Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54591.1
JCVISYN3A_0040

tRNA lysidine(34) synthetase.
M. mycoides homolog: Q6MUI9.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 70
Unique PROST Go: 30
Unique BLAST Go: 1
Unique Foldseek Go: 21

Total Homologs: 2137
Unique PROST Homologs: 1293
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 466

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: tilS; tRNA(Ile)-lysidine synthase
Zhang et al. [4]: GO:0034227|tRNA thio-modification
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A5ERG8 (tRNA(Ile)-lysidine synthase) with a FATCAT P-Value: 0 and RMSD of 3.06 angstrom. The sequence alignment identity is 20.6%.
Structural alignment shown in left. Query protein AVX54591.1 colored as red in alignment, homolog A5ERG8 colored as blue. Query protein AVX54591.1 is also shown in right top, homolog A5ERG8 showed in right bottom. They are colored based on secondary structures. 

  AVX54591.1 -----------------MKLFNINKSKKYL-IAVSGGPDSVFL--LC---NVVKLVDPNNLVVCHVNYNFRSDSNNDQMIVTNLCKQFNLKLEILNINKD 77
      A5ERG8 MSTGQSEDHLPISAAEAERLFAPFADSGVLTLAVSGGPDSMALMWLAARWRATRAGGP-RLLAVTVDHGLRPESRREALMVKQLARQLGLTHRTLR---- 95

  AVX54591.1 YSLLKQNF---ESWARVQRYDFFNMIASKYQIYNLLVAHNFNDLIETYLLQLQR-NNLVDYYGL---KPVSHYKD-LVVYRPLLDIKKSQILNYLNTNKI 169
      A5ERG8 WSGEKPAAGIPEA-ARIARYRLLARAAEQAGASHVVTAHTRDDQAETVLMRLLRGSGIA---GLAAMAPVSR-RDGLLLARPLLSLSKARLLATLRSAGI 190

  AVX54591.1 SYAIDSTNSDTKYQRNKIRT---TL-NENNFTKILDQI-NKANNNLN-SIKKIVD---NYL---------K---------D----NIINNELNLTKELFL 238
      A5ERG8 AFADDPTNRDPAFTRPRLRALMPTLAAEGADPRTLATLANRA-RRANAAIELMADGAERYLALLAAGRSSKRRGGEGEMFDPRAFAALPAEIRL--RL-L 286

  AVX54591.1 FDQNSIQRIIYTYFKL-INKESLLLNRSNKTIIEIVKRLVNSNKNHWKINLNDH--SLIKDYNKLFVIKNSLLEPKTIIINDLNDLINQTTFKNIKEIEQ 335
      A5ERG8 M--RAIDR-VGTEGPVELGKAEALLERLDRTLAGITDG-GTAERGTLKQTLAGALVSLAKD-----AIRISPAPPRR-RRGE------------------ 358

  AVX54591.1 IILKDKNFSYVITNNYEMYKSITTIANKKTNRYFIDRKISYKTRLLSPVVYNVKDKVILNKIKKHY 401
      A5ERG8 ------------------------------------------------------------------ 358

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0002100 tRNA wobble adenosine to inosine editing
1. PBF GO:0016879 ligase activity, forming carbon-nitrogen bonds
1. PBF GO:0005737 cytoplasm
1. PBF GO:0005524 ATP binding
1. PBF GO:0016783 sulfurtransferase activity
1. PBF GO:0006400 tRNA modification
1. PBF GO:0046872 metal ion binding
1. PBF GO:0008251 tRNA-specific adenosine deaminase activity
2. PF GO:0000049 tRNA binding
2. PF GO:0006526 arginine biosynthetic process
2. PF GO:0004055 argininosuccinate synthase activity
2. PF GO:0002143 tRNA wobble position uridine thiolation
3. BF GO:0052717 tRNA-specific adenosine-34 deaminase activity
3. BF GO:0052657 guanine phosphoribosyltransferase activity
3. BF GO:0034227 tRNA thio-modification
3. BF GO:0004422 hypoxanthine phosphoribosyltransferase activity
4. PB GO:0032267 tRNA(Ile)-lysidine synthase activity
4. PB GO:0002136 tRNA wobble base lysidine biosynthesis
5. P GO:0003723 RNA binding
5. P GO:0071418 cellular response to amine stimulus
5. P GO:0005886 plasma membrane
5. P GO:0070852 cell body fiber
5. P GO:0005829 cytosol
5. P GO:0006531 aspartate metabolic process
5. P GO:1903038 negative regulation of leukocyte cell-cell adhesion
5. P GO:0008152 metabolic process
5. P GO:0071499 cellular response to laminar fluid shear stress
5. P GO:0007494 midgut development
5. P GO:0000053 argininosuccinate metabolic process
5. P GO:0060539 diaphragm development
5. P GO:0005634 nucleus
5. P GO:0004345 glucose-6-phosphate dehydrogenase activity
5. P GO:0015643 toxic substance binding
5. P GO:0016798 hydrolase activity, acting on glycosyl bonds
5. P GO:0070903 mitochondrial tRNA thio-modification
5. P GO:0071400 cellular response to oleic acid
5. P GO:0060416 response to growth hormone
5. P GO:0042803 protein homodimerization activity
5. P GO:0106054 tRNA U34 sulfurtransferase activity
5. P GO:0008270 zinc ion binding
5. P GO:0000050 urea cycle
5. P GO:1990799 mitochondrial tRNA wobble position uridine thiolation
5. P GO:0000052 citrulline metabolic process
5. P GO:0071242 cellular response to ammonium ion
5. P GO:0071377 cellular response to glucagon stimulus
5. P GO:0071549 cellular response to dexamethasone stimulus
5. P GO:0061708 tRNA-5-taurinomethyluridine 2-sulfurtransferase
5. P GO:0010046 response to mycotoxin
6. F GO:0004359 glutaminase activity
6. F GO:0016779 nucleotidyltransferase activity
6. F GO:0032447 protein urmylation
6. F GO:0016462 pyrophosphatase activity
6. F GO:0008616 queuosine biosynthetic process
6. F GO:0009435 NAD biosynthetic process
6. F GO:0004781 sulfate adenylyltransferase (ATP) activity
6. F GO:0004779 sulfate adenylyltransferase activity
6. F GO:0003921 GMP synthase activity
6. F GO:0003922 GMP synthase (glutamine-hydrolyzing) activity
6. F GO:0000103 sulfate assimilation
6. F GO:0051539 4 iron, 4 sulfur cluster binding
6. F GO:0006541 glutamine metabolic process
6. F GO:0070814 hydrogen sulfide biosynthetic process
6. F GO:0006412 translation
6. F GO:0002098 tRNA wobble uridine modification
6. F GO:0008795 NAD+ synthase activity
6. F GO:0019419 sulfate reduction
6. F GO:0000287 magnesium ion binding
6. F GO:0003952 NAD+ synthase (glutamine-hydrolyzing) activity
6. F GO:0002144 cytosolic tRNA wobble base thiouridylase complex
7. B GO:0002127 tRNA wobble base cytosine methylation

Uniprot GO Annotations

GO Description
GO:0008033 tRNA processing
GO:0016879 ligase activity, forming carbon-nitrogen bonds
GO:0016874 ligase activity
GO:0005524 ATP binding
GO:0005737 cytoplasm
GO:0006400 tRNA modification
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9WZ48 tRNA(Ile)-lysidine synthase 2.04e-13 2.09e-37 2.46e-20 0.6279
1. PBF A5CFP2 tRNA(Ile)-lysidine synthase 7.97e-14 1.09e-51 1.04e-13 0.5851
1. PBF Q65PF4 tRNA(Ile)-lysidine synthase 0.00e+00 2.14e-41 7.34e-20 0.74
1. PBF C0MC74 tRNA(Ile)-lysidine synthase 1.32e-12 3.28e-54 3.46e-11 0.5787
1. PBF Q0I3D1 tRNA(Ile)-lysidine synthase 6.22e-15 1.07e-56 2.11e-14 0.5184
1. PBF Q88Z33 tRNA(Ile)-lysidine synthase 5.80e-12 1.51e-54 7.68e-17 0.5974
1. PBF Q04N53 tRNA(Ile)-lysidine synthase 2.98e-11 1.30e-59 1.81e-13 0.5553
1. PBF Q8R7K9 tRNA(Ile)-lysidine synthase 0.00e+00 9.26e-44 3.19e-18 0.7157
1. PBF Q899H5 tRNA(Ile)-lysidine synthase 1.22e-13 1.09e-43 1.70e-29 0.6542
1. PBF Q65UE9 tRNA(Ile)-lysidine synthase 4.88e-15 3.28e-54 2.56e-16 0.5136
1. PBF B2RMB4 tRNA(Ile)-lysidine synthase 8.77e-13 1.88e-44 1.24e-21 0.6295
1. PBF Q73FE5 tRNA(Ile)-lysidine synthase 0.00e+00 2.37e-42 1.13e-20 0.7717
1. PBF C1CN76 tRNA(Ile)-lysidine synthase 4.33e-11 3.16e-59 1.51e-14 0.5636
1. PBF Q87BE2 tRNA(Ile)-lysidine synthase 7.22e-15 9.74e-55 6.83e-10 0.6014
1. PBF Q3KH95 tRNA(Ile)-lysidine synthase 2.51e-14 5.39e-49 0.003 0.5613
1. PBF B1L8R5 tRNA(Ile)-lysidine synthase 1.96e-13 2.83e-37 5.81e-21 0.6317
1. PBF Q3ZYX5 tRNA(Ile)-lysidine synthase 0.00e+00 9.51e-45 2.16e-15 0.7137
1. PBF Q5GTD2 tRNA(Ile)-lysidine synthase 3.30e-14 1.25e-43 1.59e-14 0.6007
1. PBF Q7MIH8 tRNA(Ile)-lysidine synthase 1.27e-14 4.13e-59 6.17e-09 0.5354
1. PBF Q8G3S4 tRNA(Ile)-lysidine synthase 0.00e+00 2.66e-04 2.29e-10 0.66
1. PBF A8F7F8 tRNA(Ile)-lysidine synthase 3.16e-14 5.00e-48 7.76e-20 0.6728
1. PBF Q9PL79 tRNA(Ile)-lysidine synthase 0.00e+00 3.11e-04 1.31e-17 0.7543
1. PBF P44689 tRNA(Ile)-lysidine synthase 1.81e-14 5.66e-49 2.15e-16 0.5077
1. PBF A3N2I9 tRNA(Ile)-lysidine synthase 6.45e-14 8.94e-54 4.51e-15 0.5752
1. PBF O25428 tRNA(Ile)-lysidine synthase 1.08e-09 1.64e-24 2.69e-08 0.564
1. PBF Q4QND8 tRNA(Ile)-lysidine synthase 1.22e-15 1.68e-50 9.51e-18 0.5081
1. PBF A9N0U0 tRNA(Ile)-lysidine synthase 4.31e-12 6.34e-59 9.70e-07 0.5443
1. PBF Q32RX0 tRNA(Ile)-lysidine synthase, chloroplastic 2.50e-08 1.31e-20 7.62e-04 0.5188
1. PBF Q9A201 tRNA(Ile)-lysidine synthase 2.69e-12 2.37e-53 1.00e-11 0.5249
1. PBF Q63HD6 tRNA(Ile)-lysidine synthase 0.00e+00 9.18e-42 2.63e-20 0.7679
1. PBF Q9HXZ3 tRNA(Ile)-lysidine synthase 5.07e-14 8.49e-54 1.32e-10 0.6149
1. PBF A8F0E8 tRNA(Ile)-lysidine synthase 9.79e-11 7.00e-45 3.08e-17 0.52
1. PBF Q0SM64 tRNA(Ile)-lysidine synthase 6.98e-10 9.25e-49 9.41e-18 0.5898
1. PBF A5F623 tRNA(Ile)-lysidine synthase 7.11e-15 2.25e-53 1.09e-11 0.5621
1. PBF B4F252 tRNA(Ile)-lysidine synthase 3.83e-14 9.17e-54 5.42e-10 0.5329
1. PBF A8GLX9 tRNA(Ile)-lysidine synthase 1.31e-13 6.78e-52 3.55e-18 0.5812
1. PBF Q9CJH4 tRNA(Ile)-lysidine synthase 2.30e-09 1.80e-56 1.12e-11 0.6303
1. PBF Q5P9R1 tRNA(Ile)-lysidine synthase 5.56e-13 2.85e-48 4.75e-24 0.5849
1. PBF C0QU23 tRNA(Ile)-lysidine synthase 3.33e-15 9.58e-47 2.08e-21 0.6528
1. PBF A5ERG8 tRNA(Ile)-lysidine synthase 0.00e+00 8.40e-10 1.11e-16 0.6548
1. PBF B3DR08 tRNA(Ile)-lysidine synthase 0.00e+00 2.39e-04 7.06e-10 0.6571
1. PBF Q5LNU7 tRNA(Ile)-lysidine synthase 5.31e-14 6.22e-45 5.64e-18 0.6034
1. PBF Q5WYB4 tRNA(Ile)-lysidine synthase 1.23e-12 9.99e-55 1.42e-15 0.565
1. PBF Q0TMI0 tRNA(Ile)-lysidine synthase 4.78e-11 1.29e-49 6.50e-23 0.6776
1. PBF A1VRB1 tRNA(Ile)-lysidine synthase 0.00e+00 2.89e-03 3.48e-13 0.7481
1. PBF Q667K7 tRNA(Ile)-lysidine synthase 1.33e-13 2.57e-49 3.32e-12 0.5308
1. PBF Q8ZH50 tRNA(Ile)-lysidine synthase 1.39e-13 2.98e-49 3.60e-12 0.5324
1. PBF Q8EU18 tRNA(Ile)-lysidine synthase 0.00e+00 1.83e-40 5.77e-12 0.7379
1. PBF Q0C5V2 tRNA(Ile)-lysidine synthase 1.58e-09 2.52e-20 4.23e-11 0.6357
1. PBF Q92JY3 tRNA(Ile)-lysidine synthase 3.46e-12 2.09e-47 7.71e-09 0.582
1. PBF Q8D2F5 tRNA(Ile)-lysidine synthase 3.92e-09 7.89e-40 2.30e-08 0.5888
1. PBF B5F8V0 tRNA(Ile)-lysidine synthase 5.11e-15 1.17e-58 9.53e-07 0.532
1. PBF Q7VPN7 tRNA(Ile)-lysidine synthase 1.78e-15 5.35e-54 2.73e-16 0.5242
1. PBF O84847 tRNA(Ile)-lysidine synthase 0.00e+00 2.49e-03 2.38e-17 0.7526
1. PBF Q32RJ9 tRNA(Ile)-lysidine synthase, chloroplastic 3.33e-16 4.57e-06 4.55e-04 0.5766
1. PBF B1YGQ4 tRNA(Ile)-lysidine synthase 1.33e-15 1.32e-55 9.56e-18 0.6186
1. PBF Q46ID9 tRNA(Ile)-lysidine synthase 1.02e-12 2.92e-03 6.05e-04 0.6846
1. PBF Q6GJG2 tRNA(Ile)-lysidine synthase 0.00e+00 3.75e-53 3.33e-19 0.7378
1. PBF Q7VGR5 tRNA(Ile)-lysidine synthase 7.29e-09 6.90e-40 1.45e-10 0.5086
1. PBF P74192 tRNA(Ile)-lysidine synthase 0.00e+00 1.96e-03 5.95e-07 0.7464
1. PBF B0TYH9 tRNA(Ile)-lysidine synthase 1.04e-12 3.32e-58 2.00e-27 0.6327
1. PBF Q68XR8 tRNA(Ile)-lysidine synthase 7.12e-10 1.28e-53 2.76e-19 0.6008
1. PBF A9WWG9 tRNA(Ile)-lysidine synthase 4.72e-13 3.83e-47 8.95e-12 0.5956
1. PBF Q8RHN5 tRNA(Ile)-lysidine synthase 4.48e-11 8.94e-54 1.41e-18 0.5916
