 | NA |
| 7. B | Q9D3R6 | Katanin p60 ATPase-containing subunit A-like 2 | 1.21e-05 | NA | 1.83e-28 | NA |
| 7. B | B9WEC4 | Lon protease homolog 2, peroxisomal | 5.15e-02 | NA | 0.037 | NA |
| 7. B | A6TM62 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.54e-03 | NA | 1.69e-04 | NA |
| 7. B | P0A6H5 | ATP-dependent protease ATPase subunit HslU | 4.30e-02 | NA | 0.042 | NA |
| 7. B | A8Z5Z0 | Lon protease | 7.97e-03 | NA | 0.012 | NA |
| 7. B | B5BD82 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.004 | NA |
| 7. B | B7UJR1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 0.004 | NA |
| 7. B | B9DU73 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.73e-03 | NA | 0.005 | NA |
| 7. B | Q180E8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.15e-03 | NA | 2.36e-04 | NA |
| 7. B | A3PFE5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.06e-03 | NA | 0.029 | NA |
| 7. B | Q925I1 | ATPase family AAA domain-containing protein 3 | 2.99e-05 | NA | 7.04e-09 | NA |
| 7. B | Q8CNY5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.42e-03 | NA | 0.002 | NA |
| 7. B | A6QHK8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.79e-03 | NA | 0.002 | NA |
| 7. B | A4WG67 | ATP-dependent protease ATPase subunit HslU | 2.46e-02 | NA | 0.035 | NA |
| 7. B | Q7KUT2 | Lon protease homolog, mitochondrial | 1.12e-02 | NA | 0.003 | NA |
| 7. B | Q2P6Y9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.70e-03 | NA | 5.51e-04 | NA |
| 7. B | Q9UXF6 | Replication factor C large subunit | 1.17e-04 | NA | 0.009 | NA |
| 7. B | B8CY73 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.22e-02 | NA | 8.41e-04 | NA |
| 7. B | P10896 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 2.34e-04 | NA | 0.030 | NA |
| 7. B | B2I8K4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.68e-03 | NA | 6.59e-04 | NA |
| 7. B | Q1JHC2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.35e-03 | NA | 0.005 | NA |
| 7. B | A0AI71 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.75e-03 | NA | 0.002 | NA |
| 7. B | Q12BY1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.76e-03 | NA | 3.56e-04 | NA |
| 7. B | Q4QN49 | ATP-dependent protease ATPase subunit HslU | 1.78e-02 | NA | 0.027 | NA |
| 7. B | Q1LTT5 | ATP-dependent protease ATPase subunit HslU | 3.15e-02 | NA | 0.038 | NA |
| 7. B | B5BJK8 | ATP-dependent protease ATPase subunit HslU | 2.54e-02 | NA | 0.043 | NA |
| 7. B | P50866 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.12e-03 | NA | 0.002 | NA |
| 7. B | E1C6Q1 | Pachytene checkpoint protein 2 homolog | 7.89e-04 | NA | 7.06e-05 | NA |
| 7. B | Q1MQ78 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.69e-03 | NA | 0.020 | NA |
| 7. B | A2ZVG7 | ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial | 1.03e-13 | NA | 4.62e-119 | NA |
| 7. B | P33297 | 26S proteasome regulatory subunit 6A | 7.43e-08 | NA | 1.00e-64 | NA |
| 7. B | O44952 | Lon protease homolog, mitochondrial | 3.68e-02 | NA | 0.039 | NA |
| 7. B | Q04JH9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.92e-03 | NA | 0.037 | NA |
| 7. B | B7LME1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 0.004 | NA |
| 7. B | Q6MBE8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.74e-03 | NA | 0.039 | NA |
| 7. B | Q68W45 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.33e-03 | NA | 0.003 | NA |
| 7. B | A0KJU2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 0.005 | NA |
| 7. B | Q0VMA5 | ATP-dependent protease ATPase subunit HslU | 2.80e-02 | NA | 0.009 | NA |
| 7. B | A5ITJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.84e-03 | NA | 0.002 | NA |
| 7. B | P43686 | 26S proteasome regulatory subunit 6B | 9.74e-10 | NA | 5.54e-51 | NA |
| 7. B | Q62JK8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.22e-03 | NA | 0.004 | NA |
| 7. B | Q89KG2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.36e-03 | NA | 0.026 | NA |
| 7. B | A1TCB3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.50e-03 | NA | 0.002 | NA |
| 7. B | Q6GG31 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.89e-03 | NA | 0.002 | NA |
| 7. B | Q1GGF7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.22e-03 | NA | 0.049 | NA |
| 7. B | O43078 | ATPase-like fidgetin | 2.08e-05 | NA | 6.52e-22 | NA |
| 7. B | Q9YBS5 | Replication factor C large subunit | 9.39e-05 | NA | 2.20e-04 | NA |
| 7. B | Q94392 | Vesicle-fusing ATPase | 3.94e-04 | NA | 1.64e-32 | NA |
| 7. B | A0K846 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.66e-03 | NA | 5.61e-04 | NA |
| 7. B | B4F171 | ATP-dependent protease ATPase subunit HslU | 3.45e-02 | NA | 0.046 | NA |
| 7. B | Q6LVI3 | ATP-dependent protease ATPase subunit HslU | 3.00e-02 | NA | 0.038 | NA |
| 7. B | B6J8W3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.58e-03 | NA | 0.002 | NA |
| 7. B | Q6PH52 | Pachytene checkpoint protein 2 homolog | 5.49e-04 | NA | 1.95e-05 | NA |
| 7. B | A6H5M5 | Protein Ycf2 | 7.40e-03 | NA | 4.48e-11 | NA |
| 7. B | P62193 | 26S proteasome regulatory subunit 4 | 7.14e-07 | NA | 7.63e-50 | NA |
| 7. B | P46502 | Probable 26S proteasome regulatory subunit 6B | 1.74e-09 | NA | 1.42e-46 | NA |
| 7. B | A4W7A9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 0.003 | NA |
| 7. B | Q9FKM3 | AAA-ATPase At5g57480 | 6.59e-04 | NA | 5.53e-08 | NA |
| 7. B | B5YZ71 | ATP-dependent protease ATPase subunit HslU | 3.90e-02 | NA | 0.042 | NA |
| 7. B | A7GTF1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.71e-03 | NA | 0.003 | NA |
| 7. B | B7NJ56 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.32e-02 | NA | 0.004 | NA |
| 7. B | P34123 | 26S proteasome regulatory subunit 6B homolog | 2.72e-09 | NA | 1.72e-49 | NA |
| 7. B | P0AAZ5 | Replication-associated recombination protein A | 6.50e-04 | NA | 0.013 | NA |
| 7. B | Q472D2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.18e-03 | NA | 4.08e-04 | NA |
| 7. B | Q9SZD4 | 26S proteasome regulatory subunit 4 homolog A | 4.24e-07 | NA | 1.81e-51 | NA |
| 7. B | O69300 | Lon protease | 5.26e-03 | NA | 0.030 | NA |
| 7. B | O74894 | 26S proteasome regulatory subunit 6B homolog | 5.61e-10 | NA | 2.87e-51 | NA |
| 7. B | O43933 | Peroxisome biogenesis factor 1 | 3.71e-02 | NA | 4.28e-39 | NA |
| 7. B | A9IR50 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.69e-03 | NA | 1.56e-04 | NA |
| 7. B | A9C1U9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.28e-03 | NA | 0.001 | NA |
| 7. B | P28737 | Outer mitochondrial transmembrane helix translocase | 5.72e-10 | NA | 6.87e-35 | NA |
| 7. B | B1JHS0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.43e-02 | NA | 0.004 | NA |
| 7. B | A4SDM4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.93e-03 | NA | 0.015 | NA |
| 7. B | Q6G5R1 | Holliday junction ATP-dependent DNA helicase RuvB | 3.34e-04 | NA | 0.005 | NA |
| 7. B | Q1JM77 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.62e-03 | NA | 0.005 | NA |
| 7. B | Q6AJQ6 | ATP-dependent protease ATPase subunit HslU | 3.00e-02 | NA | 0.027 | NA |
| 7. B | A0QDF5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.36e-03 | NA | 0.002 | NA |
| 7. B | Q86JA1 | 26S proteasome regulatory subunit 7 | 8.57e-07 | NA | 4.63e-56 | NA |
| 7. B | Q49YA6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.33e-03 | NA | 0.001 | NA |
| 7. B | Q8F353 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.44e-03 | NA | 8.45e-05 | NA |
| 7. B | B2RL24 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.62e-03 | NA | 6.85e-05 | NA |
| 7. B | Q0ST54 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.31e-03 | NA | 0.002 | NA |
| 7. B | Q3UA06 | Pachytene checkpoint protein 2 homolog | 3.48e-04 | NA | 2.38e-05 | NA |
| 7. B | B5FPU0 | ATP-dependent protease ATPase subunit HslU | 2.96e-02 | NA | 0.043 | NA |
| 7. B | Q8IYT4 | Katanin p60 ATPase-containing subunit A-like 2 | 1.24e-05 | NA | 2.59e-29 | NA |
| 7. B | Q5R7N3 | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial | 5.16e-02 | NA | 0.049 | NA |
| 7. B | B0UD19 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.00e-03 | NA | 0.035 | NA |
| 7. B | Q256C3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.21e-03 | NA | 0.014 | NA |
| 7. B | Q9ZNT0 | Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 | 1.41e-05 | NA | 1.33e-34 | NA |
| 7. B | C4ZGF5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.56e-03 | NA | 0.005 | NA |
| 7. B | B0KJG7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.18e-03 | NA | 0.002 | NA |
| 7. B | B5RF80 | ATP-dependent protease ATPase subunit HslU | 3.81e-02 | NA | 0.043 | NA |
| 7. B | Q97FT7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.46e-03 | NA | 0.010 | NA |
| 7. B | Q12IT8 | ATP-dependent protease ATPase subunit HslU | 4.22e-02 | NA | 0.034 | NA |
| 7. B | A5EWF3 | Lon protease | 1.23e-03 | NA | 0.029 | NA |
| 7. B | Q9P7J5 | Uncharacterized AAA domain-containing protein C24B10.10c | 9.47e-10 | NA | 1.25e-30 | NA |
| 7. B | Q0HHA2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.38e-02 | NA | 6.36e-04 | NA |
| 7. B | B8GX14 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.98e-03 | NA | 0.011 | NA |
| 7. B | B2UFQ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.81e-03 | NA | 5.97e-04 | NA |
| 7. B | Q505J9 | Outer mitochondrial transmembrane helix translocase | 2.30e-09 | NA | 1.74e-36 | NA |
| 7. B | Q7MH56 | ATP-dependent protease ATPase subunit HslU | 2.27e-02 | NA | 0.048 | NA |