1. PBF B5E578 tRNA(Ile)-lysidine synthase 2.66e-11 8.22e-60 5.02e-14 0.5449
1. PBF B8DWC0 tRNA(Ile)-lysidine synthase 0.00e+00 8.36e-06 2.16e-04 0.6737
1. PBF B0UGN1 tRNA(Ile)-lysidine synthase 1.30e-13 1.62e-07 1.85e-15 0.7604
1. PBF Q839B3 tRNA(Ile)-lysidine synthase 0.00e+00 9.64e-48 6.57e-16 0.7543
1. PBF Q6YR87 tRNA(Ile)-lysidine synthase 1.09e-12 3.38e-50 1.33e-20 0.7236
1. PBF Q5M6K9 tRNA(Ile)-lysidine synthase 1.22e-12 1.44e-54 3.42e-13 0.5388
1. PBF Q9KGH8 tRNA(Ile)-lysidine synthase 0.00e+00 2.54e-47 2.47e-15 0.7301
1. PBF Q8CQV3 tRNA(Ile)-lysidine synthase 5.55e-16 1.58e-56 1.24e-21 0.7323
1. PBF Q5SI38 tRNA(Ile)-lysidine synthase 1.71e-11 4.31e-05 2.56e-17 0.6074
1. PBF Q9KPX0 tRNA(Ile)-lysidine synthase 8.55e-15 9.17e-54 8.68e-12 0.5564
1. PBF P47330 tRNA(Ile)-lysidine synthase 4.59e-14 7.01e-08 2.96e-28 0.746
1. PBF A4W6T3 tRNA(Ile)-lysidine synthase 1.61e-14 9.92e-60 2.38e-08 0.5127
1. PBF B0B969 tRNA(Ile)-lysidine synthase 0.00e+00 3.12e-03 2.36e-17 0.7561
1. PBF B7J0N4 tRNA(Ile)-lysidine synthase 5.48e-12 6.67e-51 1.20e-18 0.5819
1. PBF Q5L5B2 tRNA(Ile)-lysidine synthase 0.00e+00 8.07e-03 1.57e-16 0.7461
1. PBF A9IYI2 tRNA(Ile)-lysidine synthase 7.71e-12 5.22e-25 4.79e-12 0.5819
1. PBF Q8DWM9 tRNA(Ile)-lysidine synthase 4.60e-11 1.46e-55 1.53e-07 0.5226
1. PBF B8IP16 tRNA(Ile)-lysidine synthase 0.00e+00 6.39e-07 1.25e-20 0.6848
1. PBF Q63ST1 tRNA(Ile)-lysidine synthase 1.18e-14 1.71e-35 3.39e-12 0.6182
1. PBF B4TK64 tRNA(Ile)-lysidine synthase 4.88e-15 2.11e-58 8.64e-07 0.5338
1. PBF C3LPP6 tRNA(Ile)-lysidine synthase 2.33e-15 2.25e-53 1.09e-11 0.5449
1. PBF Q81VX7 tRNA(Ile)-lysidine synthase 0.00e+00 2.27e-42 2.58e-21 0.7611
1. PBF Q5M217 tRNA(Ile)-lysidine synthase 8.92e-11 1.44e-54 3.42e-13 0.541
1. PBF Q8F9P6 tRNA(Ile)-lysidine synthase 1.49e-08 2.60e-37 2.64e-04 0.4968
1. PBF Q74C65 tRNA(Ile)-lysidine synthase 0.00e+00 8.18e-49 4.05e-17 0.7309
1. PBF Q04XC4 tRNA(Ile)-lysidine synthase 1.84e-08 2.75e-39 0.004 0.4733
1. PBF Q87MF4 tRNA(Ile)-lysidine synthase 2.55e-15 3.50e-58 2.02e-07 0.5441
1. PBF O83388 tRNA(Ile)-lysidine synthase 4.01e-12 4.58e-39 8.47e-14 0.5664
1. PBF C5B7T0 tRNA(Ile)-lysidine synthase 2.84e-14 4.35e-54 1.18e-13 0.5131
1. PBF A8GQJ7 tRNA(Ile)-lysidine synthase 1.81e-09 5.90e-38 3.18e-17 0.5801
1. PBF C1C992 tRNA(Ile)-lysidine synthase 2.46e-11 1.70e-59 4.46e-14 0.5068
1. PBF A1K3X8 tRNA(Ile)-lysidine synthase 4.77e-14 1.07e-48 7.87e-13 0.5558
1. PBF A7FFI7 tRNA(Ile)-lysidine synthase 1.49e-13 2.87e-52 3.24e-12 0.5183
1. PBF Q0A7K1 tRNA(Ile)-lysidine synthase 8.63e-14 1.12e-51 7.01e-06 0.6148
1. PBF B1I6Y3 tRNA(Ile)-lysidine synthase 4.01e-11 2.23e-59 1.56e-14 0.551
1. PBF B2IQZ8 tRNA(Ile)-lysidine synthase 2.33e-11 8.22e-60 5.02e-14 0.5037
1. PBF Q5N517 tRNA(Ile)-lysidine synthase 0.00e+00 4.04e-03 3.16e-09 0.7789
1. PBF Q8XHL1 tRNA(Ile)-lysidine synthase 1.80e-13 7.29e-50 4.66e-23 0.6895
1. PBF Q6AJ19 tRNA(Ile)-lysidine synthase 3.71e-13 3.90e-44 9.87e-10 0.6489
1. PBF Q6MUI9 tRNA(Ile)-lysidine synthase 0.00e+00 3.97e-105 0.0 0.9789
1. PBF B4TYE9 tRNA(Ile)-lysidine synthase 4.88e-15 2.83e-58 1.38e-06 0.528
1. PBF C4K162 tRNA(Ile)-lysidine synthase 8.29e-10 4.23e-28 3.60e-17 0.5265
1. PBF C0MAT4 tRNA(Ile)-lysidine synthase 1.66e-10 7.51e-55 6.31e-12 0.525
1. PBF Q1RGN9 tRNA(Ile)-lysidine synthase 1.11e-09 2.06e-56 5.18e-19 0.5974
1. PBF B0BAU8 tRNA(Ile)-lysidine synthase 0.00e+00 3.12e-03 2.36e-17 0.763
1. PBF Q8ZRN5 tRNA(Ile)-lysidine synthase 4.66e-15 8.29e-59 9.19e-07 0.5294
1. PBF Q6MDI6 tRNA(Ile)-lysidine synthase 7.44e-15 6.09e-43 8.91e-19 0.6885
1. PBF Q57T19 tRNA(Ile)-lysidine synthase 4.55e-15 4.45e-58 4.57e-07 0.5312
1. PBF Q8Y074 tRNA(Ile)-lysidine synthase 3.22e-15 1.19e-50 9.90e-13 0.6042
1. PBF A6WY85 tRNA(Ile)-lysidine synthase 1.02e-12 1.35e-47 8.89e-14 0.56
1. PBF Q046D9 tRNA(Ile)-lysidine synthase 4.33e-13 9.37e-58 6.30e-20 0.5908
1. PBF Q8U9L7 tRNA(Ile)-lysidine synthase 6.42e-13 9.32e-46 5.11e-10 0.5753
1. PBF Q255L6 tRNA(Ile)-lysidine synthase 0.00e+00 4.95e-02 1.13e-16 0.7634
1. PBF Q5HRP5 tRNA(Ile)-lysidine synthase 0.00e+00 1.58e-56 1.24e-21 0.7425
1. PBF Q8PIY5 tRNA(Ile)-lysidine synthase 1.92e-14 2.38e-50 4.11e-07 0.524
1. PBF P0DG01 tRNA(Ile)-lysidine synthase 2.15e-10 1.31e-53 1.07e-11 0.5476
1. PBF B2S7D1 tRNA(Ile)-lysidine synthase 5.15e-13 2.73e-47 8.95e-12 0.5966
1. PBF B4U5H9 tRNA(Ile)-lysidine synthase 1.15e-12 3.28e-54 3.46e-11 0.5605
1. PBF Q3KKJ9 tRNA(Ile)-lysidine synthase 0.00e+00 2.61e-03 2.38e-17 0.7561
1. PBF Q8KC15 tRNA(Ile)-lysidine synthase 0.00e+00 1.53e-06 2.46e-19 0.7242
1. PBF Q97TC5 tRNA(Ile)-lysidine synthase 3.99e-11 2.00e-59 4.67e-14 0.5583
1. PBF Q7MTC4 tRNA(Ile)-lysidine synthase 4.72e-13 1.07e-44 2.93e-21 0.6494
1. PBF Q8FZ11 tRNA(Ile)-lysidine synthase 4.72e-13 1.22e-46 1.11e-11 0.594
1. PBF Q9Z6R2 tRNA(Ile)-lysidine synthase 0.00e+00 3.06e-02 2.31e-16 0.7638
1. PBF Q9XBG6 tRNA(Ile)-lysidine synthase 0.00e+00 6.15e-13 2.39e-19 0.6771
1. PBF B1KNS7 tRNA(Ile)-lysidine synthase 3.63e-14 2.45e-49 5.89e-09 0.5933
1. PBF Q2GC97 tRNA(Ile)-lysidine synthase 0.00e+00 1.16e-04 1.55e-18 0.724
1. PBF Q2JJ74 tRNA(Ile)-lysidine synthase 0.00e+00 9.31e-03 1.37e-07 0.7117
1. PBF Q1ACK8 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 2.26e-05 7.19e-07 0.7266
1. PBF A5VS49 tRNA(Ile)-lysidine synthase 5.95e-13 2.73e-47 8.95e-12 0.5752
1. PBF Q8KA23 tRNA(Ile)-lysidine synthase 3.50e-14 8.22e-43 5.18e-10 0.5941
1. PBF Q72C25 tRNA(Ile)-lysidine synthase 8.88e-16 1.82e-05 1.34e-09 0.6643
1. PBF A8GY99 tRNA(Ile)-lysidine synthase 1.64e-09 2.97e-56 5.58e-19 0.5954
1. PBF Q2A488 tRNA(Ile)-lysidine synthase 2.12e-12 2.11e-56 3.40e-24 0.6184
1. PBF Q9CNY2 tRNA(Ile)-lysidine synthase 3.59e-14 1.55e-57 2.49e-10 0.5177
1. PBF Q2YQH6 tRNA(Ile)-lysidine synthase 6.02e-13 2.73e-47 8.95e-12 0.5973
1. PBF Q98PE3 tRNA(Ile)-lysidine synthase 5.21e-13 1.41e-09 3.52e-33 0.6812
1. PBF O67728 tRNA(Ile)-lysidine synthase 0.00e+00 3.24e-03 1.44e-15 0.7492
1. PBF Q607F5 tRNA(Ile)-lysidine synthase 6.69e-14 1.03e-54 1.35e-13 0.5941
1. PBF C1D1Q9 tRNA(Ile)-lysidine synthase 2.89e-15 1.21e-02 5.66e-13 0.5728
1. PBF Q82VP4 tRNA(Ile)-lysidine synthase 7.47e-14 1.72e-50 1.38e-16 0.5658
1. PBF Q601M6 tRNA(Ile)-lysidine synthase 0.00e+00 5.78e-09 2.40e-29 0.7666
1. PBF Q31G65 tRNA(Ile)-lysidine synthase 2.92e-09 5.47e-61 1.68e-15 0.5644
1. PBF Q8E7Y2 tRNA(Ile)-lysidine synthase 4.46e-09 3.92e-54 9.62e-11 0.5343
1. PBF Q8EWQ7 tRNA(Ile)-lysidine synthase 3.37e-13 2.94e-09 2.79e-35 0.6996
1. PBF Q2NIN4 tRNA(Ile)-lysidine synthase 1.86e-12 3.42e-52 2.96e-19 0.7215
1. PBF Q6F880 tRNA(Ile)-lysidine synthase 5.67e-11 7.17e-46 1.32e-15 0.6401
1. PBF Q6MLS8 tRNA(Ile)-lysidine synthase 1.26e-13 1.76e-03 3.60e-13 0.682
1. PBF Q73FR9 tRNA(Ile)-lysidine synthase 9.12e-12 1.64e-44 1.82e-15 0.6293
1. PBF Q8FL00 tRNA(Ile)-lysidine synthase 6.66e-15 7.46e-53 3.43e-11 0.5191
1. PBF Q493B5 tRNA(Ile)-lysidine synthase 3.65e-09 4.29e-39 2.11e-08 0.5529
1. PBF Q7A7A6 tRNA(Ile)-lysidine synthase 0.00e+00 2.41e-54 8.93e-20 0.7439
1. PBF Q8P7L3 tRNA(Ile)-lysidine synthase 7.99e-14 9.65e-54 1.00e-08 0.5901
1. PBF B8ZJI9 tRNA(Ile)-lysidine synthase 4.22e-11 2.35e-59 3.10e-14 0.5023
1. PBF Q83BJ9 tRNA(Ile)-lysidine synthase 6.77e-15 2.91e-50 3.04e-11 0.6168
1. PBF A2C5B5 tRNA(Ile)-lysidine synthase 0.00e+00 1.90e-03 0.002 0.7183
1. PBF Q8X8W8 tRNA(Ile)-lysidine synthase 6.99e-15 8.02e-56 1.36e-11 0.5262
1. PBF Q6GBX9 tRNA(Ile)-lysidine synthase 0.00e+00 1.21e-52 2.14e-19 0.7397
1. PBF A6VNE4 tRNA(Ile)-lysidine synthase 3.21e-14 5.05e-60 1.82e-14 0.5831
1. PBF Q89AX3 tRNA(Ile)-lysidine synthase 6.56e-14 1.81e-45 6.77e-09 0.5812
1. PBF A7NB76 tRNA(Ile)-lysidine synthase 2.49e-12 2.11e-56 3.40e-24 0.6344
1. PBF Q9ZGE2 tRNA(Ile)-lysidine synthase 0.00e+00 6.23e-44 6.17e-14 0.7148
1. PBF C0R4S1 tRNA(Ile)-lysidine synthase 3.73e-14 1.08e-41 4.59e-15 0.6195
1. PBF C3PM75 tRNA(Ile)-lysidine synthase 1.52e-09 1.10e-41 3.40e-16 0.5862
1. PBF Q64WF9 tRNA(Ile)-lysidine synthase 6.03e-14 2.85e-48 1.75e-15 0.615
1. PBF Q6HPV4 tRNA(Ile)-lysidine synthase 0.00e+00 1.64e-42 2.70e-21 0.7763
1. PBF Q7VX92 tRNA(Ile)-lysidine synthase 0.00e+00 5.77e-07 8.46e-09 0.7198
1. PBF Q9PR68 tRNA(Ile)-lysidine synthase 1.15e-13 3.96e-12 6.54e-40 0.6776
1. PBF Q6D8C5 tRNA(Ile)-lysidine synthase 4.70e-14 4.76e-52 3.17e-05 0.5234
1. PBF B7IFR8 tRNA(Ile)-lysidine synthase 3.77e-13 2.90e-53 1.16e-19 0.5908
1. PBF Q8DIH2 tRNA(Ile)-lysidine synthase 6.16e-14 4.93e-10 5.17e-15 0.7568
1. PBF P37563 tRNA(Ile)-lysidine synthase 0.00e+00 2.11e-39 3.65e-27 0.7259
1. PBF Q9ZEA3 tRNA(Ile)-lysidine synthase 5.36e-14 6.40e-53 4.29e-16 0.6104
1. PBF C1CNP4 tRNA(Ile)-lysidine synthase 2.76e-11 8.91e-60 1.56e-14 0.5545
1. PBF C0REV5 tRNA(Ile)-lysidine synthase 7.57e-13 4.22e-47 5.66e-12 0.5759
1. PBF Q8NXZ4 tRNA(Ile)-lysidine synthase 7.77e-16 1.21e-52 2.14e-19 0.6732
1. PBF Q5F8F6 tRNA(Ile)-lysidine synthase 6.00e-15 1.97e-57 2.13e-12 0.5693
1. PBF P0DG00 tRNA(Ile)-lysidine synthase 2.45e-12 1.31e-53 1.07e-11 0.5459
1. PBF Q5X6W4 tRNA(Ile)-lysidine synthase 7.77e-15 1.80e-56 1.31e-15 0.5603
1. PBF Q8DBE4 tRNA(Ile)-lysidine synthase 3.89e-15 9.73e-59 5.45e-09 0.5038
1. PBF Q5WAE0 tRNA(Ile)-lysidine synthase 0.00e+00 2.07e-44 2.42e-16 0.7129
1. PBF Q9JUE9 tRNA(Ile)-lysidine synthase 5.17e-14 3.86e-56 1.27e-13 0.5326
1. PBF B0UUD3 tRNA(Ile)-lysidine synthase 5.11e-15 3.86e-56 5.46e-15 0.5208
1. PBF Q8A7D1 tRNA(Ile)-lysidine synthase 8.20e-14 4.88e-49 3.80e-21 0.6547
1. PBF Q8YYB8 tRNA(Ile)-lysidine synthase 0.00e+00 1.81e-09 6.24e-15 0.7377
1. PBF Q4W568 tRNA(Ile)-lysidine synthase 1.51e-14 3.86e-56 1.27e-13 0.5349
1. PBF Q8P322 tRNA(Ile)-lysidine synthase 2.37e-10 2.69e-53 2.64e-12 0.5287
1. PBF Q0BMM2 tRNA(Ile)-lysidine synthase 2.16e-12 2.11e-56 3.40e-24 0.6244
1. PBF A6LBU3 tRNA(Ile)-lysidine synthase 2.78e-13 4.09e-44 2.17e-16 0.6729
1. PBF Q9ZLB5 tRNA(Ile)-lysidine synthase 1.35e-09 1.92e-24 1.22e-06 0.5661
1. PBF Q6FYQ5 tRNA(Ile)-lysidine synthase 5.12e-13 7.14e-32 8.90e-11 0.6183
1. PBF P57211 tRNA(Ile)-lysidine synthase 1.55e-14 5.64e-48 0.002 0.5834
1. PBF Q74LA3 tRNA(Ile)-lysidine synthase 4.23e-13 4.96e-57 9.56e-18 0.5963
1. PBF Q67JG9 tRNA(Ile)-lysidine synthase 0.00e+00 7.18e-38 1.62e-18 0.7038
1. PBF A3CJX7 tRNA(Ile)-lysidine synthase 1.09e-12 1.20e-60 9.54e-15 0.6145
1. PBF Q7MR31 tRNA(Ile)-lysidine synthase 1.35e-10 4.38e-21 2.64e-13 0.6386
1. PBF A0Q7B6 tRNA(Ile)-lysidine synthase 1.40e-12 3.17e-57 2.03e-24 0.6265
1. PBF Q7NT72 tRNA(Ile)-lysidine synthase 1.32e-14 2.60e-54 5.16e-12 0.6729