| 7. B | Q9HUC5 | ATP-dependent protease ATPase subunit HslU | 5.81e-02 | NA | 0.040 | NA |
| 7. B | A9KWH8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.18e-02 | NA | 6.15e-04 | NA |
| 7. B | Q6N5L4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.48e-03 | NA | 0.023 | NA |
| 7. B | Q03LN0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.93e-03 | NA | 0.011 | NA |
| 7. B | Q9Z760 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.59e-03 | NA | 0.013 | NA |
| 7. B | Q13608 | Peroxisome assembly factor 2 | 5.14e-05 | NA | 1.54e-37 | NA |
| 7. B | Q6E0V2 | Katanin p60 ATPase-containing subunit A1 | 9.32e-06 | NA | 9.26e-33 | NA |
| 7. B | Q7MAS4 | ATP-dependent Clp protease ATP-binding subunit ClpX 1 | 1.20e-02 | NA | 0.007 | NA |
| 7. B | A8Z2J5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.85e-03 | NA | 0.002 | NA |
| 7. B | A1S4X6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.06e-02 | NA | 0.002 | NA |
| 7. B | Q5HY92 | Fidgetin | 7.72e-05 | NA | 7.13e-16 | NA |
| 7. B | B3GYW2 | ATP-dependent protease ATPase subunit HslU | 2.41e-02 | NA | 0.043 | NA |
| 7. B | Q8RY16 | Peroxisome biogenesis protein 6 | 2.76e-05 | NA | 2.33e-41 | NA |
| 7. B | B7MQF4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 0.004 | NA |
| 7. B | Q720F3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.32e-03 | NA | 0.002 | NA |
| 7. B | Q9Z617 | ATP-dependent protease ATPase subunit HslU | 2.51e-02 | NA | 0.011 | NA |
| 7. B | Q88D27 | ATP-dependent protease ATPase subunit HslU | 2.73e-02 | NA | 0.032 | NA |
| 7. B | A8Y3E2 | Lon protease homolog 2, peroxisomal | 2.83e-03 | NA | 0.009 | NA |
| 7. B | A8XFM8 | Lon protease homolog, mitochondrial | 3.44e-03 | NA | 0.031 | NA |
| 7. B | Q8VZG2 | Protein HYPER-SENSITIVITY-RELATED 4 | 2.85e-05 | NA | 3.06e-08 | NA |
| 7. B | Q5SCW3 | Protein Ycf2 | 8.93e-04 | NA | 1.24e-04 | NA |
| 7. B | A5U5F3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.97e-03 | NA | 0.002 | NA |
| 7. B | F4IJ77 | AAA-ATPase At2g46620 | 1.43e-04 | NA | 6.19e-04 | NA |
| 7. B | B4RCN8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.75e-03 | NA | 0.028 | NA |
| 7. B | Q5KWJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.08e-03 | NA | 4.78e-04 | NA |
| 7. B | A8AC24 | Replication factor C large subunit | 1.15e-04 | NA | 0.033 | NA |
| 7. B | A2BZ43 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.63e-02 | NA | 0.046 | NA |
| 7. B | C1A1N6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.02e-03 | NA | 0.002 | NA |
| 7. B | B0BUW3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.40e-03 | NA | 0.006 | NA |
| 7. B | A1W5B7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.72e-03 | NA | 0.002 | NA |
| 7. B | P63791 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.62e-03 | NA | 0.037 | NA |
| 7. B | C3K8V3 | ATP-dependent protease ATPase subunit HslU | 6.42e-02 | NA | 0.044 | NA |
| 7. B | A9KDS7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.45e-03 | NA | 0.002 | NA |
| 7. B | Q7NDN9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.07e-02 | NA | 0.005 | NA |
| 7. B | B5XZ37 | ATP-dependent protease ATPase subunit HslU | 3.68e-02 | NA | 0.018 | NA |
| 7. B | Q0KBK3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.77e-03 | NA | 3.58e-04 | NA |
| 7. B | Q47XL9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.05e-02 | NA | 0.003 | NA |
| 7. B | Q9PE40 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.22e-03 | NA | 0.001 | NA |
| 7. B | Q1QRX6 | ATP-dependent protease ATPase subunit HslU | 5.44e-02 | NA | 0.050 | NA |
| 7. B | B5Y0U1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.01e-02 | NA | 0.004 | NA |
| 7. B | P38126 | Pachytene checkpoint protein 2 | 4.39e-04 | NA | 2.85e-05 | NA |
| 7. B | C6E2S9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.08e-03 | NA | 0.006 | NA |
| 7. B | Q6MH12 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.80e-03 | NA | 0.001 | NA |
| 7. B | A3DNV8 | Replication factor C large subunit | 1.57e-04 | NA | 0.002 | NA |
| 7. B | Q9FGM0 | ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial | 1.07e-14 | NA | 2.29e-122 | NA |
| 7. B | A5GFA1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.05e-03 | NA | 0.018 | NA |
| 7. B | O83521 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.74e-03 | NA | 0.008 | NA |
| 7. B | Q9BVQ7 | Spermatogenesis-associated protein 5-like protein 1 | 3.00e-05 | NA | 5.73e-41 | NA |
| 7. B | B4SWU2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.27e-02 | NA | 0.004 | NA |
| 7. B | Q1QVW2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.30e-03 | NA | 0.002 | NA |
| 7. B | Q5T2N8 | ATPase family AAA domain-containing protein 3C | 5.81e-06 | NA | 3.52e-07 | NA |
| 7. B | A6LT28 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.94e-03 | NA | 0.002 | NA |
| 7. B | Q85WV5 | Protein Ycf2 | 3.25e-02 | NA | 7.49e-07 | NA |
| 7. B | B7VB75 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.10e-03 | NA | 7.70e-04 | NA |
| 7. B | A5CDP2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.09e-03 | NA | 0.001 | NA |
| 7. B | O15381 | Nuclear valosin-containing protein-like | 4.24e-05 | NA | 9.28e-47 | NA |
| 7. B | Q8NBU5 | Outer mitochondrial transmembrane helix translocase | 4.11e-10 | NA | 1.69e-36 | NA |
| 7. B | C0Q7X4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 0.004 | NA |
| 7. B | Q8DG27 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.44e-02 | NA | 0.009 | NA |
| 7. B | B4SLN2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.63e-03 | NA | 1.81e-04 | NA |
| 7. B | A2SFB6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.07e-03 | NA | 0.001 | NA |
| 7. B | P33298 | 26S proteasome regulatory subunit 6B homolog | 6.59e-11 | NA | 3.22e-50 | NA |
| 7. B | B2K6V8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.20e-02 | NA | 0.004 | NA |
| 7. B | Q8ZRC0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.09e-02 | NA | 0.004 | NA |
| 7. B | B3PI65 | ATP-dependent protease ATPase subunit HslU | 3.15e-02 | NA | 0.038 | NA |
| 7. B | A0PU31 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.01e-03 | NA | 0.002 | NA |
| 7. B | A4TS84 | ATP-dependent protease ATPase subunit HslU | 2.19e-02 | NA | 0.046 | NA |
| 7. B | B0UW19 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.46e-02 | NA | 3.19e-04 | NA |
| 7. B | B2HNG2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.11e-03 | NA | 0.002 | NA |
| 7. B | A4SXD7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.30e-03 | NA | 1.76e-04 | NA |
| 7. B | A7FCY4 | ATP-dependent protease ATPase subunit HslU | 2.37e-02 | NA | 0.046 | NA |
| 7. B | P40340 | Tat-binding homolog 7 | 4.06e-03 | NA | 6.51e-38 | NA |
| 7. B | P60122 | RuvB-like 1 | 9.57e-03 | NA | 0.033 | NA |
| 7. B | A9KH99 | Lon protease | 3.49e-03 | NA | 0.034 | NA |
| 7. B | Q7WQZ4 | ATP-dependent protease ATPase subunit HslU | 2.09e-02 | NA | 0.038 | NA |
| 7. B | Q21Y66 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.67e-03 | NA | 0.002 | NA |
| 7. B | B8ZLT1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.23e-03 | NA | 0.012 | NA |
| 7. B | A1AN84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.19e-03 | NA | 0.010 | NA |
| 7. B | A5GQ09 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.18e-03 | NA | 0.019 | NA |
| 7. B | Q0AD37 | ATP-dependent protease ATPase subunit HslU | 2.41e-02 | NA | 0.031 | NA |
| 7. B | Q0HZL9 | ATP-dependent protease ATPase subunit HslU | 1.08e-01 | NA | 0.036 | NA |
| 7. B | C0ZAG3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.62e-03 | NA | 0.001 | NA |
| 7. B | Q04TR3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.58e-03 | NA | 7.95e-05 | NA |
| 7. B | C5CAX2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.21e-02 | NA | 4.27e-04 | NA |
| 7. B | Q48KY9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.48e-03 | NA | 0.002 | NA |
| 7. B | Q9SEI3 | 26S proteasome regulatory subunit 10B homolog A | 1.12e-07 | NA | 2.92e-52 | NA |
| 7. B | C4KHA7 | Replication factor C large subunit | 1.05e-04 | NA | 0.006 | NA |
| 7. B | B7IIY3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.25e-03 | NA | 0.002 | NA |
| 7. B | B4EU54 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.73e-03 | NA | 0.003 | NA |
| 7. B | P63795 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.67e-03 | NA | 0.005 | NA |
| 7. B | Q3A1V6 | ATP-dependent protease ATPase subunit HslU | 2.79e-02 | NA | 0.031 | NA |
| 7. B | B2UX12 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.70e-03 | NA | 0.002 | NA |
| 7. B | B7NFN0 | ATP-dependent protease ATPase subunit HslU | 3.87e-02 | NA | 0.041 | NA |
| 7. B | Q8BPY9 | Fidgetin-like protein 1 | 6.86e-05 | NA | 3.78e-29 | NA |
| 7. B | B8FA63 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.21e-02 | NA | 0.013 | NA |
| 7. B | A6VW21 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.54e-03 | NA | 0.004 | NA |
| 7. B | B2IGP2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.66e-03 | NA | 0.026 | NA |
| 7. B | A1VRH7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.77e-03 | NA | 6.83e-04 | NA |
| 7. B | A6VDH5 | ATP-dependent protease ATPase subunit HslU | 4.75e-02 | NA | 0.045 | NA |
| 7. B | Q7ZV60 | Mitochondrial chaperone BCS1 | 2.71e-05 | NA | 1.17e-11 | NA |
| 7. B | B7N8Z2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.18e-02 | NA | 0.004 | NA |
| 7. B | B1XN45 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.94e-02 | NA | 0.044 | NA |