1. PBF A8B000 tRNA(Ile)-lysidine synthase 4.61e-13 1.35e-56 4.04e-11 0.5818
1. PBF Q99W94 tRNA(Ile)-lysidine synthase 0.00e+00 2.41e-54 8.93e-20 0.7414
1. PBF O51728 tRNA(Ile)-lysidine synthase 6.48e-10 6.67e-51 1.20e-18 0.5922
1. PBF B0BRD5 tRNA(Ile)-lysidine synthase 8.96e-12 9.90e-54 4.47e-15 0.5639
1. PBF Q5HIG6 tRNA(Ile)-lysidine synthase 0.00e+00 4.46e-54 3.29e-20 0.7503
1. PBF B7VIQ1 tRNA(Ile)-lysidine synthase 2.11e-14 8.92e-53 2.12e-08 0.5266
1. PBF B2SG31 tRNA(Ile)-lysidine synthase 1.63e-12 3.86e-56 1.17e-24 0.6392
1. PBF Q62J40 tRNA(Ile)-lysidine synthase 1.13e-14 1.50e-34 3.95e-12 0.6169
1. PBF Q14H05 tRNA(Ile)-lysidine synthase 4.88e-15 8.86e-57 1.25e-24 0.6375
1. PBF Q73N15 tRNA(Ile)-lysidine synthase 4.73e-12 2.73e-42 2.09e-11 0.5788
1. PBF Q8YIV0 tRNA(Ile)-lysidine synthase 5.16e-13 4.22e-47 5.66e-12 0.5765
1. PBF A5UA84 tRNA(Ile)-lysidine synthase 2.53e-14 3.38e-50 2.44e-16 0.5044
1. PBF B2S2X0 tRNA(Ile)-lysidine synthase 2.26e-12 4.58e-39 8.47e-14 0.5815
1. PBF C4K338 tRNA(Ile)-lysidine synthase 2.51e-13 2.99e-51 6.18e-11 0.5494
1. PBF Q5R0Q7 tRNA(Ile)-lysidine synthase 9.89e-14 7.03e-48 1.72e-11 0.5739
1. PBF Q6G5P5 tRNA(Ile)-lysidine synthase 1.18e-09 3.36e-27 2.59e-11 0.5841
1. PBF A5UGS0 tRNA(Ile)-lysidine synthase 1.47e-14 2.92e-48 4.06e-15 0.5051
1. PBF Q04W48 tRNA(Ile)-lysidine synthase 1.13e-10 2.75e-39 0.004 0.4561
1. PBF Q72IF6 tRNA(Ile)-lysidine synthase 1.88e-11 3.85e-05 2.47e-17 0.5998
1. PBF Q92JK0 tRNA(Ile)-lysidine synthase 8.02e-09 1.06e-42 6.75e-17 0.5292
1. PBF B3GYM3 tRNA(Ile)-lysidine synthase 9.21e-12 9.90e-54 4.47e-15 0.5511
1. PBF Q8E2H4 tRNA(Ile)-lysidine synthase 3.80e-11 3.92e-54 9.62e-11 0.6329
1. PBF Q9PMK7 tRNA(Ile)-lysidine synthase 3.37e-12 3.88e-17 2.15e-16 0.5898
1. PBF Q7N8N0 tRNA(Ile)-lysidine synthase 3.28e-14 2.16e-55 2.56e-10 0.5494
1. PBF Q5HSX8 tRNA(Ile)-lysidine synthase 3.53e-08 5.18e-18 1.78e-16 0.6048
1. PBF Q57BI8 tRNA(Ile)-lysidine synthase 5.82e-13 2.73e-47 8.95e-12 0.5951
1. PBF B0BVY4 tRNA(Ile)-lysidine synthase 7.32e-10 5.90e-38 3.18e-17 0.586
1. PBF Q8EGF9 tRNA(Ile)-lysidine synthase 1.84e-10 1.04e-51 6.45e-05 0.5875
1. PBF A2SIL9 tRNA(Ile)-lysidine synthase 4.88e-14 6.84e-51 9.27e-05 0.61
1. PBF Q6NAQ6 tRNA(Ile)-lysidine synthase 0.00e+00 1.80e-07 2.99e-16 0.7062
1. PBF Q65ZY6 tRNA(Ile)-lysidine synthase 9.53e-12 4.12e-47 5.51e-19 0.58
1. PBF A8GIC1 tRNA(Ile)-lysidine synthase 2.18e-14 1.68e-54 1.26e-05 0.5215
1. PBF B7GP48 tRNA(Ile)-lysidine synthase 1.11e-16 2.29e-04 7.86e-10 0.6502
1. PBF Q886M6 tRNA(Ile)-lysidine synthase 4.44e-14 2.11e-50 3.40e-04 0.5467
1. PBF Q7NAI9 tRNA(Ile)-lysidine synthase 9.88e-15 7.31e-07 8.38e-42 0.7243
1. PBF Q5XEL7 tRNA(Ile)-lysidine synthase 2.07e-12 1.57e-53 9.93e-12 0.5392
1. PBF Q5NFK3 tRNA(Ile)-lysidine synthase 1.67e-12 8.86e-57 1.25e-24 0.6319
1. PBF B3CUJ5 tRNA(Ile)-lysidine synthase 7.67e-12 1.06e-49 2.07e-14 0.5721
1. PBF Q5NLX8 tRNA(Ile)-lysidine synthase 0.00e+00 3.24e-04 1.66e-14 0.6951
1. PBF Q181G3 tRNA(Ile)-lysidine synthase 3.30e-14 4.14e-46 3.00e-20 0.6811
1. PBF Q7UNE1 tRNA(Ile)-lysidine synthase 1.11e-16 4.99e-06 2.21e-17 0.6103
1. PBF Q7VRC9 tRNA(Ile)-lysidine synthase 4.87e-09 6.85e-36 7.17e-10 0.533
1. PBF A4IXE6 tRNA(Ile)-lysidine synthase 1.34e-12 8.86e-57 1.25e-24 0.6409
1. PBF C1CH91 tRNA(Ile)-lysidine synthase 4.48e-11 4.24e-59 1.65e-14 0.5594
1. PBF A9M7J1 tRNA(Ile)-lysidine synthase 5.28e-13 3.83e-47 8.95e-12 0.5966
1. PBF Q9PFJ8 tRNA(Ile)-lysidine synthase 2.55e-15 6.24e-54 1.25e-09 0.6028
1. PBF Q88MG3 tRNA(Ile)-lysidine synthase 5.01e-14 2.57e-51 5.95e-08 0.5354
1. PBF Q5PD76 tRNA(Ile)-lysidine synthase 4.57e-12 1.85e-58 2.85e-06 0.5472
1. PBF Q81J84 tRNA(Ile)-lysidine synthase 0.00e+00 1.10e-41 1.04e-18 0.7629
1. PBF B5FJ36 tRNA(Ile)-lysidine synthase 4.79e-12 2.99e-58 1.68e-06 0.5481
1. PBF B4SV18 tRNA(Ile)-lysidine synthase 3.78e-12 4.36e-59 2.54e-06 0.5384
1. PBF Q6F0E4 tRNA(Ile)-lysidine synthase 0.00e+00 1.62e-76 5.25e-113 0.9164
1. PBF P75549 tRNA(Ile)-lysidine synthase 2.22e-16 2.09e-07 3.69e-31 0.7511
1. PBF Q01QT2 tRNA(Ile)-lysidine synthase 0.00e+00 3.37e-35 1.36e-16 0.7011
1. PBF A7MXZ8 tRNA(Ile)-lysidine synthase 1.61e-14 2.51e-51 1.44e-05 0.529
1. PBF Q4UN67 tRNA(Ile)-lysidine synthase 1.49e-09 5.50e-53 9.72e-17 0.5772
1. PBF Q4UWI7 tRNA(Ile)-lysidine synthase 6.01e-14 9.65e-54 1.00e-08 0.5873
1. PBF Q5L3T3 tRNA(Ile)-lysidine synthase 0.00e+00 7.89e-46 4.05e-17 0.7469
1. PBF Q5FQB6 tRNA(Ile)-lysidine synthase 5.71e-10 7.30e-39 1.36e-09 0.5229
1. PBF Q5ZXE5 tRNA(Ile)-lysidine synthase 7.55e-15 1.01e-56 1.45e-15 0.5613
1. PBF Q8DRP9 tRNA(Ile)-lysidine synthase 2.64e-11 1.30e-59 1.81e-13 0.5521
1. PBF Q97EB0 tRNA(Ile)-lysidine synthase 0.00e+00 2.12e-44 1.52e-24 0.6929
1. PBF Q8Z996 tRNA(Ile)-lysidine synthase 4.66e-15 8.74e-59 9.78e-07 0.5317
1. PBF Q6LN41 tRNA(Ile)-lysidine synthase 6.69e-14 2.49e-53 4.84e-10 0.5446
1. PBF B3CLY6 tRNA(Ile)-lysidine synthase 3.44e-14 2.89e-46 2.28e-15 0.6174
1. PBF Q7UDQ6 tRNA(Ile)-lysidine synthase 5.55e-15 2.31e-57 2.41e-11 0.5158
2. PF Q5UZ46 Argininosuccinate synthase 2.47e-03 1.40e-13 NA 0.5084
2. PF Q480B8 tRNA-specific 2-thiouridylase MnmA 1.44e-02 1.55e-08 NA 0.512
2. PF Q3IME2 Argininosuccinate synthase 1.81e-03 7.07e-13 NA 0.5399
2. PF Q089K8 Argininosuccinate synthase 3.69e-03 7.69e-10 NA 0.5436
2. PF A8ES35 tRNA-specific 2-thiouridylase MnmA 1 4.79e-02 2.82e-07 NA 0.4336
2. PF A2BSL2 tRNA-specific 2-thiouridylase MnmA 1.38e-02 1.10e-05 NA 0.415
2. PF C1A873 tRNA(Ile)-lysidine synthase 4.76e-09 7.35e-37 NA 0.4575
2. PF P9WG52 tRNA(Ile)-lysidine synthase 3.33e-16 4.14e-05 NA 0.6737
2. PF Q47KU2 tRNA(Ile)-lysidine synthase 0.00e+00 3.36e-03 NA 0.7226
2. PF A6WTS0 Argininosuccinate synthase 4.37e-03 2.32e-10 NA 0.5419
2. PF A8M8I3 tRNA(Ile)-lysidine synthase 0.00e+00 1.60e-05 NA 0.792
2. PF Q8Z7G9 tRNA-specific 2-thiouridylase MnmA 9.21e-02 5.71e-09 NA 0.503
2. PF A5IHA3 Argininosuccinate synthase 6.25e-03 3.92e-10 NA 0.512
2. PF A4YBT9 Argininosuccinate synthase 3.72e-03 2.00e-09 NA 0.5208
2. PF Q48H61 tRNA-specific 2-thiouridylase MnmA 5.76e-02 4.71e-07 NA 0.449
2. PF B2VGA8 Argininosuccinate synthase 5.21e-03 1.33e-10 NA 0.5464
2. PF Q83MT2 tRNA(Ile)-lysidine synthase 9.10e-15 2.08e-06 NA 0.596
2. PF Q5P2I9 tRNA(Ile)-lysidine synthase 2.49e-14 2.53e-55 NA 0.5719
2. PF A4XCT1 tRNA(Ile)-lysidine synthase 0.00e+00 3.79e-04 NA 0.7843
2. PF A1S264 Argininosuccinate synthase 4.38e-03 1.57e-11 NA 0.5257
2. PF O27322 Argininosuccinate synthase 1.31e-03 6.31e-11 NA 0.5343
2. PF Q5Z2W1 tRNA(Ile)-lysidine synthase 0.00e+00 6.23e-04 NA 0.6665
2. PF Q21K42 tRNA-specific 2-thiouridylase MnmA 6.49e-02 5.35e-08 NA 0.4945
2. PF B3QN91 Argininosuccinate synthase 4.11e-03 7.01e-11 NA 0.5244
2. PF Q02NB8 tRNA-specific 2-thiouridylase MnmA 5.38e-02 2.73e-09 NA 0.4827
2. PF Q9I0L2 tRNA-specific 2-thiouridylase MnmA 5.38e-02 2.73e-09 NA 0.4616
2. PF Q9KSX8 tRNA-specific 2-thiouridylase MnmA 2.94e-02 2.26e-09 NA 0.5096
2. PF B0TL85 Argininosuccinate synthase 4.30e-03 7.10e-12 NA 0.5362
2. PF C0ZNS6 tRNA(Ile)-lysidine synthase 0.00e+00 1.24e-03 NA 0.6841
2. PF Q1XDA4 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 6.23e-04 NA 0.7656
2. PF Q3ZJ89 tRNA(Ile)-lysidine synthase, chloroplastic 7.44e-03 6.48e-04 NA 0.7505
2. PF A3PEC4 tRNA-specific 2-thiouridylase MnmA 1.57e-02 7.23e-07 NA 0.4206
2. PF A5V0J9 Argininosuccinate synthase 4.59e-03 6.07e-11 NA 0.5339
2. PF Q7UA26 tRNA(Ile)-lysidine synthase 7.74e-13 1.86e-02 NA 0.6903
2. PF Q186Z6 Argininosuccinate synthase 4.92e-03 1.97e-09 NA 0.5193
2. PF P67152 tRNA(Ile)-lysidine synthase 2.22e-16 4.14e-05 NA 0.6763
2. PF B8EBG0 Argininosuccinate synthase 4.80e-03 2.32e-10 NA 0.5412
2. PF Q0HW33 tRNA-specific 2-thiouridylase MnmA 2.81e-02 4.18e-10 NA 0.4634
2. PF A6V4G0 tRNA-specific 2-thiouridylase MnmA 5.34e-02 6.69e-10 NA 0.4789
2. PF Q5WZ50 Argininosuccinate synthase 6.63e-03 2.26e-10 NA 0.5343
2. PF O20163 tRNA(Ile)-lysidine synthase, chloroplastic 6.23e-04 6.86e-04 NA 0.3759
2. PF Q8CWJ6 tRNA-specific 2-thiouridylase MnmA 1.28e-02 3.01e-09 NA 0.4895
2. PF A9IQK6 tRNA-specific 2-thiouridylase MnmA 2.01e-02 7.79e-08 NA 0.5375
2. PF Q7MBC9 tRNA-specific 2-thiouridylase MnmA 1.53e-02 3.16e-09 NA 0.4799
2. PF Q9A3H7 tRNA(Ile)-lysidine synthase 2.18e-07 5.81e-42 NA 0.4244
2. PF Q8A2F1 tRNA-specific 2-thiouridylase MnmA 2 9.14e-03 8.56e-08 NA 0.4709
2. PF C5BYK3 tRNA(Ile)-lysidine synthase 0.00e+00 3.90e-02 NA 0.7451
2. PF A9KTY7 Argininosuccinate synthase 4.39e-03 2.47e-10 NA 0.5381
2. PF A9L4G9 tRNA-specific 2-thiouridylase MnmA 2.78e-02 5.67e-10 NA 0.512
2. PF A5WCA0 tRNA(Ile)-lysidine synthase 5.75e-10 4.03e-42 NA 0.5436
2. PF Q2JRN8 tRNA(Ile)-lysidine synthase 0.00e+00 6.04e-07 NA 0.7134
2. PF Q469Z8 Argininosuccinate synthase 1.83e-03 3.28e-10 NA 0.5414
2. PF P51383 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 1.60e-02 NA 0.7179
2. PF Q5X7P9 Argininosuccinate synthase 9.83e-03 6.36e-10 NA 0.5115
2. PF Q2JY34 tRNA-specific 2-thiouridylase MnmA 5.50e-03 2.12e-07 NA 0.4815
2. PF B5ENY8 tRNA-specific 2-thiouridylase MnmA 1.20e-02 8.46e-08 NA 0.455
2. PF A8G1A4 Argininosuccinate synthase 5.41e-03 2.52e-12 NA 0.5395
2. PF Q8KDE0 Argininosuccinate synthase 3.54e-03 2.47e-11 NA 0.5259
2. PF Q18E36 Argininosuccinate synthase 1.12e-03 2.26e-12 NA 0.5433
2. PF O69538 tRNA(Ile)-lysidine synthase 1.11e-16 1.19e-02 NA 0.6746
2. PF A1RPR6 Argininosuccinate synthase 5.27e-03 9.90e-10 NA 0.514
2. PF Q83I94 tRNA(Ile)-lysidine synthase 5.11e-15 1.39e-09 NA 0.5464
2. PF A8G6A1 tRNA-specific 2-thiouridylase MnmA 1.43e-02 8.37e-07 NA 0.4955
2. PF A3Q9C9 Argininosuccinate synthase 4.21e-03 4.54e-11 NA 0.5195
2. PF A2C5I6 Argininosuccinate synthase 6.52e-03 3.09e-13 NA 0.517
2. PF B1ILH4 tRNA-specific 2-thiouridylase MnmA 1 2.06e-02 8.66e-07 NA 0.4858
2. PF Q12SM7 Argininosuccinate synthase 4.40e-03 5.19e-10 NA 0.5351
2. PF Q744A3 tRNA(Ile)-lysidine synthase 3.33e-16 2.06e-05 NA 0.7067
2. PF Q319J8 tRNA-specific 2-thiouridylase MnmA 2.10e-02 1.24e-06 NA 0.4631
2. PF Q64ZW2 tRNA-specific 2-thiouridylase MnmA 1 1.09e-02 5.95e-08 NA 0.4685
2. PF Q98F87 tRNA(Ile)-lysidine synthase 7.75e-13 2.38e-50 NA 0.6051
2. PF Q8TWU0 Argininosuccinate synthase 1.65e-03 3.59e-10 NA 0.5531
2. PF B7UV15 tRNA-specific 2-thiouridylase MnmA 5.20e-02 1.85e-09 NA 0.4789
2. PF Q9K4Z3 Argininosuccinate synthase 8.88e-03 4.66e-12 NA 0.5266
2. PF Q8EK28 Argininosuccinate synthase 4.15e-03 8.62e-10 NA 0.5152
2. PF A7MSW1 tRNA-specific 2-thiouridylase MnmA 1.69e-02 5.11e-09 NA 0.4837