| 7. B | P32794 | ATPase family gene 2 protein | 1.03e-05 | NA | 2.79e-46 | NA |
| 7. B | Q754Q9 | Lon protease homolog, mitochondrial | 3.82e-03 | NA | 0.025 | NA |
| 7. B | Q7ZZ25 | Outer mitochondrial transmembrane helix translocase | 5.58e-09 | NA | 1.25e-30 | NA |
| 7. B | Q325G3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.03e-02 | NA | 0.004 | NA |
| 7. B | A6WIH5 | ATP-dependent protease ATPase subunit HslU | 2.24e-02 | NA | 0.041 | NA |
| 7. B | Q9SEI4 | 26S proteasome regulatory subunit 6B homolog | 8.26e-10 | NA | 8.13e-49 | NA |
| 7. B | Q8FBC0 | ATP-dependent protease ATPase subunit HslU | 4.02e-02 | NA | 0.041 | NA |
| 7. B | Q147F9 | AAA-ATPase At3g50940 | 9.76e-04 | NA | 3.72e-11 | NA |
| 7. B | A5I6W0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.02e-03 | NA | 0.002 | NA |
| 7. B | B8IMW6 | ATP-dependent protease ATPase subunit HslU | 3.61e-02 | NA | 0.044 | NA |
| 7. B | Q5PBC9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.35e-03 | NA | 0.047 | NA |
| 7. B | A9HRV3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.43e-03 | NA | 0.020 | NA |
| 7. B | B4S620 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.56e-03 | NA | 0.002 | NA |
| 7. B | Q0BEF7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.45e-03 | NA | 5.96e-04 | NA |
| 7. B | P93648 | Lon protease homolog, mitochondrial | 1.05e-02 | NA | 0.019 | NA |
| 7. B | Q7MX10 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.41e-03 | NA | 6.85e-05 | NA |
| 7. B | Q48735 | ATP-dependent protease ATPase subunit HslU | 5.14e-02 | NA | 0.008 | NA |
| 7. B | B1MMV6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.94e-03 | NA | 0.002 | NA |
| 7. B | Q7UZK6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.01e-01 | NA | 0.028 | NA |
| 7. B | A5EKA7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.76e-03 | NA | 0.022 | NA |
| 7. B | A3N333 | ATP-dependent protease ATPase subunit HslU | 2.26e-02 | NA | 0.043 | NA |
| 7. B | P63793 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.30e-03 | NA | 0.005 | NA |
| 7. B | Q3IJD5 | ATP-dependent protease ATPase subunit HslU | 4.38e-02 | NA | 0.035 | NA |
| 7. B | Q5XHZ9 | Pachytene checkpoint protein 2 homolog | 4.22e-04 | NA | 2.22e-05 | NA |
| 7. B | A9KSX1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 0.025 | NA |
| 7. B | B7MI63 | ATP-dependent protease ATPase subunit HslU | 4.03e-02 | NA | 0.041 | NA |
| 7. B | Q5AG40 | Vacuolar protein sorting-associated protein 4 | 4.78e-07 | NA | 2.71e-34 | NA |
| 7. B | Q57SB4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.02e-02 | NA | 0.004 | NA |
| 7. B | A1TM61 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.63e-03 | NA | 0.002 | NA |
| 7. B | Q9P3U2 | Uncharacterized AAA domain-containing protein C328.04 | 2.44e-05 | NA | 7.25e-22 | NA |
| 7. B | A8GL96 | ATP-dependent protease ATPase subunit HslU | 3.67e-02 | NA | 0.017 | NA |
| 7. B | C1ETR8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.46e-03 | NA | 0.002 | NA |
| 7. B | A9IH53 | ATP-dependent protease ATPase subunit HslU | 2.51e-02 | NA | 0.034 | NA |
| 7. B | Q052U5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.43e-03 | NA | 7.95e-05 | NA |
| 7. B | P0DA36 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.61e-03 | NA | 0.005 | NA |
| 7. B | C3JYJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.75e-03 | NA | 0.002 | NA |
| 7. B | B0TFI7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 5.73e-04 | NA |
| 7. B | Q2FG62 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.07e-03 | NA | 0.002 | NA |
| 7. B | Q1GPH4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.33e-03 | NA | 0.015 | NA |
| 7. B | A5V3U4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.02e-03 | NA | 0.017 | NA |
| 7. B | P17980 | 26S proteasome regulatory subunit 6A | 5.33e-08 | NA | 9.42e-61 | NA |
| 7. B | P57981 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.41e-02 | NA | 4.86e-04 | NA |
| 7. B | F4K7F6 | CLP protease regulatory subunit CLPX2, mitochondrial | 1.55e-02 | NA | 0.006 | NA |
| 7. B | A5F6Z1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.61e-03 | NA | 0.008 | NA |
| 7. B | A0LSV2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.05e-02 | NA | 0.003 | NA |
| 7. B | Q7W8X1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.68e-03 | NA | 6.01e-04 | NA |
| 7. B | P40327 | 26S proteasome regulatory subunit 4 homolog | 4.74e-07 | NA | 1.82e-48 | NA |
| 7. B | A1RP57 | ATP-dependent protease ATPase subunit HslU | 2.89e-02 | NA | 0.043 | NA |
| 7. B | A8MPR5 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic | 1.69e-12 | NA | 3.26e-80 | NA |
| 7. B | B7V3E7 | ATP-dependent protease ATPase subunit HslU | 4.37e-02 | NA | 0.040 | NA |
| 7. B | P57968 | ATP-dependent protease ATPase subunit HslU | 2.41e-02 | NA | 0.021 | NA |
| 7. B | Q9CGE6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.13e-03 | NA | 0.009 | NA |
| 7. B | B1LNN6 | ATP-dependent protease ATPase subunit HslU | 3.95e-02 | NA | 0.041 | NA |
| 7. B | B9E684 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.16e-03 | NA | 0.007 | NA |
| 7. B | Q60BE7 | ATP-dependent Clp protease ATP-binding subunit ClpX 2 | 5.76e-03 | NA | 0.004 | NA |
| 7. B | Q9I2U0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.70e-03 | NA | 7.70e-04 | NA |
| 7. B | C3PLG9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.55e-03 | NA | 0.002 | NA |
| 7. B | B1JQ76 | ATP-dependent protease ATPase subunit HslU | 3.70e-02 | NA | 0.046 | NA |
| 7. B | Q07NN5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.93e-03 | NA | 0.027 | NA |
| 7. B | Q9LH83 | AAA-ATPase At3g28520 | 1.82e-04 | NA | 1.98e-07 | NA |
| 7. B | Q66DT3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.92e-03 | NA | 0.004 | NA |
| 7. B | Q2FXQ7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.26e-03 | NA | 0.002 | NA |
| 7. B | Q54DY9 | Probable mitochondrial chaperone BCS1-B | 4.66e-05 | NA | 6.66e-12 | NA |
| 7. B | P59976 | ESX-2 secretion system protein EccA2 | 6.35e-04 | NA | 0.004 | NA |
| 7. B | A0KYL8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.22e-02 | NA | 6.88e-04 | NA |
| 7. B | P32839 | Mitochondrial chaperone BCS1 | 5.47e-06 | NA | 3.18e-12 | NA |
| 7. B | Q2EEX7 | ATP-dependent zinc metalloprotease FtsH homolog | 1.87e-05 | NA | 2.29e-27 | NA |
| 7. B | Q7MYC1 | ATP-dependent protease ATPase subunit HslU | 3.32e-02 | NA | 0.038 | NA |
| 7. B | P0AAZ4 | Replication-associated recombination protein A | 5.29e-04 | NA | 0.013 | NA |
| 7. B | Q0IE20 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.87e-03 | NA | 0.023 | NA |
| 7. B | B5EQ29 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 8.36e-04 | NA |
| 7. B | A3M1Y8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.94e-02 | NA | 0.002 | NA |
| 7. B | B0TLU8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.08e-02 | NA | 0.004 | NA |
| 7. B | B7MD97 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.004 | NA |
| 7. B | A6U2E2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.13e-03 | NA | 0.002 | NA |
| 7. B | O22993 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic | 4.39e-11 | NA | 8.08e-87 | NA |
| 7. B | Q13Z14 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.94e-03 | NA | 5.66e-04 | NA |
| 7. B | B0KM26 | ATP-dependent protease ATPase subunit HslU | 2.41e-02 | NA | 0.033 | NA |
| 7. B | Q66GN9 | CLP protease regulatory subunit CLPX3, mitochondrial | 9.09e-03 | NA | 0.049 | NA |
| 7. B | B5XL03 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.67e-03 | NA | 0.005 | NA |
| 7. B | P48601 | 26S proteasome regulatory subunit 4 | 3.88e-07 | NA | 6.04e-50 | NA |
| 7. B | B0S2N4 | Lon protease | 1.62e-03 | NA | 0.017 | NA |
| 7. B | A5W634 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.94e-03 | NA | 0.002 | NA |
| 7. B | B2JGL6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.21e-03 | NA | 5.19e-04 | NA |
| 7. B | A1KUJ4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.65e-02 | NA | 0.001 | NA |
| 7. B | A7Z7B2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.89e-03 | NA | 0.002 | NA |
| 7. B | Q8CGK3 | Lon protease homolog, mitochondrial | 4.91e-03 | NA | 0.018 | NA |
| 7. B | Q1BH84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.79e-03 | NA | 5.61e-04 | NA |
| 7. B | Q9ZPR1 | Cell division control protein 48 homolog B | 9.47e-07 | NA | 1.34e-45 | NA |
| 7. B | Q83DJ1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.68e-03 | NA | 0.002 | NA |
| 7. B | Q74C83 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.80e-03 | NA | 0.015 | NA |
| 7. B | C1AES4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.08e-03 | NA | 0.002 | NA |
| 7. B | A6TGC1 | ATP-dependent protease ATPase subunit HslU | 4.32e-02 | NA | 0.019 | NA |
| 7. B | Q1RF97 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.07e-02 | NA | 0.004 | NA |
| 7. B | Q15645 | Pachytene checkpoint protein 2 homolog | 3.94e-04 | NA | 5.96e-06 | NA |
| 7. B | A7FYI1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.48e-03 | NA | 0.002 | NA |
| 7. B | Q07844 | Ribosome biogenesis ATPase RIX7 | 1.01e-04 | NA | 2.97e-42 | NA |
| 7. B | Q118P6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.73e-03 | NA | 0.009 | NA |
| 7. B | Q6CNR9 | Lon protease homolog, mitochondrial | 1.08e-02 | NA | 0.013 | NA |
| 7. B | B7M6Y2 | ATP-dependent protease ATPase subunit HslU | 2.73e-02 | NA | 0.042 | NA |
| 7. B | O75449 | Katanin p60 ATPase-containing subunit A1 | 1.39e-05 | NA | 7.75e-34 | NA |