2. PF Q5LIS5 tRNA-specific 2-thiouridylase MnmA 1 9.88e-03 5.88e-08 NA 0.4739
2. PF A4SZU5 tRNA-specific 2-thiouridylase MnmA 7.70e-02 6.18e-07 NA 0.4751
2. PF B0TQ02 tRNA-specific 2-thiouridylase MnmA 5.26e-02 7.03e-09 NA 0.5133
2. PF A6KZ28 tRNA-specific 2-thiouridylase MnmA 2 7.74e-03 3.79e-08 NA 0.4399
3. BF Q822B9 tRNA(Ile)-lysidine synthase 0.00e+00 NA 2.19e-19 0.738
3. BF A9BJK2 tRNA(Ile)-lysidine synthase 5.16e-13 NA 2.59e-15 0.6663
3. BF Q7V9L9 tRNA(Ile)-lysidine synthase 0.00e+00 NA 2.43e-06 0.7417
3. BF Q8M9Y1 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 NA 4.08e-05 0.642
3. BF Q1GJX4 tRNA-cytidine(32) 2-sulfurtransferase 3.00e-10 NA 0.004 0.6503
3. BF Q7WLK7 tRNA(Ile)-lysidine synthase 0.00e+00 NA 1.82e-09 0.7298
3. BF Q7W859 tRNA(Ile)-lysidine synthase 0.00e+00 NA 1.82e-09 0.7212
3. BF Q8FMG0 tRNA(Ile)-lysidine synthase 2.22e-16 NA 2.47e-09 0.7206
3. BF Q9T390 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 NA 1.05e-07 0.6653
3. BF Q47ZU5 tRNA-cytidine(32) 2-sulfurtransferase 2.47e-09 NA 0.032 0.6701
3. BF Q724J4 Bifunctional protein TilS/HprT 0.00e+00 NA 2.28e-26 0.7644
3. BF Q9RV23 tRNA(Ile)-lysidine synthase 8.55e-15 NA 7.39e-16 0.6133
3. BF C3MD80 tRNA-cytidine(32) 2-sulfurtransferase 1.61e-09 NA 3.23e-04 0.6939
3. BF Q7UZL1 tRNA(Ile)-lysidine synthase 0.00e+00 NA 5.25e-04 0.741
3. BF Q2EEX9 tRNA(Ile)-lysidine synthase, plastid 6.43e-10 NA 0.015 0.6359
3. BF Q7CYD2 tRNA-cytidine(32) 2-sulfurtransferase 1.82e-09 NA 0.019 0.7058
3. BF A6U9M6 tRNA-cytidine(32) 2-sulfurtransferase 1.74e-09 NA 2.29e-05 0.6877
3. BF Q9MUR3 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 NA 2.52e-06 0.6615
3. BF Q7NNL0 tRNA(Ile)-lysidine synthase 0.00e+00 NA 2.84e-11 0.7349
3. BF Q92F56 Bifunctional protein TilS/HprT 0.00e+00 NA 2.06e-29 0.7451
3. BF Q6M2E8 tRNA(Ile)-lysidine synthase 0.00e+00 NA 7.41e-05 0.727
3. BF Q6B8L1 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 NA 0.003 0.7686
3. BF Q16A99 tRNA-cytidine(32) 2-sulfurtransferase 4.20e-10 NA 8.67e-05 0.7332
3. BF Q7V987 tRNA(Ile)-lysidine synthase 0.00e+00 NA 3.54e-08 0.7137
3. BF Q92PH1 tRNA-cytidine(32) 2-sulfurtransferase 1.14e-09 NA 2.66e-04 0.6922
3. BF A4WWJ3 tRNA-cytidine(32) 2-sulfurtransferase 8.05e-10 NA 9.00e-04 0.7176
3. BF Q8YAC7 Bifunctional protein TilS/HprT 0.00e+00 NA 1.19e-26 0.7556
4. PB Q10441 Probable tRNA(Ile)-lysidine synthase 1.10e-07 4.72e-43 6.73e-13 NA
4. PB P52097 tRNA(Ile)-lysidine synthase 4.71e-12 4.63e-56 2.61e-11 NA
4. PB Q72W10 tRNA(Ile)-lysidine synthase 1.26e-08 2.83e-37 2.06e-04 NA
5. P A1AQ29 tRNA-specific 2-thiouridylase MnmA 1.63e-02 5.48e-08 NA NA
5. P B9LK98 tRNA-specific 2-thiouridylase MnmA 2.58e-02 5.44e-09 NA NA
5. P Q9PDD9 tRNA-specific 2-thiouridylase MnmA 2.62e-02 1.76e-09 NA NA
5. P Q0RDH6 tRNA-specific 2-thiouridylase MnmA 1.21e-02 2.47e-09 NA NA
5. P A8IQ54 Argininosuccinate synthase 4.33e-03 5.82e-13 NA NA
5. P Q1IBE4 tRNA-specific 2-thiouridylase MnmA 4.73e-02 3.76e-09 NA NA
5. P P59607 Argininosuccinate synthase 8.48e-03 3.32e-13 NA NA
5. P C1CI29 tRNA-specific 2-thiouridylase MnmA 7.09e-03 1.02e-09 NA NA
5. P B7M079 Argininosuccinate synthase 9.03e-03 5.49e-12 NA NA
5. P P00966 Argininosuccinate synthase 7.56e-03 8.53e-11 NA NA
5. P Q6D4E9 tRNA-specific 2-thiouridylase MnmA 8.88e-02 9.77e-09 NA NA
5. P Q3J358 tRNA-specific 2-thiouridylase MnmA 6.88e-02 4.57e-06 NA NA
5. P A7HSW4 Argininosuccinate synthase 9.86e-03 2.17e-12 NA NA
5. P A1R591 Argininosuccinate synthase 2.80e-03 6.78e-09 NA NA
5. P Q2FLD8 Argininosuccinate synthase 3.51e-03 1.09e-12 NA NA
5. P A5VJ48 tRNA-specific 2-thiouridylase MnmA 1.93e-02 7.69e-11 NA NA
5. P C0ZXK1 tRNA-specific 2-thiouridylase MnmA 1.46e-02 2.13e-06 NA NA
5. P C1DQV2 Argininosuccinate synthase 9.55e-03 1.06e-11 NA NA
5. P Q5P7R7 tRNA-specific 2-thiouridylase MnmA 1.61e-02 4.10e-09 NA NA
5. P Q1MC84 tRNA-specific 2-thiouridylase MnmA 2.32e-02 1.06e-08 NA NA
5. P P58074 tRNA-specific 2-thiouridylase MnmA 2.08e-02 9.29e-08 NA NA
5. P A6W7K7 tRNA-specific 2-thiouridylase MnmA 2.26e-02 1.66e-09 NA NA
5. P Q8Y714 tRNA-specific 2-thiouridylase MnmA 7.85e-02 2.60e-10 NA NA
5. P Q8NZ00 tRNA-specific 2-thiouridylase MnmA 6.94e-03 4.29e-10 NA NA
5. P Q827Z1 Argininosuccinate synthase 2.62e-03 3.82e-10 NA NA
5. P B2SY63 Argininosuccinate synthase 1.03e-02 9.30e-12 NA NA
5. P B9M374 Argininosuccinate synthase 6.89e-03 5.32e-11 NA NA
5. P A0LSQ2 tRNA-specific 2-thiouridylase MnmA 2.31e-02 1.48e-09 NA NA
5. P Q313S6 tRNA-specific 2-thiouridylase MnmA 2.33e-02 1.03e-07 NA NA
5. P B5ED13 Argininosuccinate synthase 7.35e-03 1.87e-11 NA NA
5. P Q0S2J4 tRNA-specific 2-thiouridylase MnmA 2.29e-02 3.21e-08 NA NA
5. P B9KG97 Argininosuccinate synthase 1.00e-02 3.68e-11 NA NA
5. P Q7U3B9 Argininosuccinate synthase 6.64e-03 3.91e-12 NA NA
5. P P61522 Argininosuccinate synthase 1.17e-02 8.65e-11 NA NA
5. P P61525 Argininosuccinate synthase 3.18e-03 1.21e-10 NA NA
5. P A6W0E1 tRNA-specific 2-thiouridylase MnmA 5.64e-02 3.40e-04 NA NA
5. P A3CQQ4 Argininosuccinate synthase 3.16e-03 9.90e-10 NA NA
5. P A1WUZ5 Argininosuccinate synthase 5.19e-03 3.58e-11 NA NA
5. P Q5LWG3 Argininosuccinate synthase 1.09e-02 1.23e-10 NA NA
5. P A1AA27 tRNA-specific 2-thiouridylase MnmA 9.33e-02 4.20e-09 NA NA
5. P B7MB92 Argininosuccinate synthase 1.17e-02 7.30e-12 NA NA
5. P A2CB44 tRNA-specific 2-thiouridylase MnmA 1.81e-02 4.48e-08 NA NA
5. P Q71ZF8 tRNA-specific 2-thiouridylase MnmA 7.24e-02 3.07e-10 NA NA
5. P O35020 tRNA-specific 2-thiouridylase MnmA 1.02e-01 4.02e-10 NA NA
5. P Q5LFN5 tRNA-specific 2-thiouridylase MnmA 2 5.65e-02 3.68e-10 NA NA
5. P Q96Y23 GMP synthase [glutamine-hydrolyzing] subunit B 1.15e-03 1.52e-02 NA NA
5. P B2S746 tRNA-specific 2-thiouridylase MnmA 1.66e-02 6.11e-07 NA NA
5. P Q2GFW6 tRNA-specific 2-thiouridylase MnmA 1.06e-02 4.49e-05 NA NA
5. P B8ESL2 Argininosuccinate synthase 6.42e-03 2.11e-12 NA NA
5. P Q63QY5 tRNA-specific 2-thiouridylase MnmA 9.45e-02 3.79e-08 NA NA
5. P C0R1H5 Argininosuccinate synthase 7.09e-03 5.27e-12 NA NA
5. P A0QHA8 Argininosuccinate synthase 3.47e-03 4.79e-11 NA NA
5. P Q8CWW0 tRNA-specific 2-thiouridylase MnmA 7.16e-03 1.64e-09 NA NA
5. P Q14FW2 tRNA-specific 2-thiouridylase MnmA 1.75e-02 6.86e-10 NA NA
5. P A5E8P0 Argininosuccinate synthase 8.81e-03 2.49e-12 NA NA
5. P A0QJE5 tRNA-specific 2-thiouridylase MnmA 1.89e-02 1.16e-08 NA NA
5. P C3LRV3 Argininosuccinate synthase 4.24e-03 3.23e-12 NA NA
5. P A4FMT5 tRNA-specific 2-thiouridylase MnmA 3.69e-02 1.51e-08 NA NA
5. P A1ATU4 Argininosuccinate synthase 7.75e-03 4.79e-12 NA NA
5. P P61521 Argininosuccinate synthase 3.78e-03 2.07e-09 NA NA
5. P Q03W70 Argininosuccinate synthase 3.92e-03 1.13e-08 NA NA
5. P B0T3Z9 Argininosuccinate synthase 8.91e-03 3.27e-12 NA NA
5. P A5WE20 tRNA-specific 2-thiouridylase MnmA 3.34e-02 8.18e-07 NA NA
5. P A6TUB2 tRNA-specific 2-thiouridylase MnmA 9.04e-02 6.69e-10 NA NA
5. P Q5MZ36 tRNA-specific 2-thiouridylase MnmA 6.59e-03 1.97e-09 NA NA
5. P B0K4D8 Argininosuccinate synthase 3.98e-03 7.69e-11 NA NA
5. P Q0T5N9 tRNA-specific 2-thiouridylase MnmA 5.86e-02 3.90e-09 NA NA
5. P Q1QHE6 Argininosuccinate synthase 5.26e-03 6.86e-14 NA NA
5. P C1A3S5 Argininosuccinate synthase 1.10e-02 4.48e-12 NA NA
5. P Q1WV65 Argininosuccinate synthase 4.17e-03 1.54e-09 NA NA
5. P Q7PR38 Argininosuccinate synthase 7.95e-03 1.09e-11 NA NA
5. P A8GZ21 Argininosuccinate synthase 3.81e-03 5.13e-12 NA NA
5. P A0JYI6 tRNA-specific 2-thiouridylase MnmA 2.81e-02 1.13e-08 NA NA
5. P B0BBR8 tRNA-specific 2-thiouridylase MnmA 1.44e-02 3.01e-09 NA NA
5. P A0RJM4 Argininosuccinate synthase 3.34e-03 4.99e-09 NA NA
5. P Q7MH72 Argininosuccinate synthase 6.37e-03 8.13e-13 NA NA
5. P Q2RHY7 tRNA-specific 2-thiouridylase MnmA 2.22e-02 3.05e-07 NA NA
5. P Q2FIB4 Argininosuccinate synthase 4.31e-03 7.94e-09 NA NA
5. P B0CE39 tRNA-specific 2-thiouridylase MnmA 5.48e-03 3.32e-09 NA NA
5. P B6ISD0 tRNA-specific 2-thiouridylase MnmA 2.15e-02 7.38e-09 NA NA
5. P A6SUW6 tRNA-specific 2-thiouridylase MnmA 2.15e-02 9.78e-10 NA NA
5. P A8FJL3 tRNA-specific 2-thiouridylase MnmA 2.30e-02 1.95e-09 NA NA
5. P Q1GCK1 Argininosuccinate synthase 1.03e-02 4.54e-11 NA NA
5. P Q8R7C2 Argininosuccinate synthase 4.08e-03 1.70e-10 NA NA
5. P B0VBY5 tRNA-specific 2-thiouridylase MnmA 1.54e-02 8.26e-08 NA NA
5. P A2BZ94 Argininosuccinate synthase 1.01e-02 7.99e-11 NA NA
5. P Q730D7 tRNA-specific 2-thiouridylase MnmA 2.77e-02 2.53e-08 NA NA
5. P B0B7K3 tRNA-specific 2-thiouridylase MnmA 1.06e-02 3.01e-09 NA NA
5. P A4JBM2 tRNA-specific 2-thiouridylase MnmA 9.59e-02 4.87e-09 NA NA
5. P Q6G2J9 tRNA-specific 2-thiouridylase MnmA 1.18e-02 3.66e-08 NA NA
5. P B0SPC6 tRNA-specific 2-thiouridylase MnmA 1.58e-02 4.64e-08 NA NA
5. P A0QYS6 Argininosuccinate synthase 3.34e-03 2.94e-11 NA NA
5. P A1V076 tRNA-specific 2-thiouridylase MnmA 9.08e-02 3.89e-08 NA NA
5. P A5W1G2 tRNA-specific 2-thiouridylase MnmA 4.81e-02 1.08e-08 NA NA
5. P Q3SHT1 Argininosuccinate synthase 9.32e-03 4.36e-12 NA NA
5. P Q98E81 Argininosuccinate synthase 5.96e-03 1.28e-12 NA NA
5. P A8LK49 tRNA-specific 2-thiouridylase MnmA 8.98e-02 1.04e-06 NA NA
5. P A9W8W7 tRNA-specific 2-thiouridylase MnmA 2.25e-02 8.85e-07 NA NA
5. P Q11D10 Argininosuccinate synthase 9.54e-03 6.92e-11 NA NA
5. P Q8NXF2 Argininosuccinate synthase 3.51e-03 7.20e-09 NA NA
5. P Q2SRW8 tRNA-specific 2-thiouridylase MnmA 1.34e-02 1.58e-08 NA NA
5. P Q1H0L1 Argininosuccinate synthase 1.07e-02 3.41e-12 NA NA
5. P Q1Q9L2 Argininosuccinate synthase 7.25e-03 2.05e-12 NA NA
5. P Q32BG2 Argininosuccinate synthase 9.05e-03 8.02e-12 NA NA
5. P B1KXY1 Argininosuccinate synthase 5.03e-03 3.68e-11 NA NA
5. P Q9CLA3 tRNA-specific 2-thiouridylase MnmA 1.45e-01 6.46e-07 NA NA
5. P B0S9J6 Argininosuccinate synthase 2.68e-03 1.42e-08 NA NA
5. P Q4FNX4 Argininosuccinate synthase 6.36e-03 3.36e-10 NA NA
5. P Q8KA60 Argininosuccinate synthase 4.32e-03 2.03e-12 NA NA
5. P A7GHC7 tRNA-specific 2-thiouridylase MnmA 2 1.72e-02 9.36e-07 NA NA
5. P Q3Z8D8 tRNA-specific 2-thiouridylase MnmA 1.54e-02 1.25e-06 NA NA
5. P A1S7B1 tRNA-specific 2-thiouridylase MnmA 9.95e-02 3.89e-08 NA NA
5. P Q59491 Argininosuccinate synthase 2.61e-03 8.86e-08 NA NA
5. P Q60174 Argininosuccinate synthase 1.53e-03 2.11e-08 NA NA
5. P Q812R6 tRNA-specific 2-thiouridylase MnmA 2.79e-02 2.04e-08 NA NA
5. P A5I123 tRNA-specific 2-thiouridylase MnmA 1 1.01e-02 7.15e-07 NA NA
5. P Q118B7 tRNA-specific 2-thiouridylase MnmA 1.44e-02 1.81e-08 NA NA
5. P Q5P0Z7 Argininosuccinate synthase 1.07e-02 5.32e-11 NA NA
5. P A4WEY6 Argininosuccinate synthase 9.10e-03 3.50e-12 NA NA