| 7. B | Q75JU2 | ATPase WRNIP1 | 1.37e-02 | NA | 0.011 | NA |
| 7. B | Q02Z22 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.87e-03 | NA | 0.007 | NA |
| 7. B | Q02KU5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.70e-03 | NA | 7.70e-04 | NA |
| 7. B | Q02EW3 | ATP-dependent protease ATPase subunit HslU | 6.60e-02 | NA | 0.040 | NA |
| 7. B | Q73I60 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.04e-02 | NA | 0.001 | NA |
| 7. B | O25926 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.40e-02 | NA | 0.003 | NA |
| 7. B | Q2RL30 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.79e-03 | NA | 3.77e-04 | NA |
| 7. B | B6J0V9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.00e-03 | NA | 0.002 | NA |
| 7. B | B9M0Y2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.00e-03 | NA | 0.016 | NA |
| 7. B | C5CIU4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.68e-05 | NA | 3.87e-04 | NA |
| 7. B | P0A6H4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-02 | NA | 0.004 | NA |
| 7. B | P9WPH7 | ESX-2 secretion system protein EccA2 | 6.69e-04 | NA | 0.003 | NA |
| 7. B | Q9M0Y8 | Vesicle-fusing ATPase | 2.31e-05 | NA | 1.63e-30 | NA |
| 7. B | Q2SWQ5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.83e-03 | NA | 5.32e-04 | NA |
| 7. B | Q9K8F4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.44e-03 | NA | 5.06e-04 | NA |
| 7. B | B1L1D6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.37e-03 | NA | 0.002 | NA |
| 7. B | Q5U2U0 | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial | 4.51e-02 | NA | 0.037 | NA |
| 7. B | Q7V993 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.19e-02 | NA | 0.042 | NA |
| 7. B | Q5N1P7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.61e-02 | NA | 0.026 | NA |
| 7. B | A4XPN6 | ATP-dependent protease ATPase subunit HslU | 6.60e-02 | NA | 0.048 | NA |
| 7. B | P62192 | 26S proteasome regulatory subunit 4 | 6.37e-07 | NA | 7.63e-50 | NA |
| 7. B | B5FBZ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.34e-02 | NA | 0.008 | NA |
| 7. B | Q5SKM7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.55e-03 | NA | 0.028 | NA |
| 7. B | Q58889 | Putative 26S proteasome regulatory subunit homolog MJ1494 | 1.13e-05 | NA | 3.32e-42 | NA |
| 7. B | B7KBH7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.22e-02 | NA | 0.012 | NA |
| 7. B | Q7V9L5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.90e-02 | NA | 0.049 | NA |
| 7. B | Q65RF7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.22e-03 | NA | 6.67e-04 | NA |
| 7. B | Q6GX84 | Fidgetin-like protein 1 | 4.08e-06 | NA | 5.20e-29 | NA |
| 7. B | B1IVE8 | ATP-dependent protease ATPase subunit HslU | 1.03e-02 | NA | 0.042 | NA |
| 7. B | Q6BKJ4 | Lon protease homolog, mitochondrial | 2.79e-02 | NA | 0.005 | NA |
| 7. B | O14114 | Uncharacterized AAA domain-containing protein C31G5.19 | 2.43e-04 | NA | 3.59e-37 | NA |
| 7. B | B7L675 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.24e-02 | NA | 0.004 | NA |
| 7. B | Q9FN78 | AAA-ATPase At5g17730 | 1.04e-04 | NA | 3.07e-09 | NA |
| 7. B | Q9CZP5 | Mitochondrial chaperone BCS1 | 1.13e-04 | NA | 4.24e-11 | NA |
| 7. B | F4KID5 | AAA-ATPase At5g17750 | 1.71e-04 | NA | 1.50e-09 | NA |
| 7. B | B0KBA3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.17e-03 | NA | 3.57e-04 | NA |
| 7. B | O84711 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.88e-03 | NA | 0.014 | NA |
| 7. B | C0M9R7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.51e-03 | NA | 0.007 | NA |
| 7. B | P52917 | Vacuolar protein sorting-associated protein 4 | 9.43e-07 | NA | 4.01e-32 | NA |
| 7. B | P36612 | 26S proteasome regulatory subunit 4 homolog | 5.07e-07 | NA | 1.56e-48 | NA |
| 7. B | B4T9E4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.32e-02 | NA | 0.004 | NA |
| 7. B | P0DKJ9 | 26S proteasome regulatory subunit 7A | 8.59e-07 | NA | 1.49e-54 | NA |
| 7. B | Q58294 | Replication factor C large subunit | 7.76e-05 | NA | 0.031 | NA |
| 7. B | Q69UZ3 | Lon protease homolog, mitochondrial | 1.35e-02 | NA | 0.008 | NA |
| 7. B | Q4ZVM6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.62e-03 | NA | 0.002 | NA |
| 7. B | Q9Y276 | Mitochondrial chaperone BCS1 | 2.89e-05 | NA | 1.59e-11 | NA |
| 7. B | A8GVR9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.32e-02 | NA | 0.003 | NA |
| 7. B | A8A737 | ATP-dependent protease ATPase subunit HslU | 1.06e-02 | NA | 0.042 | NA |
| 7. B | Q24SJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.66e-03 | NA | 0.001 | NA |
| 7. B | A8F2I3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 0.003 | NA |
| 7. B | Q87V00 | ATP-dependent protease ATPase subunit HslU | 2.83e-02 | NA | 0.050 | NA |
| 7. B | Q9SEI2 | 26S proteasome regulatory subunit 6A homolog A | 4.56e-08 | NA | 2.93e-60 | NA |
| 7. B | B8DHN7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.68e-03 | NA | 0.002 | NA |
| 7. B | A8M1K7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.22e-03 | NA | 0.015 | NA |
| 7. B | B5F0S2 | ATP-dependent protease ATPase subunit HslU | 2.57e-02 | NA | 0.043 | NA |
| 7. B | P46471 | 26S proteasome regulatory subunit 7 | 9.16e-07 | NA | 2.58e-57 | NA |
| 7. B | C6DB56 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.21e-02 | NA | 0.004 | NA |
| 7. B | Q056X2 | ATP-dependent protease ATPase subunit HslU | 4.56e-02 | NA | 0.020 | NA |
| 7. B | A8ZXB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.95e-03 | NA | 0.015 | NA |
| 7. B | Q6LNW1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.95e-03 | NA | 0.005 | NA |
| 7. B | P62334 | 26S proteasome regulatory subunit 10B | 6.31e-08 | NA | 2.38e-54 | NA |
| 7. B | Q6FPE6 | Lon protease homolog, mitochondrial | 4.27e-02 | NA | 0.048 | NA |
| 7. B | Q9ZJL8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.07e-03 | NA | 0.005 | NA |
| 7. B | Q5RII9 | Katanin p60 ATPase-containing subunit A1 | 1.11e-05 | NA | 1.37e-32 | NA |
| 7. B | Q9SEX2 | Katanin p60 ATPase-containing subunit A1 | 1.02e-05 | NA | 1.07e-31 | NA |
| 7. B | A8H613 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.13e-03 | NA | 0.004 | NA |
| 7. B | Q0SGZ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.23e-03 | NA | 0.002 | NA |
| 7. B | Q1I3T9 | ATP-dependent protease ATPase subunit HslU | 1.33e-02 | NA | 0.049 | NA |
| 7. B | Q3A3X6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.45e-03 | NA | 7.58e-04 | NA |
| 7. B | Q6CZ91 | ATP-dependent protease ATPase subunit HslU | 2.39e-02 | NA | 0.044 | NA |
| 7. B | O16299 | Fidgetin-like protein 1 | 3.26e-05 | NA | 1.00e-27 | NA |
| 7. B | B3QWK0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.57e-03 | NA | 7.63e-04 | NA |
| 7. B | Q48PI5 | ATP-dependent protease ATPase subunit HslU | 5.61e-02 | NA | 0.049 | NA |
| 7. B | F3YDF1 | ATP-dependent zinc metalloprotease YME1L | 6.59e-14 | NA | 7.58e-120 | NA |
| 7. B | B7H092 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.43e-02 | NA | 0.002 | NA |
| 7. B | A3NAI4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.75e-03 | NA | 3.82e-04 | NA |
| 7. B | Q6AK60 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.38e-03 | NA | 0.001 | NA |
| 7. B | A7FLC3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.26e-03 | NA | 0.004 | NA |
| 7. B | Q04A05 | ATP-dependent protease ATPase subunit HslU | 6.00e-02 | NA | 0.008 | NA |
| 7. B | Q9D5T0 | Outer mitochondrial transmembrane helix translocase | 3.84e-10 | NA | 1.69e-36 | NA |
| 7. B | Q54YV4 | Lon protease homolog, mitochondrial 1 | 1.24e-02 | NA | 4.06e-05 | NA |
| 7. B | Q75JI3 | Vesicle-fusing ATPase | 1.85e-04 | NA | 2.73e-28 | NA |
| 7. B | Q59HJ6 | Lon protease homolog, mitochondrial | 1.15e-02 | NA | 0.008 | NA |
| 7. B | B7NU74 | ATP-dependent protease ATPase subunit HslU | 3.96e-02 | NA | 0.041 | NA |
| 7. B | Q9PIM0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.97e-03 | NA | 0.021 | NA |
| 7. B | A3QFX5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.24e-03 | NA | 0.002 | NA |
| 7. B | B3CQC6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 0.001 | NA |
| 7. B | B1J010 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.04e-02 | NA | 0.004 | NA |
| 7. B | Q9JHS4 | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial | 5.43e-02 | NA | 0.043 | NA |
| 7. B | P33760 | Peroxisomal ATPase PEX6 | 1.08e-03 | NA | 6.41e-42 | NA |
| 7. B | Q5FFG6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.38e-02 | NA | 0.028 | NA |
| 7. B | Q9M9L8 | Lon protease homolog 3, mitochondrial | 3.78e-03 | NA | 0.008 | NA |
| 7. B | Q6FEP7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.91e-03 | NA | 0.001 | NA |
| 7. B | Q32836 | Protein Ycf2 | 3.23e-01 | NA | 0.003 | NA |
| 7. B | Q0I4F0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.60e-02 | NA | 3.51e-04 | NA |
| 7. B | A8MIS7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.72e-03 | NA | 3.71e-04 | NA |
| 7. B | P34808 | Meiotic spindle formation protein mei-1 | 9.46e-09 | NA | 5.94e-24 | NA |
| 7. B | Q9KQS7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.16e-02 | NA | 0.008 | NA |
| 7. B | Q8VEJ9 | Vacuolar protein sorting-associated protein 4A | 2.08e-05 | NA | 1.53e-32 | NA |
| 7. B | B7I5E4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.94e-02 | NA | 0.002 | NA |
| 7. B | A6T5I1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.20e-02 | NA | 0.004 | NA |
| 7. B | A6NMB9 | Fidgetin-like protein 2 | 1.25e-04 | NA | 6.59e-13 | NA |