5. P A3DBU1 Argininosuccinate synthase 3.75e-03 7.59e-11 NA NA
5. P A8FL83 Argininosuccinate synthase 1.08e-02 1.75e-11 NA NA
5. P B4T702 Argininosuccinate synthase 1.15e-02 1.09e-11 NA NA
5. P A7NK07 tRNA-specific 2-thiouridylase MnmA 1.29e-02 1.47e-08 NA NA
5. P A5FZD5 tRNA-specific 2-thiouridylase MnmA 8.90e-02 4.81e-10 NA NA
5. P Q11UP4 tRNA-specific 2-thiouridylase MnmA 1.03e-02 5.15e-07 NA NA
5. P A5GMJ9 tRNA-specific 2-thiouridylase MnmA 1.68e-02 1.85e-08 NA NA
5. P A5I5Y9 tRNA-specific 2-thiouridylase MnmA 2 1.07e-01 7.65e-07 NA NA
5. P Q4QP16 tRNA-specific 2-thiouridylase MnmA 3.14e-02 6.99e-07 NA NA
5. P A7I281 Argininosuccinate synthase 9.29e-03 2.43e-14 NA NA
5. P A1VXD7 tRNA-specific 2-thiouridylase MnmA 2.28e-02 1.36e-09 NA NA
5. P A9NDN1 tRNA-specific 2-thiouridylase MnmA 1.35e-02 9.89e-09 NA NA
5. P Q8DRI5 Argininosuccinate synthase 5.28e-03 4.81e-10 NA NA
5. P A5CW80 tRNA-specific 2-thiouridylase MnmA 2.59e-02 2.79e-09 NA NA
5. P Q73VF7 tRNA-specific 2-thiouridylase MnmA 1.85e-02 7.12e-09 NA NA
5. P Q1MEZ8 Argininosuccinate synthase 1 8.45e-03 4.20e-11 NA NA
5. P O28032 Argininosuccinate synthase 2.21e-03 1.11e-07 NA NA
5. P A8MEV9 tRNA-specific 2-thiouridylase MnmA 4.86e-02 4.93e-10 NA NA
5. P Q4FSB4 tRNA-specific 2-thiouridylase MnmA 3.87e-02 5.74e-06 NA NA
5. P A2BJL6 Argininosuccinate synthase 5.80e-03 2.38e-11 NA NA
5. P Q081F9 tRNA-specific 2-thiouridylase MnmA 3.26e-02 1.97e-09 NA NA
5. P P57799 Argininosuccinate synthase 2.59e-03 5.16e-08 NA NA
5. P A4YI75 Argininosuccinate synthase 9.71e-03 2.44e-10 NA NA
5. P A7GYN4 Argininosuccinate synthase 6.85e-03 1.62e-12 NA NA
5. P A1WEN1 tRNA-specific 2-thiouridylase MnmA 3.32e-02 1.70e-09 NA NA
5. P Q5LXZ8 Argininosuccinate synthase 3.24e-03 3.00e-10 NA NA
5. P A7ZEK1 tRNA-specific 2-thiouridylase MnmA 3.43e-02 6.77e-08 NA NA
5. P B5ZNK8 tRNA-specific 2-thiouridylase MnmA 2.23e-02 6.86e-10 NA NA
5. P B4S7R9 Argininosuccinate synthase 3.95e-03 6.37e-09 NA NA
5. P B8ZK04 tRNA-specific 2-thiouridylase MnmA 7.15e-03 7.99e-10 NA NA
5. P B1GZY9 tRNA-specific 2-thiouridylase MnmA 1.77e-02 1.04e-06 NA NA
5. P A5CFJ6 tRNA-specific 2-thiouridylase MnmA 7.44e-02 1.20e-04 NA NA
5. P B8DN64 Argininosuccinate synthase 1.06e-02 3.19e-10 NA NA
5. P Q6LT18 tRNA-specific 2-thiouridylase MnmA 2.06e-02 4.55e-07 NA NA
5. P A9EXM5 tRNA-specific 2-thiouridylase MnmA 9.10e-03 2.77e-06 NA NA
5. P P0A585 Glucose-6-phosphate 1-dehydrogenase 2 7.32e-02 2.91e-02 NA NA
5. P B6J7H5 tRNA-specific 2-thiouridylase MnmA 2.16e-02 1.86e-07 NA NA
5. P A1K7J8 Argininosuccinate synthase 1.02e-02 1.34e-11 NA NA
5. P A6WP69 tRNA-specific 2-thiouridylase MnmA 9.18e-03 4.93e-10 NA NA
5. P Q7U320 tRNA-specific 2-thiouridylase MnmA 3.11e-02 3.45e-09 NA NA
5. P A6T7K3 tRNA-specific 2-thiouridylase MnmA 9.74e-02 1.53e-07 NA NA
5. P Q5M8Z6 Argininosuccinate synthase 9.28e-03 4.20e-11 NA NA
5. P Q7NCP5 Argininosuccinate synthase 6.35e-03 3.69e-14 NA NA
5. P A3DA23 Argininosuccinate synthase 4.10e-03 2.32e-10 NA NA
5. P Q7TTQ1 tRNA-specific 2-thiouridylase MnmA 2.11e-02 9.05e-07 NA NA
5. P Q2SZ45 tRNA-specific 2-thiouridylase MnmA 8.32e-02 8.14e-09 NA NA
5. P Q2K3B7 Argininosuccinate synthase 3.18e-03 8.81e-12 NA NA
5. P A6WZ88 tRNA-specific 2-thiouridylase MnmA 1.59e-02 1.49e-06 NA NA
5. P B0CCQ2 Argininosuccinate synthase 2.90e-03 3.14e-12 NA NA
5. P B1IQV0 Argininosuccinate synthase 1.19e-02 7.20e-12 NA NA
5. P A0AKJ7 Argininosuccinate synthase 3.76e-03 1.49e-08 NA NA
5. P A0Q1Z2 Argininosuccinate synthase 6.49e-03 3.87e-10 NA NA
5. P A4X484 tRNA-specific 2-thiouridylase MnmA 1.67e-02 7.70e-08 NA NA
5. P B0UIW7 tRNA-specific 2-thiouridylase MnmA 1.52e-02 2.38e-06 NA NA
5. P Q9HY84 Argininosuccinate synthase 8.25e-03 4.99e-12 NA NA
5. P B8HGC9 Argininosuccinate synthase 3.46e-03 1.77e-08 NA NA
5. P B1JPT9 Argininosuccinate synthase 1.27e-02 1.68e-11 NA NA
5. P C6DFW7 tRNA-specific 2-thiouridylase MnmA 9.10e-02 7.85e-09 NA NA
5. P A6VVI2 Argininosuccinate synthase 9.64e-03 5.27e-13 NA NA
5. P Q2FZU1 Argininosuccinate synthase 3.84e-03 7.94e-09 NA NA
5. P A8YUQ2 tRNA-specific 2-thiouridylase MnmA 8.69e-03 9.18e-10 NA NA
5. P P44315 Argininosuccinate synthase 8.23e-03 1.02e-11 NA NA
5. P A1TWB8 tRNA-specific 2-thiouridylase MnmA 3.23e-02 1.14e-08 NA NA
5. P A5IJQ4 tRNA-specific 2-thiouridylase MnmA 2.10e-02 1.81e-08 NA NA
5. P P13256 Argininosuccinate synthase 2.64e-03 3.78e-11 NA NA
5. P Q9UX31 Argininosuccinate synthase 5.17e-03 6.64e-12 NA NA
5. P Q8G376 Argininosuccinate synthase 1.03e-02 2.05e-11 NA NA
5. P B2THM7 tRNA-specific 2-thiouridylase MnmA 2.31e-02 1.97e-06 NA NA
5. P Q98HL0 tRNA-specific 2-thiouridylase MnmA 3.35e-02 3.75e-07 NA NA
5. P Q2G933 Argininosuccinate synthase 9.63e-03 1.37e-11 NA NA
5. P B2G6Y6 Argininosuccinate synthase 5.02e-03 2.05e-09 NA NA
5. P Q9X2A1 Argininosuccinate synthase 4.84e-03 3.36e-09 NA NA
5. P A6W614 Argininosuccinate synthase 1.28e-02 3.24e-09 NA NA
5. P B9DIU4 Argininosuccinate synthase 3.49e-03 1.26e-07 NA NA
5. P Q5ZVQ1 tRNA-specific 2-thiouridylase MnmA 2.93e-02 2.04e-10 NA NA
5. P P59603 Argininosuccinate synthase 3.63e-03 1.40e-07 NA NA
5. P P25745 tRNA-specific 2-thiouridylase MnmA 1.06e-01 3.81e-09 NA NA
5. P C1D9Q4 Argininosuccinate synthase 6.68e-03 1.12e-12 NA NA
5. P Q6MA75 tRNA-specific 2-thiouridylase MnmA 2.67e-02 1.74e-09 NA NA
5. P A4JLD9 Argininosuccinate synthase 1.15e-02 1.04e-11 NA NA
5. P B5FBP4 Argininosuccinate synthase 5.30e-03 8.46e-12 NA NA
5. P Q3AV73 tRNA-specific 2-thiouridylase MnmA 1.01e-02 1.01e-06 NA NA
5. P Q0TIU0 tRNA-specific 2-thiouridylase MnmA 7.60e-02 4.20e-09 NA NA
5. P Q3BTY6 tRNA-specific 2-thiouridylase MnmA 2.75e-02 1.24e-09 NA NA
5. P Q47SD2 tRNA-specific 2-thiouridylase MnmA 1.29e-02 4.81e-08 NA NA
5. P Q8PL08 tRNA-specific 2-thiouridylase MnmA 2.63e-02 2.35e-09 NA NA
5. P A7MXB9 Argininosuccinate synthase 3.76e-03 1.22e-12 NA NA
5. P Q2K4M8 tRNA-specific 2-thiouridylase MnmA 2.59e-02 8.04e-09 NA NA
5. P Q2T1W2 Argininosuccinate synthase 1.07e-02 6.15e-11 NA NA
5. P Q2YT57 tRNA-specific 2-thiouridylase MnmA 1.24e-02 9.08e-09 NA NA
5. P Q3KA70 tRNA-specific 2-thiouridylase MnmA 5.02e-02 1.84e-07 NA NA
5. P Q63U95 Argininosuccinate synthase 3.42e-03 1.19e-11 NA NA
5. P Q4J8F1 Argininosuccinate synthase 1.19e-02 2.31e-11 NA NA
5. P A7ML85 Argininosuccinate synthase 4.22e-03 5.46e-10 NA NA
5. P Q1BLH4 Argininosuccinate synthase 1.15e-02 8.24e-12 NA NA
5. P A4G3H1 Argininosuccinate synthase 1.28e-02 1.61e-11 NA NA
5. P Q8RAH7 tRNA-specific 2-thiouridylase MnmA 1 8.93e-03 2.30e-08 NA NA
5. P B8D6W2 Argininosuccinate synthase 3.57e-03 1.81e-12 NA NA
5. P A7GCM3 tRNA-specific 2-thiouridylase MnmA 1 3.40e-02 2.43e-06 NA NA
5. P Q2IHX6 tRNA-specific 2-thiouridylase MnmA 7.94e-02 3.03e-08 NA NA
5. P Q68X66 tRNA-specific 2-thiouridylase MnmA 8.23e-03 3.42e-07 NA NA
5. P Q4UM73 tRNA-specific 2-thiouridylase MnmA 1.46e-02 7.65e-07 NA NA
5. P Q3JYG1 tRNA-specific 2-thiouridylase MnmA 6.85e-03 1.48e-09 NA NA
5. P Q81KV7 Argininosuccinate synthase 3.34e-03 4.87e-09 NA NA
5. P Q5PMJ4 tRNA-specific 2-thiouridylase MnmA 5.82e-02 5.71e-09 NA NA
5. P C1AGE1 tRNA-specific 2-thiouridylase MnmA 2.30e-02 4.02e-06 NA NA
5. P A9BIS3 tRNA-specific 2-thiouridylase MnmA 1.61e-02 2.99e-06 NA NA
5. P Q13UR1 Argininosuccinate synthase 9.06e-03 1.03e-12 NA NA
5. P Q97A55 Argininosuccinate synthase 3.12e-03 7.29e-11 NA NA
5. P Q1GRI1 tRNA-specific 2-thiouridylase MnmA 6.33e-02 5.41e-05 NA NA
5. P A3MYN0 tRNA-specific 2-thiouridylase MnmA 3.04e-02 5.46e-07 NA NA
5. P B0UWF2 tRNA-specific 2-thiouridylase MnmA 9.06e-02 1.93e-07 NA NA
5. P A1UE63 tRNA-specific 2-thiouridylase MnmA 1.81e-02 1.23e-07 NA NA
5. P O86583 tRNA-specific 2-thiouridylase MnmA 6.71e-02 1.05e-08 NA NA
5. P Q74A22 tRNA-specific 2-thiouridylase MnmA 1.62e-02 2.27e-08 NA NA
5. P A7ZKS3 tRNA-specific 2-thiouridylase MnmA 1.01e-01 3.81e-09 NA NA
5. P Q0HDU8 Argininosuccinate synthase 4.41e-03 5.32e-10 NA NA
5. P Q8NW84 tRNA-specific 2-thiouridylase MnmA 1.06e-02 4.99e-09 NA NA
5. P A5CXM9 Argininosuccinate synthase 5.91e-03 1.28e-11 NA NA
5. P Q4K9U2 tRNA-specific 2-thiouridylase MnmA 4.96e-02 1.13e-08 NA NA
5. P Q058D6 Argininosuccinate synthase 1.06e-02 5.32e-10 NA NA
5. P A9IWH0 tRNA-specific 2-thiouridylase MnmA 1.07e-02 4.07e-08 NA NA
5. P Q0TTA5 Argininosuccinate synthase 4.95e-03 2.69e-09 NA NA
5. P B2S7X3 Argininosuccinate synthase 9.95e-03 3.49e-11 NA NA
5. P Q8NR24 tRNA-specific 2-thiouridylase MnmA 1.80e-02 9.62e-08 NA NA
5. P B9MBJ2 Argininosuccinate synthase 1.46e-02 4.54e-12 NA NA
5. P B2I9X8 tRNA-specific 2-thiouridylase MnmA 2.62e-02 1.20e-09 NA NA
5. P Q8P9A1 tRNA-specific 2-thiouridylase MnmA 2.83e-02 5.30e-09 NA NA
5. P B1I677 tRNA-specific 2-thiouridylase MnmA 1.47e-02 4.50e-07 NA NA
5. P Q06734 Argininosuccinate synthase 5.16e-02 5.33e-07 NA NA
5. P Q1IE03 Argininosuccinate synthase 8.14e-03 7.91e-12 NA NA
5. P P57158 Argininosuccinate synthase 3.42e-03 1.81e-12 NA NA
5. P Q3ASI2 Argininosuccinate synthase 4.63e-03 1.11e-10 NA NA
5. P C5CUG9 Argininosuccinate synthase 1.14e-02 4.20e-11 NA NA
5. P A7GZX4 tRNA-specific 2-thiouridylase MnmA 3.55e-02 4.87e-09 NA NA
5. P Q67KE1 Argininosuccinate synthase 5.84e-03 5.99e-11 NA NA
5. P Q6MLR7 tRNA-specific 2-thiouridylase MnmA 9.04e-03 4.25e-07 NA NA
5. P Q7TTZ4 tRNA-specific 2-thiouridylase MnmA 1.72e-02 5.74e-06 NA NA
5. P A9M6S7 Argininosuccinate synthase 2.83e-03 3.49e-11 NA NA
5. P B1LI10 tRNA-specific 2-thiouridylase MnmA 5.85e-02 3.49e-09 NA NA
5. P Q7WKW7 Argininosuccinate synthase 8.57e-03 4.37e-11 NA NA
5. P Q5FH27 Argininosuccinate synthase 1.34e-02 1.58e-12 NA NA
5. P P59602 Argininosuccinate synthase 4.71e-03 1.08e-10 NA NA
5. P B4EE50 tRNA-specific 2-thiouridylase MnmA 6.03e-02 4.27e-08 NA NA
5. P Q0RFB2 Argininosuccinate synthase 2.49e-03 2.73e-09 NA NA
5. P C1ASZ6 Argininosuccinate synthase 4.74e-03 8.42e-11 NA NA
5. P A0KFV3 Argininosuccinate synthase 5.55e-03 2.38e-10 NA NA
5. P Q81JE5 tRNA-specific 2-thiouridylase MnmA 2.74e-02 1.90e-08 NA NA
5. P O67274 tRNA-specific 2-thiouridylase MnmA 1.80e-02 2.76e-07 NA NA
5. P B6IVD0 Argininosuccinate synthase 8.43e-03 3.82e-13 NA NA
5. P Q1GGT2 tRNA-specific 2-thiouridylase MnmA 6.32e-02 3.16e-06 NA NA
5. P A8FUG9 tRNA-specific 2-thiouridylase MnmA 7.02e-02 8.75e-09 NA NA
5. P B8HSA9 Argininosuccinate synthase 6.40e-03 8.70e-12 NA NA
5. P B2UPK4 tRNA-specific 2-thiouridylase MnmA 5.96e-02 1.79e-08 NA NA
5. P Q1BZ27 tRNA-specific 2-thiouridylase MnmA 4.93e-02 2.33e-08 NA NA
5. P P9WN73 Glucose-6-phosphate 1-dehydrogenase 2 7.63e-02 2.91e-02 NA NA
5. P A7GTR5 Argininosuccinate synthase 3.28e-03 4.25e-09 NA NA
5. P B1J4I4 Argininosuccinate synthase 1.12e-02 1.19e-11 NA NA
5. P Q04FC0 Argininosuccinate synthase 4.48e-03 4.69e-10 NA NA
5. P A6Q941 tRNA-specific 2-thiouridylase MnmA 1.68e-02 6.93e-08 NA NA
5. P B5E605 tRNA-specific 2-thiouridylase MnmA NA 1.54e-09 NA NA
5. P Q9ABU1 Argininosuccinate synthase 9.36e-03 2.64e-11 NA NA
5. P A0AIW1 tRNA-specific 2-thiouridylase MnmA 8.29e-02 3.59e-10 NA NA
5. P Q72Q44 tRNA-specific 2-thiouridylase MnmA 1.73e-02 1.38e-06 NA NA
5. P Q8Q0U5 Argininosuccinate synthase 2.16e-03 1.97e-09 NA NA
5. P A6QAX6 Argininosuccinate synthase 6.78e-03 4.04e-11 NA NA
5. P Q73PV6 tRNA-specific 2-thiouridylase MnmA 1.44e-02 2.30e-08 NA NA
5. P A6UE09 Argininosuccinate synthase 4.50e-03 3.85e-12 NA NA
5. P P61523 Argininosuccinate synthase 6.68e-03 9.11e-11 NA NA
5. P Q8YEK8 Argininosuccinate synthase 3.23e-03 3.49e-11 NA NA
5. P C1F792 tRNA-specific 2-thiouridylase MnmA 1.02e-02 1.30e-07 NA NA
5. P B0CII7 Argininosuccinate synthase 4.84e-03 3.49e-11 NA NA
5. P Q5GTC8 tRNA-specific 2-thiouridylase MnmA 1.28e-02 9.20e-05 NA NA
5. P Q2SJL8 tRNA-specific 2-thiouridylase MnmA 4.38e-02 4.40e-10 NA NA
5. P C5B8B9 tRNA-specific 2-thiouridylase MnmA 8.57e-02 2.02e-08 NA NA
5. P Q131Q8 tRNA-specific 2-thiouridylase MnmA 1.96e-02 4.93e-07 NA NA
5. P Q83LF7 tRNA-specific 2-thiouridylase MnmA 9.55e-02 3.90e-09 NA NA
5. P B9MIA2 tRNA-specific 2-thiouridylase MnmA 3.30e-02 4.87e-09 NA NA
5. P B1JI67 tRNA-specific 2-thiouridylase MnmA 9.48e-02 9.53e-09 NA NA
5. P Q8CXZ8 tRNA-specific 2-thiouridylase MnmA NA 2.69e-09 NA NA
5. P Q3ATZ5 tRNA-specific 2-thiouridylase MnmA 1.51e-01 2.99e-08 NA NA
5. P Q5QWZ9 Argininosuccinate synthase 5.07e-03 2.44e-10 NA NA
5. P B1VAX7 tRNA-specific 2-thiouridylase MnmA 2.08e-02 6.37e-09 NA NA
5. P Q88V96 tRNA-specific 2-thiouridylase MnmA 2.23e-02 1.62e-09 NA NA
5. P Q64P39 tRNA-specific 2-thiouridylase MnmA 3 2.02e-02 5.75e-10 NA NA
5. P A0LUB9 Argininosuccinate synthase 2.63e-03 5.57e-09 NA NA
5. P Q5HBV2 tRNA-specific 2-thiouridylase MnmA 1.04e-02 2.34e-05 NA NA
5. P A7FJE9 Argininosuccinate synthase 9.83e-03 1.68e-11 NA NA
5. P P0A6E4 Argininosuccinate synthase 1.19e-02 6.29e-12 NA NA
5. P B2HIE6 tRNA-specific 2-thiouridylase MnmA 2.15e-02 1.90e-08 NA NA
5. P B5F6U1 Argininosuccinate synthase 8.89e-03 4.18e-12 NA NA
5. P B8E0N9 Argininosuccinate synthase 4.60e-03 2.50e-13 NA NA
5. P Q98Q11 tRNA-specific 2-thiouridylase MnmA 1.97e-02 1.09e-07 NA NA
5. P A9N735 Argininosuccinate synthase 8.85e-03 2.28e-11 NA NA
5. P Q65GR9 tRNA-specific 2-thiouridylase MnmA 6.21e-02 7.79e-10 NA NA
5. P A9R622 Argininosuccinate synthase 1.29e-02 1.68e-11 NA NA
5. P A1WD47 tRNA-specific 2-thiouridylase MnmA 5.12e-02 6.77e-08 NA NA
5. P A3PJ71 tRNA-specific 2-thiouridylase MnmA 7.09e-02 1.08e-05 NA NA
5. P Q2W2V2 tRNA-specific 2-thiouridylase MnmA 4.34e-02 1.42e-05 NA NA
5. P B4EVG2 tRNA-specific 2-thiouridylase MnmA 6.30e-02 1.06e-08 NA NA
5. P Q9WYZ0 tRNA-specific 2-thiouridylase MnmA 1.51e-02 2.53e-08 NA NA
5. P P59604 Argininosuccinate synthase 7.65e-03 7.91e-12 NA NA
5. P C1EUX9 Argininosuccinate synthase 3.26e-03 4.99e-09 NA NA
5. P Q5FFJ0 tRNA-specific 2-thiouridylase MnmA 1.05e-02 3.00e-05 NA NA
5. P Q3J9C8 Argininosuccinate synthase 7.12e-03 8.76e-11 NA NA
5. P Q2YWS4 Argininosuccinate synthase 4.11e-03 1.20e-08 NA NA
5. P Q8DRS4 tRNA-specific 2-thiouridylase MnmA 6.72e-03 1.48e-09 NA NA
5. P A7ZZ88 tRNA-specific 2-thiouridylase MnmA 5.59e-02 3.81e-09 NA NA
5. P A5EVB4 tRNA-specific 2-thiouridylase MnmA 2.42e-02 4.53e-08 NA NA
5. P Q600M2 tRNA-specific 2-thiouridylase MnmA 1.98e-02 1.27e-09 NA NA
5. P A5D3F0 tRNA-specific 2-thiouridylase MnmA 2.25e-02 1.11e-07 NA NA
5. P A4T9W4 Argininosuccinate synthase 3.19e-03 1.02e-10 NA NA
5. P A5GPT0 Argininosuccinate synthase 6.53e-03 6.78e-13 NA NA
5. P A8EUB2 Argininosuccinate synthase 5.65e-03 9.69e-12 NA NA
5. P Q9DAT5 Mitochondrial tRNA-specific 2-thiouridylase 1 8.97e-02 2.27e-06 NA NA
5. P Q7MBE1 tRNA-specific 2-thiouridylase MnmA 5.87e-02 7.93e-04 NA NA
5. P A7Z7M0 Argininosuccinate synthase 3.61e-03 5.04e-08 NA NA
5. P Q1LT51 tRNA-specific 2-thiouridylase MnmA 5.39e-02 6.93e-08 NA NA
5. P C1FU68 Argininosuccinate synthase 5.18e-03 1.59e-10 NA NA
5. P B0VUD6 tRNA-specific 2-thiouridylase MnmA 1.51e-02 1.19e-07 NA NA
5. P A9VIM2 tRNA-specific 2-thiouridylase MnmA 2.67e-02 1.77e-08 NA NA
5. P A1R0A7 tRNA-specific 2-thiouridylase MnmA 8.25e-02 1.39e-09 NA NA
5. P B3R6Q0 tRNA-specific 2-thiouridylase MnmA 1.76e-02 1.58e-09 NA NA
5. P Q5E3W7 tRNA-specific 2-thiouridylase MnmA 2.01e-02 1.40e-07 NA NA
5. P B1I833 tRNA-specific 2-thiouridylase MnmA 2.21e-02 2.10e-09 NA NA
5. P B5XJA6 tRNA-specific 2-thiouridylase MnmA 6.67e-03 2.05e-09 NA NA
5. P Q31ZK9 tRNA-specific 2-thiouridylase MnmA 9.52e-02 3.62e-09 NA NA
5. P B8DDZ8 tRNA-specific 2-thiouridylase MnmA 7.25e-02 2.92e-10 NA NA
5. P Q4K749 Argininosuccinate synthase 1.08e-02 1.22e-11 NA NA
5. P P55744 Argininosuccinate synthase 1.19e-02 4.02e-12 NA NA
5. P A3D5F8 tRNA-specific 2-thiouridylase MnmA 2.85e-02 1.29e-09 NA NA
5. P Q7U342 tRNA-specific 2-thiouridylase MnmA 2.99e-02 8.18e-07 NA NA
5. P A4XKG4 Argininosuccinate synthase 5.92e-03 6.88e-13 NA NA
5. P Q5QYZ7 tRNA-specific 2-thiouridylase MnmA 8.57e-02 1.09e-06 NA NA
5. P C1CBU0 tRNA-specific 2-thiouridylase MnmA 7.02e-03 8.09e-10 NA NA
5. P A8GRJ5 tRNA-specific 2-thiouridylase MnmA 9.63e-03 1.36e-07 NA NA
5. P Q9K820 Argininosuccinate synthase 3.06e-03 2.75e-08 NA NA
5. P B7J2N7 tRNA-specific 2-thiouridylase MnmA 1.20e-01 1.19e-08 NA NA
5. P Q65SH4 Argininosuccinate synthase 8.67e-03 4.02e-12 NA NA
5. P A4TKI3 Argininosuccinate synthase 9.91e-03 1.68e-11 NA NA
5. P Q65G67 Argininosuccinate synthase 3.33e-03 2.33e-08 NA NA
5. P A4WTT2 tRNA-specific 2-thiouridylase MnmA 6.97e-02 1.22e-06 NA NA
5. P A2RH05 tRNA-specific 2-thiouridylase MnmA 7.11e-03 1.88e-09 NA NA
5. P Q62EQ4 Argininosuccinate synthase 8.51e-03 9.47e-11 NA NA
5. P P47537 tRNA-specific 2-thiouridylase MnmA 2.11e-02 2.32e-06 NA NA
5. P B0TW32 tRNA-specific 2-thiouridylase MnmA 1.20e-02 4.81e-09 NA NA
5. P B1WC37 Mitochondrial tRNA-specific 2-thiouridylase 1 9.72e-02 4.48e-06 NA NA
5. P B5Z8Y2 tRNA-specific 2-thiouridylase MnmA 3.15e-02 9.85e-11 NA NA
5. P Q38XI3 tRNA-specific 2-thiouridylase MnmA 2.14e-02 2.98e-11 NA NA
5. P A9IQ90 Argininosuccinate synthase 8.53e-03 1.66e-11 NA NA
5. P C3L1U3 Argininosuccinate synthase 4.83e-03 3.44e-11 NA NA
5. P B5ZBP8 tRNA-specific 2-thiouridylase MnmA 5.18e-02 2.50e-08 NA NA
5. P B1VZW7 tRNA-specific 2-thiouridylase MnmA 1.11e-01 3.36e-09 NA NA
5. P Q5HQK0 Argininosuccinate synthase 3.93e-03 8.14e-09 NA NA
5. P Q0SS39 tRNA-specific 2-thiouridylase MnmA 2.76e-02 2.40e-06 NA NA
5. P Q6AEE4 tRNA-specific 2-thiouridylase MnmA 2.54e-02 1.37e-09 NA NA
5. P A8LE46 Argininosuccinate synthase 2.38e-03 1.92e-09 NA NA
5. P Q5X5H6 tRNA-specific 2-thiouridylase MnmA 2.73e-02 1.57e-10 NA NA
5. P Q1LJ45 tRNA-specific 2-thiouridylase MnmA 1.72e-02 8.95e-10 NA NA
5. P B2FQX2 tRNA-specific 2-thiouridylase MnmA 2.94e-02 3.41e-10 NA NA
5. P A1U1H5 tRNA-specific 2-thiouridylase MnmA 1.33e-02 3.20e-09 NA NA
5. P B4SIN4 tRNA-specific 2-thiouridylase MnmA 2.86e-02 9.65e-10 NA NA
5. P B5XSX1 Argininosuccinate synthase 9.20e-03 9.18e-12 NA NA
5. P Q9JWM1 Argininosuccinate synthase 8.87e-03 1.47e-10 NA NA
5. P Q4JVZ8 Argininosuccinate synthase 3.25e-03 3.83e-11 NA NA
5. P Q57FU2 Argininosuccinate synthase 2.84e-03 3.49e-11 NA NA
5. P Q0AZQ5 tRNA-specific 2-thiouridylase MnmA 1.09e-02 1.00e-06 NA NA
5. P A9A0S9 tRNA-specific 2-thiouridylase MnmA 5.23e-02 5.28e-08 NA NA
5. P B7K1G5 tRNA-specific 2-thiouridylase MnmA 6.98e-03 1.41e-07 NA NA
5. P Q17440 Probable mitochondrial tRNA-specific 2-thiouridylase 1 4.16e-02 2.19e-07 NA NA
5. P A4W488 Argininosuccinate synthase 3.08e-03 1.21e-10 NA NA
5. P A5F4Z4 Argininosuccinate synthase 3.67e-03 3.23e-12 NA NA
5. P A6V1S1 Argininosuccinate synthase 7.92e-03 2.63e-12 NA NA
5. P C1A051 Argininosuccinate synthase 4.62e-03 4.37e-11 NA NA
5. P B0KMQ6 tRNA-specific 2-thiouridylase MnmA 5.16e-02 1.60e-08 NA NA
5. P A4QDK1 tRNA-specific 2-thiouridylase MnmA 2.42e-02 9.62e-08 NA NA
5. P Q3B625 tRNA-specific 2-thiouridylase MnmA 3.18e-01 2.27e-08 NA NA
5. P Q492R5 tRNA-specific 2-thiouridylase MnmA 7.55e-02 7.38e-09 NA NA
5. P Q0VRM5 Argininosuccinate synthase 1.31e-02 1.41e-11 NA NA
5. P B0K0P8 tRNA-specific 2-thiouridylase MnmA 2 1.08e-02 2.11e-06 NA NA
5. P Q57QC0 tRNA-specific 2-thiouridylase MnmA 9.41e-02 5.44e-09 NA NA
5. P Q3YX68 Argininosuccinate synthase 8.95e-03 5.49e-12 NA NA
5. P Q0I5Y6 tRNA-specific 2-thiouridylase MnmA 4.31e-02 1.57e-07 NA NA
5. P B5FG83 tRNA-specific 2-thiouridylase MnmA 1.86e-02 1.21e-07 NA NA
5. P P24532 Argininosuccinate synthase 5.67e-02 9.47e-07 NA NA
5. P B3PYW4 tRNA-specific 2-thiouridylase MnmA 2.57e-02 8.54e-09 NA NA
5. P Q1J090 tRNA-specific 2-thiouridylase MnmA 1.17e-02 5.41e-08 NA NA
5. P Q66C31 Argininosuccinate synthase 9.87e-03 1.68e-11 NA NA
5. P Q8ELT8 Argininosuccinate synthase 4.75e-03 2.50e-10 NA NA
5. P Q3YS95 Argininosuccinate synthase 1.13e-02 6.37e-12 NA NA
5. P Q3JNT6 tRNA-specific 2-thiouridylase MnmA 8.23e-02 3.17e-08 NA NA
5. P A7ZDF2 Argininosuccinate synthase 1.13e-02 1.97e-11 NA NA
5. P Q8ABF5 tRNA-specific 2-thiouridylase MnmA 1 1.01e-01 3.53e-09 NA NA
5. P Q0VQ25 tRNA-specific 2-thiouridylase MnmA 2.53e-02 1.24e-07 NA NA
5. P Q12093 Mitochondrial tRNA-specific 2-thiouridylase 1 1.25e-02 9.53e-09 NA NA
5. P B1XX60 tRNA-specific 2-thiouridylase MnmA 7.69e-02 4.93e-09 NA NA
5. P Q5HFE1 tRNA-specific 2-thiouridylase MnmA 9.79e-03 8.65e-09 NA NA
5. P Q24ZG8 Argininosuccinate synthase 3.79e-03 3.88e-11 NA NA
5. P B1KID0 tRNA-specific 2-thiouridylase MnmA 1.03e-02 8.97e-09 NA NA
5. P B7JS06 Argininosuccinate synthase 3.30e-03 5.30e-09 NA NA
5. P B8GXL9 Argininosuccinate synthase 1.03e-02 2.64e-11 NA NA
5. P B1YTE9 tRNA-specific 2-thiouridylase MnmA 8.80e-02 9.42e-09 NA NA
5. P B3ECP2 Argininosuccinate synthase 3.86e-03 2.13e-09 NA NA
5. P Q1GVV6 Argininosuccinate synthase 4.33e-03 9.34e-13 NA NA
5. P Q2JKS2 Argininosuccinate synthase 3.57e-03 7.80e-14 NA NA
5. P A4FDS0 Argininosuccinate synthase 6.24e-02 6.18e-07 NA NA
5. P A7X333 tRNA-specific 2-thiouridylase MnmA 9.70e-03 5.11e-09 NA NA
5. P Q82UP5 Argininosuccinate synthase 7.07e-03 2.85e-12 NA NA
5. P Q6FCW2 tRNA-specific 2-thiouridylase MnmA 1.64e-02 9.89e-09 NA NA
5. P Q67LS2 tRNA-specific 2-thiouridylase MnmA 1.30e-02 5.30e-05 NA NA