| 7. B | Q72SG5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.13e-03 | NA | 8.45e-05 | NA |
| 7. B | Q87E50 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.14e-03 | NA | 6.59e-04 | NA |
| 7. B | Q65VY1 | ATP-dependent protease ATPase subunit HslU | 2.35e-02 | NA | 0.045 | NA |
| 7. B | Q5T9A4 | ATPase family AAA domain-containing protein 3B | 4.11e-05 | NA | 4.77e-11 | NA |
| 7. B | P41836 | 26S proteasome regulatory subunit 8 homolog | 3.14e-08 | NA | 2.25e-51 | NA |
| 7. B | B0V4T7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.33e-02 | NA | 0.002 | NA |
| 7. B | P62195 | 26S proteasome regulatory subunit 8 | 3.47e-08 | NA | 7.90e-55 | NA |
| 7. B | P46460 | Vesicle-fusing ATPase | 2.35e-04 | NA | 7.38e-30 | NA |
| 7. B | A4IRH2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.91e-03 | NA | 4.95e-04 | NA |
| 7. B | Q1Q8J1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.07e-02 | NA | 0.002 | NA |
| 7. B | A9R6C7 | ATP-dependent protease ATPase subunit HslU | 3.95e-02 | NA | 0.046 | NA |
| 7. B | Q5XCM0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.68e-03 | NA | 0.005 | NA |
| 7. B | Q1CL64 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.08e-02 | NA | 0.004 | NA |
| 7. B | B5Z3U5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.07e-02 | NA | 0.004 | NA |
| 7. B | Q6HD54 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.82e-03 | NA | 0.002 | NA |
| 7. B | Q3K0K0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.77e-03 | NA | 0.005 | NA |
| 7. B | Q9SSB5 | 26S proteasome regulatory subunit 7 homolog A | 7.19e-07 | NA | 5.71e-55 | NA |
| 7. B | A1BE59 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.08e-02 | NA | 0.022 | NA |
| 7. B | B5EI28 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.67e-03 | NA | 0.006 | NA |
| 7. B | B1XB97 | ATP-dependent protease ATPase subunit HslU | 3.58e-02 | NA | 0.042 | NA |
| 7. B | C3KU76 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.60e-03 | NA | 0.002 | NA |
| 7. B | Q7S8C4 | Lon protease homolog, mitochondrial | 6.99e-03 | NA | 0.041 | NA |
| 7. B | A0L1J9 | ATP-dependent protease ATPase subunit HslU | 8.42e-02 | NA | 0.036 | NA |
| 7. B | Q7VP79 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.13e-02 | NA | 0.003 | NA |
| 7. B | A3CMV1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.67e-03 | NA | 0.016 | NA |
| 7. B | A9WUW1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.01e-02 | NA | 0.003 | NA |
| 7. B | P54777 | Peroxisome assembly factor 2 | 4.57e-05 | NA | 4.73e-36 | NA |
| 7. B | Q9LH84 | AAA-ATPase At3g28510 | 6.05e-05 | NA | 2.81e-07 | NA |
| 7. B | A4XTZ6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.53e-03 | NA | 0.002 | NA |
| 7. B | P24004 | Peroxisomal ATPase PEX1 | 6.06e-04 | NA | 6.45e-39 | NA |
| 7. B | A1SME0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.20e-03 | NA | 0.003 | NA |
| 7. B | A4Y5I3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.19e-02 | NA | 5.83e-04 | NA |
| 7. B | Q3SI99 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.30e-03 | NA | 0.002 | NA |
| 7. B | O88685 | 26S proteasome regulatory subunit 6A | 7.33e-08 | NA | 1.40e-60 | NA |
| 7. B | P39955 | Protein SAP1 | 4.58e-05 | NA | 2.26e-26 | NA |
| 7. B | B2GGB7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.64e-03 | NA | 0.001 | NA |
| 7. B | P62196 | 26S proteasome regulatory subunit 8 | 3.46e-08 | NA | 7.90e-55 | NA |
| 7. B | B0K532 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.46e-03 | NA | 3.16e-04 | NA |
| 7. B | Q9P6Q3 | Probable mitochondrial chaperone bcs1 | 4.46e-05 | NA | 2.03e-12 | NA |
| 7. B | Q2JDQ7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.49e-02 | NA | 4.13e-04 | NA |
| 7. B | Q32065 | Uncharacterized 341.7 kDa protein in psbD-psbC intergenic region | NA | NA | 0.002 | NA |
| 7. B | B7FSL4 | Lon protease homolog, mitochondrial | 3.54e-03 | NA | 0.020 | NA |
| 7. B | Q54SY2 | Putative ribosome biogenesis ATPase nvl | 1.61e-06 | NA | 2.51e-43 | NA |
| 7. B | A8G7G2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.08e-02 | NA | 0.031 | NA |
| 7. B | A1JNN1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.55e-03 | NA | 0.006 | NA |
| 7. B | Q8EG18 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.32e-02 | NA | 6.09e-04 | NA |
| 7. B | P0A529 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.04e-03 | NA | 0.002 | NA |
| 7. B | Q87R79 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 0.009 | NA |
| 7. B | P33299 | 26S proteasome regulatory subunit 7 homolog | 9.64e-07 | NA | 1.91e-58 | NA |
| 7. B | A9MZI1 | ATP-dependent protease ATPase subunit HslU | 2.53e-02 | NA | 0.043 | NA |
| 7. B | B7GH25 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.38e-03 | NA | 3.58e-04 | NA |
| 7. B | Q8E4L8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.12e-03 | NA | 0.005 | NA |
| 7. B | P54775 | 26S proteasome regulatory subunit 6B | 2.22e-11 | NA | 6.07e-51 | NA |
| 7. B | O04019 | 26S proteasome regulatory subunit 6A homolog B | 4.27e-08 | NA | 1.08e-57 | NA |
| 7. B | P36775 | Lon protease homolog, mitochondrial | 5.50e-02 | NA | 0.013 | NA |
| 7. B | B2A159 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.77e-03 | NA | 0.001 | NA |
| 7. B | Q9LJJ7 | AAA-ATPase At3g28580 | 1.68e-04 | NA | 3.51e-09 | NA |
| 7. B | A3MKJ7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.60e-03 | NA | 0.004 | NA |
| 7. B | P0A6H2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.21e-02 | NA | 0.004 | NA |
| 7. B | P34124 | 26S proteasome regulatory subunit 8 | 3.50e-08 | NA | 2.53e-50 | NA |
| 7. B | Q3V4U3 | Uncharacterized protein ORF529 | NA | NA | 0.001 | NA |
| 7. B | C0MEW5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.25e-03 | NA | 0.006 | NA |
| 7. B | Q8TZC5 | Replication factor C large subunit | 1.81e-04 | NA | 0.036 | NA |
| 7. B | Q5M5B0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.61e-03 | NA | 0.011 | NA |
| 7. B | B7LUS3 | ATP-dependent protease ATPase subunit HslU | 2.66e-02 | NA | 0.043 | NA |
| 7. B | O34126 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.89e-03 | NA | 0.026 | NA |
| 7. B | Q01939 | 26S proteasome regulatory subunit 8 homolog | 3.51e-08 | NA | 1.43e-55 | NA |
| 7. B | Q2JLU2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.25e-02 | NA | 0.044 | NA |
| 7. B | Q7XK25 | Pachytene checkpoint protein 2 homolog | 1.28e-03 | NA | 9.32e-08 | NA |
| 7. B | Q9Y265 | RuvB-like 1 | 9.45e-03 | NA | 0.032 | NA |
| 7. B | A3NWA5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.59e-03 | NA | 3.82e-04 | NA |
| 7. B | P57548 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 4.29e-04 | NA |
| 7. B | B3QPN4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.42e-03 | NA | 0.007 | NA |
| 7. B | Q9UN37 | Vacuolar protein sorting-associated protein 4A | 2.09e-05 | NA | 3.32e-33 | NA |
| 7. B | Q1CBE8 | ATP-dependent protease ATPase subunit HslU | 3.78e-02 | NA | 0.046 | NA |
| 7. B | Q982V5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.61e-03 | NA | 0.046 | NA |
| 7. B | Q9UBP0 | Spastin | 2.46e-06 | NA | 3.11e-29 | NA |
| 7. B | Q92C84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.42e-03 | NA | 0.002 | NA |
| 7. B | Q8MNV0 | Spastin homolog | 1.04e-05 | NA | 1.85e-30 | NA |
| 7. B | Q74JJ5 | ATP-dependent protease ATPase subunit HslU | 3.57e-02 | NA | 0.042 | NA |
| 7. B | C5D5L4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.10e-03 | NA | 4.74e-04 | NA |
| 7. B | A2BTN8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.42e-02 | NA | 0.032 | NA |
| 7. B | Q8PBY5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.61e-03 | NA | 6.38e-04 | NA |
| 7. B | A1SUW8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.54e-03 | NA | 6.99e-04 | NA |
| 7. B | Q5XIK7 | Katanin p60 ATPase-containing subunit A-like 1 | 6.39e-06 | NA | 3.78e-35 | NA |
| 7. B | Q9XTT9 | 26S proteasome regulatory subunit 8 | 3.79e-08 | NA | 2.78e-58 | NA |
| 7. B | B6JGU8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.47e-03 | NA | 0.030 | NA |
| 7. B | C5BB81 | ATP-dependent protease ATPase subunit HslU | 1.30e-02 | NA | 0.049 | NA |
| 7. B | B1YJW0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.34e-03 | NA | 4.50e-04 | NA |
| 7. B | A2RF17 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.62e-03 | NA | 0.005 | NA |
| 7. B | A0JXL2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.07e-02 | NA | 0.002 | NA |
| 7. B | A8GTC4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.14e-03 | NA | 0.006 | NA |
| 7. B | F4J0C0 | AAA-ATPase At3g28600 | 8.25e-05 | NA | 5.83e-10 | NA |
| 7. B | Q8YQX7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.06e-02 | NA | 0.026 | NA |
| 7. B | Q07ZX9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 5.83e-04 | NA |
| 7. B | Q5HF98 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.46e-03 | NA | 0.002 | NA |
| 7. B | A8L1X0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.27e-02 | NA | 5.34e-04 | NA |
| 7. B | Q8NN26 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.14e-03 | NA | 0.012 | NA |
| 7. B | Q55510 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.36e-02 | NA | 0.034 | NA |
| 7. B | B1J2T7 | ATP-dependent protease ATPase subunit HslU | 2.62e-02 | NA | 0.028 | NA |
| 7. B | Q0TAD3 | ATP-dependent protease ATPase subunit HslU | 3.92e-02 | NA | 0.041 | NA |
| 7. B | Q9KNQ7 | ATP-dependent protease ATPase subunit HslU | 2.29e-02 | NA | 0.014 | NA |