5. P Q3AA24 tRNA-specific 2-thiouridylase MnmA 1.14e-02 2.19e-05 NA NA
5. P Q607H5 tRNA-specific 2-thiouridylase MnmA 8.53e-02 4.20e-11 NA NA
5. P Q31N30 tRNA-specific 2-thiouridylase MnmA 8.46e-03 1.97e-09 NA NA
5. P A7I2L9 tRNA-specific 2-thiouridylase MnmA 4.21e-02 3.84e-06 NA NA
5. P C5CAM5 Argininosuccinate synthase 3.83e-03 1.79e-10 NA NA
5. P Q3B425 Argininosuccinate synthase 4.08e-03 3.49e-10 NA NA
5. P Q817C6 Argininosuccinate synthase 3.26e-03 6.00e-09 NA NA
5. P Q82JK2 tRNA-specific 2-thiouridylase MnmA 1.10e-01 4.47e-09 NA NA
5. P Q48F14 Argininosuccinate synthase 7.24e-03 1.77e-11 NA NA
5. P Q46I72 Argininosuccinate synthase 9.31e-03 1.43e-12 NA NA
5. P A4J173 Argininosuccinate synthase 5.07e-03 1.81e-09 NA NA
5. P A6Q3P9 Argininosuccinate synthase 3.14e-03 1.42e-14 NA NA
5. P P59608 Argininosuccinate synthase 1.13e-02 8.58e-12 NA NA
5. P A1JTL6 Argininosuccinate synthase 9.67e-03 7.30e-12 NA NA
5. P C5D679 Argininosuccinate synthase 3.05e-03 7.29e-09 NA NA
5. P Q9PQ88 tRNA-specific 2-thiouridylase MnmA 8.31e-02 2.56e-09 NA NA
5. P Q66I24 Argininosuccinate synthase 7.82e-03 1.77e-10 NA NA
5. P Q8U484 Argininosuccinate synthase 3.72e-03 5.68e-11 NA NA
5. P Q8PK26 Argininosuccinate synthase 9.08e-03 7.69e-10 NA NA
5. P B7IK29 Argininosuccinate synthase 3.39e-03 3.85e-09 NA NA
5. P C4LIE1 Argininosuccinate synthase 3.01e-03 3.49e-10 NA NA
5. P O25893 tRNA-specific 2-thiouridylase MnmA 4.91e-02 4.31e-11 NA NA
5. P Q3J9J6 tRNA-specific 2-thiouridylase MnmA 3.27e-02 2.14e-10 NA NA
5. P A1JLK6 tRNA-specific 2-thiouridylase MnmA 9.68e-02 6.07e-09 NA NA
5. P Q2LT97 Argininosuccinate synthase 6.18e-03 2.97e-12 NA NA
5. P A5IBN1 tRNA-specific 2-thiouridylase MnmA 2.31e-02 2.06e-10 NA NA
5. P B1IUD4 tRNA-specific 2-thiouridylase MnmA 6.76e-02 3.81e-09 NA NA
5. P B1IK08 Argininosuccinate synthase 4.15e-03 3.68e-11 NA NA
5. P P66978 tRNA-specific 2-thiouridylase MnmA 6.70e-03 5.75e-10 NA NA
5. P Q5YRS5 tRNA-specific 2-thiouridylase MnmA 2.49e-02 1.17e-07 NA NA
5. P Q8CX40 tRNA-specific 2-thiouridylase MnmA 2.39e-02 4.18e-10 NA NA
5. P Q5WED8 Argininosuccinate synthase 3.86e-03 8.44e-09 NA NA
5. P Q21AM9 tRNA-specific 2-thiouridylase MnmA 1.67e-02 1.93e-07 NA NA
5. P Q7MLT4 tRNA-specific 2-thiouridylase MnmA 1.72e-02 2.26e-09 NA NA
5. P B3E966 tRNA-specific 2-thiouridylase MnmA 2.07e-02 5.92e-09 NA NA
5. P Q92MB5 tRNA-specific 2-thiouridylase MnmA 1.48e-02 5.71e-09 NA NA
5. P B8ZS29 tRNA-specific 2-thiouridylase MnmA 2.00e-02 6.18e-07 NA NA
5. P B6I1P6 Argininosuccinate synthase 9.04e-03 6.37e-12 NA NA
5. P Q8CXC7 tRNA-specific 2-thiouridylase MnmA 2.78e-02 1.17e-10 NA NA
5. P B8CNI0 Argininosuccinate synthase 4.46e-03 1.23e-11 NA NA
5. P Q05FN6 Argininosuccinate synthase 1.56e-03 2.96e-10 NA NA
5. P Q145K0 tRNA-specific 2-thiouridylase MnmA 9.35e-02 6.69e-08 NA NA
5. P B7NDF7 Argininosuccinate synthase 1.13e-02 6.29e-12 NA NA
5. P Q5F7G4 tRNA-specific 2-thiouridylase MnmA 7.33e-02 3.62e-09 NA NA
5. P A5U737 tRNA-specific 2-thiouridylase MnmA 2.27e-02 4.02e-06 NA NA
5. P Q54I63 Mitochondrial tRNA-specific 2-thiouridylase 1 1.03e-01 2.32e-04 NA NA
5. P A4W9E5 tRNA-specific 2-thiouridylase MnmA 9.56e-02 4.63e-09 NA NA
5. P B2SX74 tRNA-specific 2-thiouridylase MnmA 1.95e-02 7.20e-09 NA NA
5. P C0Z6S0 Argininosuccinate synthase 1.26e-02 4.07e-10 NA NA
5. P Q1CRS3 tRNA-specific 2-thiouridylase MnmA 3.04e-02 1.20e-09 NA NA
5. P A9BS40 tRNA-specific 2-thiouridylase MnmA 2.97e-02 2.50e-11 NA NA
5. P A9BDR3 Argininosuccinate synthase 5.53e-03 1.20e-13 NA NA
5. P Q6GIC7 Argininosuccinate synthase 4.87e-03 1.31e-08 NA NA
5. P A8AHK2 tRNA-specific 2-thiouridylase MnmA 9.46e-02 1.95e-09 NA NA
5. P B0CI68 tRNA-specific 2-thiouridylase MnmA 1.58e-02 3.75e-07 NA NA
5. P B2S125 tRNA-specific 2-thiouridylase MnmA 6.57e-02 4.48e-08 NA NA
5. P Q5NEF9 tRNA-specific 2-thiouridylase MnmA 1.62e-02 6.86e-10 NA NA
5. P Q1CGZ2 Argininosuccinate synthase 9.82e-03 1.68e-11 NA NA
5. P Q4JUL5 tRNA-specific 2-thiouridylase MnmA 2.65e-02 4.93e-06 NA NA
5. P A5F2F2 tRNA-specific 2-thiouridylase MnmA 2.87e-02 2.26e-09 NA NA
5. P Q2NU15 tRNA-specific 2-thiouridylase MnmA 4.38e-02 4.55e-07 NA NA
5. P A6H0G9 tRNA-specific 2-thiouridylase MnmA 7.41e-03 5.95e-08 NA NA
5. P C0REM2 tRNA-specific 2-thiouridylase MnmA 1.63e-02 6.11e-07 NA NA
5. P Q4FR79 Argininosuccinate synthase 7.05e-03 1.12e-12 NA NA
5. P Q49WA0 Argininosuccinate synthase 3.64e-03 6.07e-09 NA NA
5. P C3PFT7 tRNA-specific 2-thiouridylase MnmA 2.05e-02 3.35e-07 NA NA
5. P Q2LVR6 tRNA-specific 2-thiouridylase MnmA 2 1.05e-01 7.76e-06 NA NA
5. P Q01S58 Glycosyl hydrolase family 109 protein 2.34e-01 2.16e-02 NA NA
5. P Q28PD8 tRNA-specific 2-thiouridylase MnmA 7.23e-02 2.74e-06 NA NA
5. P P59412 Argininosuccinate synthase 4.14e-03 1.32e-09 NA NA
5. P C6DIG9 Argininosuccinate synthase 1.17e-02 3.01e-12 NA NA
5. P A8GL82 Argininosuccinate synthase 5.12e-03 7.50e-10 NA NA
5. P A6VN06 Argininosuccinate synthase 8.56e-03 3.85e-12 NA NA
5. P Q5X9C1 tRNA-specific 2-thiouridylase MnmA 7.07e-03 1.88e-09 NA NA
5. P Q39JI1 tRNA-specific 2-thiouridylase MnmA 7.24e-02 1.12e-08 NA NA
5. P B1LV15 tRNA-specific 2-thiouridylase MnmA 1.81e-02 1.16e-06 NA NA
5. P Q04MV1 tRNA-specific 2-thiouridylase MnmA 7.20e-03 1.64e-09 NA NA
5. P O33099 tRNA-specific 2-thiouridylase MnmA 1.39e-02 6.18e-07 NA NA
5. P A1R863 tRNA-specific 2-thiouridylase MnmA 1.63e-02 5.44e-09 NA NA
5. P A5ILL1 Argininosuccinate synthase 6.33e-03 9.53e-10 NA NA
5. P P22768 Argininosuccinate synthase 1.10e-02 6.12e-12 NA NA
5. P Q0ARV1 tRNA-specific 2-thiouridylase MnmA 2.88e-02 1.44e-05 NA NA
5. P A8GMY3 tRNA-specific 2-thiouridylase MnmA 1.53e-02 1.49e-06 NA NA
5. P A0JV26 Argininosuccinate synthase 2.67e-03 5.92e-09 NA NA
5. P B4TWE1 Argininosuccinate synthase 1.12e-02 8.13e-12 NA NA
5. P A8AQ63 Argininosuccinate synthase 1.19e-02 1.19e-11 NA NA
5. P Q21HZ6 Argininosuccinate synthase 7.97e-03 7.17e-13 NA NA
5. P A8A4Y7 Argininosuccinate synthase 1.20e-02 7.20e-12 NA NA
5. P Q5WWV9 tRNA-specific 2-thiouridylase MnmA 3.49e-02 4.23e-10 NA NA
5. P Q4A9Q7 tRNA-specific 2-thiouridylase MnmA 2.33e-02 1.27e-09 NA NA
5. P Q6KHK4 tRNA-specific 2-thiouridylase MnmA 1.87e-02 1.44e-09 NA NA
5. P B2IRK2 tRNA-specific 2-thiouridylase MnmA 7.09e-03 7.99e-10 NA NA
5. P A9BM60 Argininosuccinate synthase 8.72e-03 3.41e-12 NA NA
5. P Q97KE6 Argininosuccinate synthase 5.29e-03 5.97e-10 NA NA
5. P Q9Z8A5 tRNA-specific 2-thiouridylase MnmA 2.36e-02 6.83e-11 NA NA
5. P Q0HJT7 tRNA-specific 2-thiouridylase MnmA 3.27e-02 4.02e-10 NA NA
5. P A7FXG3 tRNA-specific 2-thiouridylase MnmA 2 9.72e-02 7.65e-07 NA NA
5. P A4XLP5 tRNA-specific 2-thiouridylase MnmA 8.61e-03 3.51e-05 NA NA
5. P A8LPE0 Argininosuccinate synthase 1.08e-02 4.14e-11 NA NA
5. P Q9HKF1 Argininosuccinate synthase 2.13e-03 3.77e-10 NA NA
5. P Q896F5 tRNA-specific 2-thiouridylase MnmA 1 1.06e-01 1.75e-06 NA NA
5. P B1VFZ9 tRNA-specific 2-thiouridylase MnmA 2.74e-02 2.18e-06 NA NA
5. P Q2FXV6 tRNA-specific 2-thiouridylase MnmA 1.03e-02 8.65e-09 NA NA
5. P Q6A8Q1 tRNA-specific 2-thiouridylase MnmA 2.14e-02 1.28e-08 NA NA
5. P Q0AEE4 Argininosuccinate synthase 6.89e-03 1.74e-12 NA NA
5. P Q2N9H9 Argininosuccinate synthase 5.83e-03 3.99e-13 NA NA
5. P A4VIU7 Argininosuccinate synthase 8.22e-03 2.90e-11 NA NA
5. P Q0AB32 Argininosuccinate synthase 3.31e-03 8.13e-13 NA NA
5. P A1AZB7 Argininosuccinate synthase 1.05e-02 2.12e-10 NA NA
5. P A3Q0T3 Argininosuccinate synthase 3.52e-03 2.44e-11 NA NA
5. P O84289 tRNA-specific 2-thiouridylase MnmA 1.29e-02 3.95e-09 NA NA
5. P A4Z082 tRNA-specific 2-thiouridylase MnmA 3.31e-02 1.71e-06 NA NA
5. P B9DNH6 tRNA-specific 2-thiouridylase MnmA 2.19e-02 4.81e-10 NA NA
5. P B1VH30 Argininosuccinate synthase 4.40e-03 6.65e-11 NA NA
5. P A3N4T7 Argininosuccinate synthase 1.07e-02 9.47e-11 NA NA
5. P B1ZZ32 tRNA-specific 2-thiouridylase MnmA 1.95e-02 1.06e-07 NA NA
5. P P50986 Argininosuccinate synthase 3.88e-03 4.02e-10 NA NA
5. P Q0BI73 tRNA-specific 2-thiouridylase MnmA 7.00e-02 9.42e-09 NA NA
5. P Q317T4 Argininosuccinate synthase 9.50e-03 8.46e-12 NA NA
5. P A5FQ73 Argininosuccinate synthase 4.95e-03 1.99e-08 NA NA
5. P C4Z9C9 Argininosuccinate synthase 4.87e-03 6.92e-11 NA NA
5. P B0JM14 Argininosuccinate synthase 6.68e-03 5.80e-12 NA NA
5. P Q7M8I9 tRNA-specific 2-thiouridylase MnmA 3.30e-02 7.60e-12 NA NA
5. P B2J5L9 tRNA-specific 2-thiouridylase MnmA 6.53e-03 1.74e-07 NA NA
5. P Q64WG8 tRNA-specific 2-thiouridylase MnmA 2 7.65e-02 5.67e-10 NA NA
5. P B0JVR4 tRNA-specific 2-thiouridylase MnmA 1.01e-02 8.24e-09 NA NA
5. P Q30QT1 Argininosuccinate synthase 3.20e-03 8.96e-13 NA NA
5. P Q7VGU9 Argininosuccinate synthase 7.56e-03 5.80e-12 NA NA
5. P Q0TCT8 Argininosuccinate synthase 9.06e-03 6.29e-12 NA NA
5. P Q1RJ52 tRNA-specific 2-thiouridylase MnmA 1.78e-02 1.00e-06 NA NA
5. P Q6GAW5 Argininosuccinate synthase 2.88e-03 7.20e-09 NA NA
5. P Q8D397 tRNA-specific 2-thiouridylase MnmA 4.51e-02 9.29e-08 NA NA
5. P A1UTJ1 tRNA-specific 2-thiouridylase MnmA 2.08e-02 4.45e-07 NA NA
5. P Q5HBF2 Argininosuccinate synthase 1.54e-02 4.72e-13 NA NA
5. P B6JCC3 tRNA-specific 2-thiouridylase MnmA 2.00e-02 1.31e-06 NA NA
5. P A9VKE1 Argininosuccinate synthase 3.41e-03 4.58e-09 NA NA
5. P A8L536 tRNA-specific 2-thiouridylase MnmA 1.05e-02 6.12e-10 NA NA
5. P Q57BT1 tRNA-specific 2-thiouridylase MnmA 1.76e-02 6.11e-07 NA NA
5. P A3MNB7 Argininosuccinate synthase 1.05e-02 9.47e-11 NA NA
5. P A8H5M1 tRNA-specific 2-thiouridylase MnmA 5.20e-02 2.02e-09 NA NA
5. P A6QFH2 Argininosuccinate synthase 4.10e-03 7.94e-09 NA NA
5. P A9MP33 Argininosuccinate synthase 9.31e-03 1.82e-11 NA NA
5. P A6KXF7 tRNA-specific 2-thiouridylase MnmA 1 1.04e-01 3.53e-08 NA NA
5. P A1TAA6 Argininosuccinate synthase 3.20e-03 8.31e-11 NA NA
5. P A7FWU6 Argininosuccinate synthase 4.87e-03 9.35e-11 NA NA
5. P P0C1A1 Argininosuccinate synthase 8.82e-03 1.27e-11 NA NA
5. P B7GGR4 Argininosuccinate synthase 3.71e-03 2.07e-09 NA NA
5. P Q8R5Z5 tRNA-specific 2-thiouridylase MnmA 2 2.98e-02 8.62e-10 NA NA
5. P A5D510 Argininosuccinate synthase 4.98e-03 9.18e-10 NA NA
5. P Q970V0 Argininosuccinate synthase 4.01e-03 4.98e-11 NA NA
5. P Q3M5R7 tRNA-specific 2-thiouridylase MnmA 6.87e-03 4.87e-09 NA NA
5. P Q03QJ0 tRNA-specific 2-thiouridylase MnmA 2.39e-02 1.58e-09 NA NA
5. P Q2N6A6 tRNA-specific 2-thiouridylase MnmA 4.18e-02 2.29e-07 NA NA
5. P Q5E2E7 Argininosuccinate synthase 4.68e-03 8.42e-11 NA NA
5. P A1U3U4 Argininosuccinate synthase 9.98e-03 6.07e-13 NA NA
5. P A7HCV7 tRNA-specific 2-thiouridylase MnmA 9.68e-02 2.59e-08 NA NA