| 7. B | P0CAU2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.92e-03 | NA | 0.011 | NA |
| 7. B | Q39FE9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.91e-03 | NA | 5.61e-04 | NA |
| 7. B | A2YQ56 | Lon protease homolog, mitochondrial | 1.33e-02 | NA | 0.009 | NA |
| 7. B | Q9BW62 | Katanin p60 ATPase-containing subunit A-like 1 | 8.71e-06 | NA | 7.50e-35 | NA |
| 7. B | Q9WV86 | Katanin p60 ATPase-containing subunit A1 | 4.73e-05 | NA | 1.12e-32 | NA |
| 7. B | A4JF04 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.46e-03 | NA | 5.51e-04 | NA |
| 7. B | B9MG15 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.52e-03 | NA | 0.002 | NA |
| 7. B | Q1RJ84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 0.003 | NA |
| 7. B | Q54PN7 | 26S proteasome regulatory subunit 6A homolog | 3.76e-08 | NA | 2.30e-59 | NA |
| 7. B | Q5PFN5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.004 | NA |
| 7. B | P84578 | ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragments) | 8.75e-01 | NA | 0.009 | NA |
| 7. B | A6VL81 | ATP-dependent protease ATPase subunit HslU | 2.03e-02 | NA | 0.042 | NA |
| 7. B | P63790 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.76e-03 | NA | 0.002 | NA |
| 7. B | Q0RPH1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.73e-03 | NA | 3.98e-04 | NA |
| 7. B | C0Q441 | ATP-dependent protease ATPase subunit HslU | 3.38e-02 | NA | 0.043 | NA |
| 7. B | Q9FLD5 | AAA-ATPase ASD, mitochondrial | 5.34e-05 | NA | 2.41e-07 | NA |
| 7. B | P9WQN5 | Proteasome-associated ATPase | 4.47e-04 | NA | 2.96e-29 | NA |
| 7. B | B2IA20 | ATP-dependent protease ATPase subunit HslU | 2.54e-02 | NA | 0.044 | NA |
| 7. B | A1UJ35 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.09e-03 | NA | 0.002 | NA |
| 7. B | Q73M37 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.41e-03 | NA | 5.30e-04 | NA |
| 7. B | A5N2K7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.83e-03 | NA | 0.007 | NA |
| 7. B | B3R4W2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.75e-03 | NA | 3.52e-04 | NA |
| 7. B | Q8PNI4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.25e-03 | NA | 5.51e-04 | NA |
| 7. B | Q5Z061 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.80e-03 | NA | 0.002 | NA |
| 7. B | Q9C5U3 | 26S proteasome regulatory subunit 8 homolog A | 4.51e-08 | NA | 1.01e-55 | NA |
| 7. B | Q09803 | Suppressor protein of bem1/bed5 double mutants | 2.00e-07 | NA | 5.21e-31 | NA |
| 7. B | B2RYN7 | Spastin | 3.90e-06 | NA | 2.47e-29 | NA |
| 7. B | B2JZC5 | ATP-dependent protease ATPase subunit HslU | 1.94e-02 | NA | 0.046 | NA |
| 7. B | P9WPB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.96e-03 | NA | 0.002 | NA |
| 7. B | A7MFI7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 0.004 | NA |
| 7. B | P40328 | Probable 26S proteasome subunit YTA6 | 2.48e-06 | NA | 1.52e-28 | NA |
| 7. B | A9NDF9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.27e-03 | NA | 0.002 | NA |
| 7. B | Q8H1F9 | Pachytene checkpoint protein 2 homolog | 9.93e-04 | NA | 8.16e-06 | NA |
| 7. B | Q54KQ7 | Spastin | 4.56e-07 | NA | 9.19e-27 | NA |
| 7. B | B5RMG2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.21e-03 | NA | 0.001 | NA |
| 7. B | B2IR87 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-03 | NA | 0.012 | NA |
| 7. B | P46467 | Vacuolar protein sorting-associated protein 4B | 6.54e-06 | NA | 1.60e-31 | NA |
| 7. B | Q0SY58 | ATP-dependent protease ATPase subunit HslU | 2.60e-02 | NA | 0.042 | NA |
| 7. B | Q3M727 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.65e-02 | NA | 0.024 | NA |
| 7. B | A1K782 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.82e-03 | NA | 5.80e-04 | NA |
| 7. B | Q9NAG4 | Protein mac-1 | 4.94e-05 | NA | 2.65e-40 | NA |
| 7. B | A4SM43 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.24e-02 | NA | 0.005 | NA |
| 7. B | F4IQG2 | AAA-ATPase At2g18190 | 4.31e-05 | NA | 2.96e-07 | NA |
| 7. B | B1IND6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.02e-03 | NA | 0.002 | NA |
| 7. B | Q18787 | 26S proteasome regulatory subunit 7 | 7.31e-07 | NA | 3.47e-58 | NA |
| 7. B | Q2NV78 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.18e-03 | NA | 0.005 | NA |
| 7. B | B7J791 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.82e-03 | NA | 8.36e-04 | NA |
| 7. B | A3M072 | Lon protease homolog, mitochondrial (Fragment) | 1.86e-02 | NA | 0.005 | NA |
| 7. B | B0BSG4 | ATP-dependent protease ATPase subunit HslU | 1.93e-02 | NA | 0.041 | NA |
| 7. B | P63792 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.97e-03 | NA | 0.037 | NA |
| 7. B | Q89AA0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.46e-03 | NA | 2.54e-04 | NA |
| 7. B | A8FTI0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.38e-03 | NA | 0.002 | NA |
| 7. B | A7HK39 | Lon protease | 2.00e-03 | NA | 0.002 | NA |
| 7. B | O69177 | Lon protease | 1.40e-02 | NA | 0.039 | NA |
| 7. B | A8AXB9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.69e-03 | NA | 0.016 | NA |
| 7. B | Q0TQK3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.70e-03 | NA | 0.002 | NA |
| 7. B | Q8NB90 | ATPase family protein 2 homolog | 1.87e-05 | NA | 5.83e-49 | NA |
| 7. B | Q0AQ06 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.70e-03 | NA | 0.038 | NA |
| 7. B | Q8Z2Z0 | ATP-dependent protease ATPase subunit HslU | 2.47e-02 | NA | 0.042 | NA |
| 7. B | C1FLA5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.44e-03 | NA | 0.002 | NA |
| 7. B | Q3JAJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.44e-03 | NA | 0.004 | NA |
| 7. B | P46465 | 26S proteasome regulatory subunit 6A homolog | 5.68e-08 | NA | 9.41e-60 | NA |
| 7. B | P62191 | 26S proteasome regulatory subunit 4 | 6.73e-07 | NA | 7.63e-50 | NA |
| 7. B | Q5H433 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.14e-03 | NA | 5.51e-04 | NA |
| 7. B | Q3SRD3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.14e-03 | NA | 0.032 | NA |
| 7. B | Q2Y6J1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.87e-03 | NA | 4.94e-04 | NA |
| 7. B | Q5LUP9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.42e-03 | NA | 0.030 | NA |
| 7. B | P54351 | Vesicle-fusing ATPase 2 | 6.64e-05 | NA | 6.42e-31 | NA |
| 7. B | B7M3T1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.46e-02 | NA | 0.004 | NA |
| 7. B | Q57HC6 | ATP-dependent protease ATPase subunit HslU | 2.73e-02 | NA | 0.043 | NA |
| 7. B | Q6A7F1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.48e-03 | NA | 0.002 | NA |
| 7. B | O16368 | Probable 26S proteasome regulatory subunit 4 | 2.41e-06 | NA | 2.33e-50 | NA |
| 7. B | Q0A6A8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.44e-03 | NA | 7.96e-04 | NA |
| 7. B | Q1R3Y6 | ATP-dependent protease ATPase subunit HslU | 3.78e-02 | NA | 0.041 | NA |
| 7. B | C3LNM5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.008 | NA |
| 7. B | P45262 | Replication-associated recombination protein A | 8.56e-04 | NA | 0.036 | NA |
| 7. B | Q21222 | ATPase family protein 2 homolog | 6.18e-06 | NA | 1.00e-50 | NA |
| 7. B | O51557 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.25e-03 | NA | 2.51e-04 | NA |
| 7. B | Q9FN77 | AAA-ATPase At5g17740 | 1.19e-04 | NA | 1.93e-07 | NA |
| 7. B | Q2RU44 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.34e-03 | NA | 0.031 | NA |
| 7. B | B1LJJ5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.03e-02 | NA | 0.004 | NA |
| 7. B | Q924S5 | Lon protease homolog, mitochondrial | 6.35e-03 | NA | 0.022 | NA |
| 7. B | A6VME2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.28e-03 | NA | 7.78e-04 | NA |
| 7. B | B1Y6H2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.35e-03 | NA | 0.001 | NA |
| 7. B | Q5HNM9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.31e-03 | NA | 0.002 | NA |
| 7. B | B5YE53 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.60e-03 | NA | 0.021 | NA |
| 7. B | A4Y2S7 | ATP-dependent protease ATPase subunit HslU | 3.40e-02 | NA | 0.044 | NA |
| 7. B | Q7VGY5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 0.009 | NA |
| 7. B | Q8RY66 | AAA-ATPase At4g25835 | 5.06e-04 | NA | 5.99e-09 | NA |
| 7. B | Q9PLM1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.33e-03 | NA | 0.015 | NA |
| 7. B | Q5UQE0 | Putative AAA family ATPase R476 | NA | NA | 2.01e-28 | NA |
| 7. B | B4TCM8 | ATP-dependent protease ATPase subunit HslU | 3.70e-02 | NA | 0.043 | NA |
| 7. B | B1HVE5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.22e-02 | NA | 0.004 | NA |
| 7. B | A7ZIJ6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.004 | NA |
| 7. B | P63789 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.20e-03 | NA | 0.002 | NA |
| 7. B | P45219 | ATP-dependent zinc metalloprotease FtsH homolog | 0.00e+00 | NA | 2.30e-81 | NA |
| 7. B | Q3B0U2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.70e-02 | NA | 0.025 | NA |
| 7. B | Q8ZC66 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.16e-02 | NA | 0.004 | NA |
| 7. B | Q9XW87 | Lon protease homolog 2, peroxisomal | 8.93e-03 | NA | 0.020 | NA |
| 7. B | Q07WM2 | ATP-dependent protease ATPase subunit HslU | 2.47e-02 | NA | 0.042 | NA |
| 7. B | Q89WN2 | ATP-dependent protease ATPase subunit HslU | 2.83e-02 | NA | 0.045 | NA |
| 7. B | A8GAR0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.15e-02 | NA | 0.005 | NA |
| 7. B | Q6MGP8 | Lon protease 2 | 3.39e-03 | NA | 0.015 | NA |
| 7. B | B4TPV2 | ATP-dependent protease ATPase subunit HslU | 3.71e-02 | NA | 0.043 | NA |
| 7. B | Q1QL77 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.52e-03 | NA | 0.030 | NA |
| 7. B | P62333 | 26S proteasome regulatory subunit 10B | 4.20e-08 | NA | 2.38e-54 | NA |
| 7. B | B4EBM2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.71e-03 | NA | 5.61e-04 | NA |
| 7. B | A7X396 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.80e-03 | NA | 0.002 | NA |
| 7. B | C4L9W9 | ATP-dependent protease ATPase subunit HslU | 4.34e-02 | NA | 0.016 | NA |
| 7. B | C1L2H6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.86e-03 | NA | 0.002 | NA |
| 7. B | B2U4P3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.11e-02 | NA | 0.004 | NA |
| 7. B | Q503W7 | Outer mitochondrial transmembrane helix translocase | 4.09e-09 | NA | 3.18e-35 | NA |
| 7. B | Q1LTK0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.76e-03 | NA | 0.003 | NA |
| 7. B | Q86XH1 | Dynein regulatory complex protein 11 | 3.30e-04 | NA | 1.06e-04 | NA |
| 7. B | C6C0P1 | ATP-dependent protease ATPase subunit HslU | 2.49e-02 | NA | 0.020 | NA |
| 7. B | B1J693 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.81e-03 | NA | 0.002 | NA |
| 7. B | A9MWX5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.30e-02 | NA | 0.004 | NA |
| 7. B | Q5X452 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.02e-03 | NA | 0.001 | NA |
| 7. B | A0LDT3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.22e-03 | NA | 1.93e-04 | NA |
| 7. B | Q9ULI0 | ATPase family AAA domain-containing protein 2B | 2.84e-03 | NA | 1.06e-35 | NA |
| 7. B | C4LDB4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.04e-02 | NA | 0.003 | NA |
| 7. B | B5FKV4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.13e-02 | NA | 0.004 | NA |
| 7. B | D3K5L7 | Pachytene checkpoint protein 2 homolog | 6.29e-04 | NA | 4.38e-06 | NA |
| 7. B | Q8G5R1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.58e-02 | NA | 3.36e-04 | NA |
| 7. B | A7ILC7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.87e-03 | NA | 0.030 | NA |
| 7. B | Q3KRE0 | ATPase family AAA domain-containing protein 3 | 2.10e-05 | NA | 2.58e-09 | NA |
| 7. B | Q2L255 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.15e-02 | NA | 4.78e-04 | NA |
| 7. B | Q820F8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.52e-03 | NA | 3.66e-04 | NA |
| 7. B | B2I3C2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.17e-02 | NA | 0.002 | NA |
| 7. B | A5U9Z5 | ATP-dependent protease ATPase subunit HslU | 2.43e-02 | NA | 0.030 | NA |
| 7. B | Q54GX5 | Peroxisome biogenesis factor 1 | 2.37e-04 | NA | 1.87e-42 | NA |
| 7. B | A9AJR1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.74e-03 | NA | 5.28e-04 | NA |
| 7. B | Q2NDC1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.33e-03 | NA | 0.004 | NA |
| 7. B | Q9LP11 | AAA-ATPase At1g43910 | 4.00e-05 | NA | 3.10e-07 | NA |
| 7. B | B7LA28 | ATP-dependent protease ATPase subunit HslU | 3.99e-02 | NA | 0.042 | NA |
| 7. B | B4U360 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.18e-03 | NA | 0.006 | NA |
| 7. B | Q58576 | Proteasome-activating nucleotidase | 1.90e-11 | NA | 1.23e-66 | NA |
| 7. B | A4XHW1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.63e-03 | NA | 0.005 | NA |
| 7. B | C4L4J1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.53e-03 | NA | 3.82e-04 | NA |
| 7. B | Q0T7E5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 0.004 | NA |
| 7. B | A3LUF7 | Lon protease homolog 2, peroxisomal | 3.08e-02 | NA | 0.005 | NA |
| 7. B | A5ID16 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.57e-03 | NA | 8.90e-04 | NA |
| 7. B | Q2GJB5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.33e-02 | NA | 0.044 | NA |
| 7. B | B2IT91 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.55e-03 | NA | 0.038 | NA |
| 7. B | Q0DGP6 | Vesicle-fusing ATPase | 3.34e-05 | NA | 1.81e-31 | NA |
| 7. B | Q9ZJL3 | Lon protease | 2.92e-03 | NA | 0.005 | NA |
| 7. B | Q1D801 | ATP-dependent protease ATPase subunit HslU | 4.64e-02 | NA | 0.008 | NA |
| 7. B | Q8GW96 | AAA-ATPase At2g18193 | 5.43e-05 | NA | 6.13e-10 | NA |
| 7. B | Q94BQ2 | 26S proteasome regulatory subunit 8 homolog B | 4.26e-08 | NA | 1.68e-55 | NA |
| 7. B | B6ISY6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.83e-03 | NA | 0.048 | NA |
| 7. B | A8FFV9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.52e-03 | NA | 0.001 | NA |
| 7. B | Q7WK82 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.82e-03 | NA | 6.01e-04 | NA |
| 7. B | Q2SK35 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.85e-03 | NA | 8.34e-04 | NA |
| 7. B | B8GNT9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.96e-03 | NA | 7.49e-04 | NA |
| 7. B | F4J0B7 | AAA-ATPase At3g28570, mitochondrial | 1.09e-04 | NA | 2.66e-06 | NA |
| 7. B | O33873 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.23e-02 | NA | 0.006 | NA |
| 7. B | F4IAE9 | ATPase family AAA domain-containing protein At1g05910 | 1.15e-04 | NA | 1.86e-37 | NA |
| 7. B | P54815 | Mitochondrial sorting homolog | 8.04e-12 | NA | 1.39e-30 | NA |
| 7. B | Q5GS84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.98e-03 | NA | 2.74e-04 | NA |
| 7. B | Q8K0T4 | Katanin p60 ATPase-containing subunit A-like 1 | 7.00e-06 | NA | 1.82e-34 | NA |
| 7. B | B5EXI9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-02 | NA | 0.004 | NA |
| 7. B | Q4L715 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.15e-03 | NA | 0.002 | NA |
| 7. B | Q1H1F9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.00e-03 | NA | 0.003 | NA |
| 7. B | Q12LA2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.78e-03 | NA | 5.99e-04 | NA |
| 7. B | O76371 | 26S protease regulatory subunit 6A | 3.31e-08 | NA | 4.36e-57 | NA |
| 7. B | A1A8A7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.29e-02 | NA | 0.004 | NA |
| 7. B | F4JEX5 | ATPase family AAA domain-containing protein FIGL1 | 2.46e-05 | NA | 2.38e-30 | NA |
| 7. B | A7ZUE6 | ATP-dependent protease ATPase subunit HslU | 2.66e-02 | NA | 0.042 | NA |
| 7. B | B4SEI4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.83e-02 | NA | 0.024 | NA |
| 7. B | Q9SSB4 | 26S proteasome regulatory subunit 7 homolog B | 2.48e-06 | NA | 1.10e-51 | NA |
| 7. B | P0A6H3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 0.004 | NA |
| 7. B | Q9LJJ5 | AAA-ATPase At3g28610 | 5.89e-05 | NA | 4.97e-08 | NA |
| 7. B | Q2GD18 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.75e-03 | NA | 0.001 | NA |
| 7. B | Q8RC24 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.70e-03 | NA | 0.001 | NA |
| 7. B | Q63570 | 26S proteasome regulatory subunit 6B | 2.34e-11 | NA | 6.07e-51 | NA |
| 7. B | P0AAZ6 | Replication-associated recombination protein A | 3.22e-04 | NA | 0.013 | NA |
| 7. B | B6I4S4 | ATP-dependent protease ATPase subunit HslU | 2.62e-02 | NA | 0.042 | NA |
| 7. B | A1V4X0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.84e-03 | NA | 0.004 | NA |
| 7. B | Q87YR7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.60e-03 | NA | 0.002 | NA |
| 7. B | F4JPK8 | AAA-ATPase At4g30250 | 5.38e-05 | NA | 2.22e-06 | NA |
| 7. B | Q4FQB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.13e-02 | NA | 0.002 | NA |
| 7. B | Q20748 | ATPase family AAA domain-containing protein 3 | 6.61e-06 | NA | 5.83e-13 | NA |
| 7. B | B3Q7P4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.14e-03 | NA | 0.023 | NA |
| 7. B | A7ML81 | ATP-dependent protease ATPase subunit HslU | 4.08e-02 | NA | 0.050 | NA |
| 7. B | Q8ZJJ5 | ATP-dependent protease ATPase subunit HslU | 3.68e-02 | NA | 0.046 | NA |
| 7. B | Q7VRH0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.62e-03 | NA | 0.009 | NA |
| 7. B | Q6P4W8 | Pachytene checkpoint protein 2 homolog | 5.89e-04 | NA | 2.67e-05 | NA |
| 7. B | Q63V40 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.45e-03 | NA | 3.82e-04 | NA |
| 7. B | Q0HTK8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-02 | NA | 6.36e-04 | NA |
| 7. B | Q9ZCN1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.47e-03 | NA | 0.002 | NA |
| 7. B | A1AIA6 | ATP-dependent protease ATPase subunit HslU | 4.21e-02 | NA | 0.041 | NA |
| 7. B | Q660R1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.82e-02 | NA | 2.30e-04 | NA |
| 7. B | Q0C0G0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.39e-03 | NA | 0.034 | NA |
| 7. B | P43773 | ATP-dependent protease ATPase subunit HslU | 1.99e-02 | NA | 0.028 | NA |
| 7. B | P53549 | 26S proteasome subunit RPT4 | 2.10e-07 | NA | 2.62e-48 | NA |
| 7. B | A2QCJ2 | Lon protease homolog, mitochondrial | 1.25e-02 | NA | 0.017 | NA |
| 7. B | Q9WXZ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.41e-03 | NA | 0.006 | NA |
| 7. B | Q88KI9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.63e-03 | NA | 0.002 | NA |
| 7. B | Q9SL67 | 26S proteasome regulatory subunit 4 homolog B | 2.45e-06 | NA | 7.42e-51 | NA |
| 7. B | A7MV82 | ATP-dependent Clp protease ATP-binding subunit ClpX | 8.91e-03 | NA | 0.009 | NA |
| 7. B | Q5E6Q4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.17e-02 | NA | 0.009 | NA |
| 7. B | P0DTF4 | CD-NTase-associated protein 6 | 2.91e-11 | NA | 4.21e-07 | NA |
| 7. B | Q0I5E0 | ATP-dependent protease ATPase subunit HslU | 1.86e-02 | NA | 0.021 | NA |
| 7. B | P0DKK0 | 26S proteasome regulatory subunit 7B | 7.26e-07 | NA | 1.49e-54 | NA |
| 7. B | Q317Y5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.01e-01 | NA | 0.030 | NA |
| 7. B | P93431 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 1.59e-03 | NA | 0.032 | NA |
| 7. B | A4G5X0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.59e-02 | NA | 7.39e-04 | NA |
| 7. B | P9WPH6 | ESX-2 secretion system protein EccA2 | 6.57e-04 | NA | 0.004 | NA |
| 7. B | Q0TKK3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.33e-02 | NA | 0.004 | NA |
| 7. B | P18759 | Vesicular-fusion protein SEC18 | 2.23e-04 | NA | 9.40e-30 | NA |
| 7. B | B0RTF5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.28e-03 | NA | 6.38e-04 | NA |
| 7. B | F4KFX5 | AAA-ATPase At5g40000 | 2.81e-05 | NA | 9.43e-10 | NA |
| 7. B | O64301 | Sliding-clamp-loader large subunit | NA | NA | 2.53e-04 | NA |
| 7. B | Q1CD55 | ATP-dependent protease ATPase subunit HslU | 1.88e-02 | NA | 0.046 | NA |
| 7. B | Q8K989 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 1.79e-04 | NA |
| 7. B | A9M020 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.14e-02 | NA | 0.001 | NA |
| 7. B | Q92GQ4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.10e-03 | NA | 0.002 | NA |
| 7. B | Q96TA2 | ATP-dependent zinc metalloprotease YME1L1 | 3.18e-12 | NA | 1.33e-125 | NA |
| 7. B | Q7VUJ9 | ATP-dependent protease ATPase subunit HslU | 2.10e-02 | NA | 0.038 | NA |
| 7. B | P60123 | RuvB-like 1 | 9.53e-03 | NA | 0.033 | NA |
| 7. B | Q66G85 | ATP-dependent protease ATPase subunit HslU | 4.32e-02 | NA | 0.046 | NA |
| 7. B | Q8XYP6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.72e-03 | NA | 6.23e-04 | NA |
| 7. B | Q8GJP6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.20e-03 | NA | 0.009 | NA |
| 7. B | O60058 | ATPase family gene 2 protein | 7.96e-07 | NA | 6.14e-48 | NA |
| 7. B | Q72CE7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.23e-03 | NA | 0.014 | NA |
| 7. B | P46459 | Vesicle-fusing ATPase | 2.84e-04 | NA | 8.00e-30 | NA |
| 7. B | F4J3N2 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic | 2.73e-08 | NA | 1.06e-37 | NA |
| 7. B | B1VXA8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.93e-03 | NA | 4.02e-04 | NA |
| 7. B | Q6PIW4 | Fidgetin-like protein 1 | 1.54e-05 | NA | 5.19e-29 | NA |
| 7. B | B9MQ33 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.79e-03 | NA | 0.003 | NA |
| 7. B | Q9JYY3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.89e-02 | NA | 0.001 | NA |
| 7. B | Q3B5I8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.20e-03 | NA | 0.011 | NA |
| 7. B | B0VKU4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.71e-02 | NA | 0.002 | NA |
| 7. B | A1RL88 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.26e-02 | NA | 5.83e-04 | NA |
| 7. B | Q5FUR4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.07e-03 | NA | 0.025 | NA |
| 7. B | A3Q2I1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.51e-03 | NA | 0.002 | NA |
| 7. B | P60374 | Replication factor C small subunit | 1.70e-04 | NA | 0.013 | NA |
| 7. B | A5WA35 | ATP-dependent protease ATPase subunit HslU | 2.38e-02 | NA | 0.032 | NA |
| 7. B | B8HA33 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.95e-03 | NA | 0.003 | NA |
| 7. B | B1JTU9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.71e-03 | NA | 5.61e-04 | NA |
| 7. B | Q3KKY9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.89e-03 | NA | 0.014 | NA |
| 7. B | D7Y2H4 | CD-NTase-associated protein 6 | 4.27e-11 | NA | 0.002 | NA |
| 7. B | Q833M7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.29e-03 | NA | 0.013 | NA |
| 7. B | A3MS27 | Replication factor C large subunit | 2.42e-04 | NA | 0.006 | NA |
| 7. B | Q8DUI0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.35e-03 | NA | 0.011 | NA |
| 7. B | P93655 | Lon protease homolog 1, mitochondrial | 1.15e-02 | NA | 0.006 | NA |
| 7. B | A6WDT9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.86e-03 | NA | 0.005 | NA |
| 7. B | Q1JC93 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.02e-03 | NA | 0.005 | NA |
| 7. B | A3DJ11 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.05e-02 | NA | 8.77e-04 | NA |
| 7. B | Q82SP6 | ATP-dependent protease ATPase subunit HslU | 2.51e-02 | NA | 0.012 | NA |
| 7. B | Q9P7Q4 | Vesicular-fusion protein sec18 | 7.46e-05 | NA | 7.89e-31 | NA |
| 7. B | Q5QXN9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.70e-03 | NA | 0.016 | NA |
| 7. B | B7UNQ1 | ATP-dependent protease ATPase subunit HslU | 3.93e-02 | NA | 0.041 | NA |
| 7. B | Q3SWE4 | ATP-dependent protease ATPase subunit HslU | 5.26e-02 | NA | 0.027 | NA |
| 7. B | Q5P503 | ATP-dependent protease ATPase subunit HslU | 2.69e-02 | NA | 0.041 | NA |
| 7. B | Q65GJ4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.33e-03 | NA | 0.001 | NA |
| 7. B | B0C146 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.20e-03 | NA | 0.008 | NA |
| 7. B | Q8I0P1 | Spastin | 6.25e-06 | NA | 2.03e-29 | NA |
| 7. B | B0U6U9 | ATP-dependent protease ATPase subunit HslU | 2.77e-02 | NA | 0.037 | NA |
| 7. B | Q9QYY8 | Spastin | 4.76e-08 | NA | 1.89e-29 | NA |
| 7. B | Q1LM63 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.86e-03 | NA | 3.46e-04 | NA |
| 7. B | A2XUN8 | Pachytene checkpoint protein 2 homolog | 1.61e-03 | NA | 8.93e-08 | NA |
| 7. B | O75351 | Vacuolar protein sorting-associated protein 4B | 8.09e-06 | NA | 1.71e-31 | NA |
| 7. B | A1UR84 | Holliday junction ATP-dependent DNA helicase RuvB | 3.72e-04 | NA | 5.75e-04 | NA |
| 7. B | Q31U59 | ATP-dependent protease ATPase subunit HslU | 4.19e-02 | NA | 0.042 | NA |
| 7. B | P32180 | ATP-dependent protease ATPase subunit HslU | 2.66e-02 | NA | 0.042 | NA |
| 7. B | Q2YTB5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.13e-03 | NA | 0.002 | NA |
| 7. B | A8F811 | Lon protease | 5.03e-03 | NA | 0.013 | NA |
| 7. B | A4TPE2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.10e-02 | NA | 0.004 | NA |
| 7. B | B5QXM0 | ATP-dependent protease ATPase subunit HslU | 3.21e-02 | NA | 0.043 | NA |
| 7. B | Q21KA8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.12e-03 | NA | 6.99e-04 | NA |
| 7. B | B4TMC7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.23e-02 | NA | 0.004 | NA |
| 7. B | B2TPB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.22e-02 | NA | 0.002 | NA |
| 7. B | B7JQ65 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.22e-03 | NA | 0.002 | NA |
| 7. B | Q3ANI9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.04e-02 | NA | 0.027 | NA |
| 7. B | A8EZR2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.46e-03 | NA | 0.003 | NA |
| 7. B | B2T404 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.87e-03 | NA | 5.66e-04 | NA |
| 7. B | Q5UPT0 | Lon protease homolog | NA | NA | 1.25e-04 | NA |
| 7. B | B1KLT6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.71e-03 | NA | 0.001 | NA |
| 7. B | A8AK15 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.14e-02 | NA | 0.004 | NA |
| 7. B | Q9NVI7 | ATPase family AAA domain-containing protein 3A | 1.32e-05 | NA | 5.79e-09 | NA |
| 7. B | Q32JJ4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.93e-03 | NA | 0.004 | NA |
| 7. B | Q9FN75 | AAA-ATPase At5g17760 | 6.86e-04 | NA | 7.43e-09 | NA |
| 7. B | Q7VXI6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.83e-03 | NA | 6.01e-04 | NA |
| 7. B | B9KHZ5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.11e-02 | NA | 0.047 | NA |
| 7. B | B5R6V0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.12e-02 | NA | 0.004 | NA |
| 7. B | C4ZTJ5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.55e-02 | NA | 0.004 | NA |
| 7. B | Q215J1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.27e-03 | NA | 0.027 | NA |
| 7. B | A2T308 | Protein Ycf2 | 5.95e-03 | NA | 9.85e-06 | NA |
| 7. B | A9MI34 | ATP-dependent protease ATPase subunit HslU | 2.56e-02 | NA | 0.043 | NA |
| 7. B | Q5UR45 | Putative AAA family ATPase L572 | NA | NA | 1.15e-04 | NA |
| 7. B | B2TWC7 | ATP-dependent protease ATPase subunit HslU | 3.99e-02 | NA | 0.042 | NA |
| 7. B | B8IN27 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.23e-03 | NA | 0.031 | NA |
| 7. B | A6W2U6 | ATP-dependent protease ATPase subunit HslU | 3.13e-02 | NA | 0.031 | NA |
| 7. B | Q8DZ10 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.29e-03 | NA | 0.005 | NA |
| 7. B | Q9QUL6 | Vesicle-fusing ATPase | 2.31e-04 | NA | 7.72e-30 | NA |
| 7. B | A6SY75 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.14e-03 | NA | 8.57e-04 | NA |
| 7. B | Q891J8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.17e-03 | NA | 0.003 | NA |
| 7. B | P0A6H7 | ATP-dependent protease ATPase subunit HslU | 2.97e-02 | NA | 0.042 | NA |
| 7. B | B7JW74 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.71e-02 | NA | 0.012 | NA |
| 7. B | B0JL96 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.80e-02 | NA | 0.012 | NA |
| 7. B | Q6C0B5 | Lon protease homolog, mitochondrial | 2.50e-02 | NA | 0.002 | NA |
| 7. B | Q39UH3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.01e-03 | NA | 0.016 | NA |
| 7. B | O74445 | Probable 26S proteasome subunit rpt4 | 8.89e-08 | NA | 2.15e-51 | NA |
| 7. B | O18413 | 26S proteasome regulatory subunit 8 | 2.89e-08 | NA | 3.66e-56 | NA |
| 7. B | B8CRF6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.10e-02 | NA | 0.002 | NA |
| 7. B | P41653 | Protein Ycf2 | 1.09e-02 | NA | 1.35e-09 | NA |
| 7. B | Q6G8Q1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.40e-03 | NA | 0.002 | NA |