5. P Q3SV21 tRNA-specific 2-thiouridylase MnmA 2.06e-02 4.64e-08 NA NA
5. P C5C2D6 tRNA-specific 2-thiouridylase MnmA 1.21e-02 1.08e-07 NA NA
5. P Q1MRW7 tRNA-specific 2-thiouridylase MnmA 3.59e-02 2.04e-10 NA NA
5. P P58075 tRNA-specific 2-thiouridylase MnmA 6.89e-03 2.15e-09 NA NA
5. P A3PNQ9 Argininosuccinate synthase 1.09e-02 7.99e-11 NA NA
5. P Q46JH9 tRNA-specific 2-thiouridylase MnmA 2.96e-02 3.76e-09 NA NA
5. P B7UJ66 Argininosuccinate synthase 8.98e-03 5.06e-12 NA NA
5. P A6TEJ0 Argininosuccinate synthase 9.16e-03 6.55e-12 NA NA
5. P A4XS43 Argininosuccinate synthase 7.46e-03 1.63e-11 NA NA
5. P A6Q239 tRNA-specific 2-thiouridylase MnmA 1.41e-02 1.84e-07 NA NA
5. P O97069 Argininosuccinate synthase 3.60e-03 1.32e-11 NA NA
5. P Q1QUR7 tRNA-specific 2-thiouridylase MnmA 6.03e-02 6.23e-08 NA NA
5. P Q8E7N1 Argininosuccinate synthase 5.52e-03 1.07e-10 NA NA
5. P Q7U375 tRNA-specific 2-thiouridylase MnmA 2.49e-02 7.12e-09 NA NA
5. P Q7V3S9 Argininosuccinate synthase 5.66e-03 1.12e-12 NA NA
5. P C5BC58 Argininosuccinate synthase 8.94e-03 6.95e-10 NA NA
5. P A5VRW1 tRNA-specific 2-thiouridylase MnmA 1.65e-02 6.11e-07 NA NA
5. P A8Z5W4 tRNA-specific 2-thiouridylase MnmA 3.61e-03 1.74e-09 NA NA
5. P Q3SKH7 tRNA-specific 2-thiouridylase MnmA 2.82e-02 1.02e-09 NA NA
5. P A5GE36 tRNA-specific 2-thiouridylase MnmA 2.05e-02 2.02e-07 NA NA
5. P A4FN60 Glycosyl hydrolase family 109 protein 2.45e-01 2.57e-02 NA NA
5. P B0S3R4 tRNA-specific 2-thiouridylase MnmA 6.28e-02 9.65e-10 NA NA
5. P Q1QQB5 tRNA-specific 2-thiouridylase MnmA 1.63e-02 1.29e-06 NA NA
5. P A0LEB2 Argininosuccinate synthase 7.52e-03 1.28e-11 NA NA
5. P Q9PJ66 tRNA-specific 2-thiouridylase MnmA 2.29e-02 1.07e-09 NA NA
5. P A0L678 tRNA-specific 2-thiouridylase MnmA 1.14e-02 5.30e-09 NA NA
5. P A1VL71 Argininosuccinate synthase 1.29e-02 1.63e-11 NA NA
5. P B1MDW3 tRNA-specific 2-thiouridylase MnmA 1.24e-02 1.21e-07 NA NA
5. P C1CAE7 tRNA-specific 2-thiouridylase MnmA 7.09e-03 8.84e-10 NA NA
5. P A2S5A6 tRNA-specific 2-thiouridylase MnmA 7.25e-02 3.89e-08 NA NA
5. P B8DRE0 tRNA-specific 2-thiouridylase MnmA 4.02e-02 4.07e-08 NA NA
5. P Q3ZYG0 Argininosuccinate synthase 5.30e-03 1.99e-08 NA NA
5. P Q8CSA5 tRNA-specific 2-thiouridylase MnmA 9.63e-03 1.24e-09 NA NA
5. P Q820E9 tRNA-specific 2-thiouridylase MnmA 8.21e-02 2.64e-11 NA NA
5. P Q669Q4 tRNA-specific 2-thiouridylase MnmA 4.40e-02 9.53e-09 NA NA
5. P A1KUY0 tRNA-specific 2-thiouridylase MnmA 1.14e-01 4.06e-06 NA NA
5. P A4TLN3 tRNA-specific 2-thiouridylase MnmA 5.24e-02 9.53e-09 NA NA
5. P Q5HNS9 tRNA-specific 2-thiouridylase MnmA 9.26e-03 1.24e-09 NA NA
5. P A9M700 tRNA-specific 2-thiouridylase MnmA 1.85e-02 2.40e-07 NA NA
5. P Q7U353 tRNA-specific 2-thiouridylase MnmA 1.35e-01 2.10e-09 NA NA
5. P B5XSN3 tRNA-specific 2-thiouridylase MnmA 7.44e-02 1.48e-07 NA NA
5. P A4G213 tRNA-specific 2-thiouridylase MnmA 2.12e-02 2.23e-09 NA NA
5. P Q6NCS7 Argininosuccinate synthase 8.42e-03 3.41e-12 NA NA
5. P B8G5F1 tRNA-specific 2-thiouridylase MnmA 2.44e-02 3.28e-09 NA NA
5. P A9R0L5 tRNA-specific 2-thiouridylase MnmA 4.53e-02 9.53e-09 NA NA
5. P B0K991 tRNA-specific 2-thiouridylase MnmA 2 1.05e-02 2.11e-06 NA NA
5. P Q0A8N7 tRNA-specific 2-thiouridylase MnmA 4.81e-02 7.79e-11 NA NA
5. P Q5FKU0 tRNA-specific 2-thiouridylase MnmA 8.94e-03 1.74e-09 NA NA
5. P B0RT32 tRNA-specific 2-thiouridylase MnmA 2.83e-02 5.30e-09 NA NA
5. P Q7TTU4 tRNA-specific 2-thiouridylase MnmA 1.84e-02 1.65e-06 NA NA
5. P Q0K720 tRNA-specific 2-thiouridylase MnmA 1.82e-02 5.39e-10 NA NA
5. P B2HR32 Argininosuccinate synthase 3.12e-03 1.04e-11 NA NA
5. P Q0I061 Argininosuccinate synthase 4.22e-03 5.32e-10 NA NA
5. P P59606 Argininosuccinate synthase 3.43e-03 3.67e-09 NA NA
5. P Q4QJM0 Argininosuccinate synthase 8.11e-03 1.34e-11 NA NA
5. P Q2NIM9 tRNA-specific 2-thiouridylase MnmA 2.57e-02 4.69e-10 NA NA
5. P Q894S7 tRNA-specific 2-thiouridylase MnmA 2 2.94e-02 8.82e-06 NA NA
5. P Q72GX1 tRNA-specific 2-thiouridylase MnmA 1.05e-02 2.14e-08 NA NA
5. P Q253W3 tRNA-specific 2-thiouridylase MnmA 8.92e-02 5.11e-09 NA NA
5. P Q18BE2 tRNA-specific 2-thiouridylase MnmA 1.90e-02 2.93e-06 NA NA
5. P Q6NHQ7 tRNA-specific 2-thiouridylase MnmA 2.29e-02 8.97e-08 NA NA
5. P Q5HHC4 Argininosuccinate synthase 3.07e-03 7.94e-09 NA NA
5. P P63643 Argininosuccinate synthase 2.86e-03 3.49e-11 NA NA
5. P A9KHL4 Argininosuccinate synthase 4.71e-03 1.46e-10 NA NA
5. P Q0IFL5 Argininosuccinate synthase 3.97e-03 1.26e-10 NA NA
5. P Q5RB73 Mitochondrial tRNA-specific 2-thiouridylase 1 5.70e-02 2.11e-08 NA NA
5. P Q92L73 Argininosuccinate synthase 9.25e-03 8.24e-12 NA NA
5. P Q4ZPK0 Argininosuccinate synthase 6.73e-03 1.43e-11 NA NA
5. P A0RQY3 tRNA-specific 2-thiouridylase MnmA 2.21e-02 3.36e-09 NA NA
5. P B4EM48 Argininosuccinate synthase 1.16e-02 1.23e-11 NA NA
5. P B0KBW5 Argininosuccinate synthase 3.71e-03 3.83e-11 NA NA
5. P A5GX16 Argininosuccinate synthase 7.06e-03 3.05e-13 NA NA
5. P P14568 Argininosuccinate synthase 7.73e-03 1.79e-10 NA NA
5. P B0BWZ7 tRNA-specific 2-thiouridylase MnmA 7.58e-03 1.36e-07 NA NA
5. P B0RGA6 tRNA-specific 2-thiouridylase MnmA 2.51e-02 2.53e-09 NA NA
5. P Q65VV2 tRNA-specific 2-thiouridylase MnmA 3.13e-02 4.40e-07 NA NA
5. P Q7V9F8 Argininosuccinate synthase 7.05e-03 2.28e-11 NA NA
5. P B2JZQ2 Argininosuccinate synthase 1.25e-02 1.68e-11 NA NA
5. P A1S4U5 Glycosyl hydrolase family 109 protein 1.13e-01 2.11e-03 NA NA
5. P Q31W50 Argininosuccinate synthase 1.17e-02 4.86e-12 NA NA
5. P A4W4N7 tRNA-specific 2-thiouridylase MnmA 6.50e-03 1.83e-08 NA NA
5. P B1XRS6 Argininosuccinate synthase 8.86e-03 1.05e-11 NA NA
5. P P77973 Argininosuccinate synthase 6.62e-03 2.14e-12 NA NA
5. P P61520 Argininosuccinate synthase 3.24e-03 3.53e-09 NA NA
5. P Q92BK1 tRNA-specific 2-thiouridylase MnmA 8.47e-02 6.20e-10 NA NA
5. P Q5ZY78 Argininosuccinate synthase 1.02e-02 7.04e-10 NA NA
5. P A8AU84 tRNA-specific 2-thiouridylase MnmA 7.04e-03 1.95e-09 NA NA
5. P B1YJE9 tRNA-specific 2-thiouridylase MnmA 7.36e-02 4.10e-09 NA NA
5. P A1TNA2 Argininosuccinate synthase 8.86e-03 3.85e-12 NA NA
5. P B7GTP0 Argininosuccinate synthase 1.05e-02 5.18e-11 NA NA
5. P Q3IYJ1 Argininosuccinate synthase 1.04e-02 7.99e-11 NA NA
5. P Q15X83 Argininosuccinate synthase 6.42e-03 3.82e-10 NA NA
5. P Q07VN9 Argininosuccinate synthase 1.34e-02 3.88e-11 NA NA
5. P B8D8K8 Argininosuccinate synthase 3.41e-03 1.81e-12 NA NA
5. P Q74JW9 tRNA-specific 2-thiouridylase MnmA 8.68e-03 2.29e-09 NA NA
5. P A7GGQ9 Argininosuccinate synthase 4.80e-03 2.14e-11 NA NA
5. P Q1IWM3 Argininosuccinate synthase 9.84e-03 1.25e-12 NA NA
5. P B2UC85 tRNA-specific 2-thiouridylase MnmA 9.38e-02 1.70e-09 NA NA
5. P Q4FME4 tRNA-specific 2-thiouridylase MnmA 2.02e-02 5.58e-07 NA NA
5. P Q5L186 tRNA-specific 2-thiouridylase MnmA 1 6.86e-02 1.51e-07 NA NA
5. P A8Z4F9 tRNA-specific 2-thiouridylase MnmA 1.03e-02 8.65e-09 NA NA
5. P A6U068 Argininosuccinate synthase 3.80e-03 7.94e-09 NA NA
5. P B2IBH3 tRNA-specific 2-thiouridylase MnmA 1.71e-02 9.68e-07 NA NA
5. P Q1BAU9 tRNA-specific 2-thiouridylase MnmA 1.89e-02 1.23e-07 NA NA
5. P Q31GM9 tRNA-specific 2-thiouridylase MnmA 2.29e-02 7.75e-09 NA NA
5. P C3MI00 tRNA-specific 2-thiouridylase MnmA 1.53e-02 5.44e-09 NA NA
5. P P16460 Argininosuccinate synthase 9.12e-03 2.14e-10 NA NA
5. P A3M3K6 Argininosuccinate synthase 1.02e-02 2.63e-12 NA NA
5. P Q2GGE6 Argininosuccinate synthase 1.41e-02 8.47e-13 NA NA
5. P Q3MBE6 Argininosuccinate synthase 5.85e-03 5.91e-11 NA NA
5. P Q3JWY8 Argininosuccinate synthase 1.07e-02 9.47e-11 NA NA
5. P Q9JYJ6 tRNA-specific 2-thiouridylase MnmA 1.06e-01 4.24e-06 NA NA
5. P Q8ZFQ5 tRNA-specific 2-thiouridylase MnmA 5.61e-02 9.53e-09 NA NA
5. P B1XGY3 Argininosuccinate synthase 1.18e-02 6.29e-12 NA NA
5. P Q6DAZ8 Argininosuccinate synthase 9.17e-03 6.04e-12 NA NA
5. P A6TL10 Argininosuccinate synthase 7.54e-03 5.82e-10 NA NA
5. P Q8YIL6 tRNA-specific 2-thiouridylase MnmA 1.72e-02 5.52e-07 NA NA
5. P Q7W7H8 Argininosuccinate synthase 8.61e-03 4.37e-11 NA NA
5. P B1Z0E2 Argininosuccinate synthase 1.16e-02 8.58e-12 NA NA
5. P Q87QL9 tRNA-specific 2-thiouridylase MnmA 1.76e-02 5.44e-09 NA NA
5. P Q2RMV0 Argininosuccinate synthase 7.30e-03 7.60e-12 NA NA
5. P A1T6X1 tRNA-specific 2-thiouridylase MnmA 1.65e-02 1.04e-07 NA NA
5. P A8F5H8 tRNA-specific 2-thiouridylase MnmA 2.34e-02 9.95e-12 NA NA
5. P C4ZSR2 Argininosuccinate synthase 9.05e-03 6.29e-12 NA NA
5. P Q1J988 tRNA-specific 2-thiouridylase MnmA 6.97e-03 2.26e-09 NA NA
5. P Q030C8 tRNA-specific 2-thiouridylase MnmA 1.39e-02 1.81e-10 NA NA
5. P A1K983 tRNA-specific 2-thiouridylase MnmA 2.46e-02 4.67e-11 NA NA
5. P Q7MAW9 tRNA-specific 2-thiouridylase MnmA 5.21e-02 1.62e-08 NA NA
5. P Q7UFW4 Argininosuccinate synthase 4.87e-03 1.54e-09 NA NA
5. P A6QHG3 tRNA-specific 2-thiouridylase MnmA 9.71e-03 8.65e-09 NA NA
5. P A8AA65 Argininosuccinate synthase 4.61e-03 6.12e-10 NA NA
5. P Q3A3F8 tRNA-specific 2-thiouridylase MnmA 1.12e-02 2.47e-08 NA NA
5. P Q5KW94 Argininosuccinate synthase 3.21e-03 7.79e-08 NA NA
5. P Q0SI58 Argininosuccinate synthase 4.55e-03 8.42e-11 NA NA
5. P A4VLW2 tRNA-specific 2-thiouridylase MnmA 5.43e-02 7.75e-09 NA NA
5. P Q392V6 Argininosuccinate synthase 1.13e-02 9.95e-12 NA NA
5. P Q8CWZ0 Argininosuccinate synthase 3.00e-03 3.78e-11 NA NA
5. P O51625 tRNA-specific 2-thiouridylase MnmA 7.50e-02 1.09e-08 NA NA
5. P A9AH63 tRNA-specific 2-thiouridylase MnmA 8.65e-02 2.44e-08 NA NA
5. P Q3AVL9 Argininosuccinate synthase 6.47e-03 6.07e-13 NA NA
5. P A2RLX1 tRNA-specific 2-thiouridylase MnmA 1.50e-02 6.57e-11 NA NA
5. P A5VAK5 Argininosuccinate synthase 8.92e-03 6.29e-14 NA NA
5. P A7H1D7 tRNA-specific 2-thiouridylase MnmA 2.28e-02 7.29e-09 NA NA
5. P C1CXR6 Argininosuccinate synthase 1.03e-02 8.99e-11 NA NA
5. P C6E6Y6 Argininosuccinate synthase 8.93e-03 3.68e-11 NA NA
5. P Q6YR90 tRNA-specific 2-thiouridylase MnmA 1.79e-02 3.12e-09 NA NA
5. P P61524 Argininosuccinate synthase 3.16e-03 1.83e-08 NA NA
5. P Q28WC8 Argininosuccinate synthase 1.03e-02 4.23e-10 NA NA
5. P Q3K3Q4 Argininosuccinate synthase 5.43e-03 1.11e-10 NA NA
5. P B1XA43 tRNA-specific 2-thiouridylase MnmA 8.01e-02 3.81e-09 NA NA
5. P A4SZQ2 Argininosuccinate synthase 2.60e-03 1.47e-11 NA NA
5. P B6JAT0 Argininosuccinate synthase 8.52e-03 4.24e-12 NA NA
5. P A3QD79 tRNA-specific 2-thiouridylase MnmA 1.35e-01 9.41e-10 NA NA
5. P Q8DCN0 Argininosuccinate synthase 6.33e-03 8.13e-13 NA NA
5. P Q87XM3 Argininosuccinate synthase 7.39e-03 2.34e-11 NA NA
5. P Q0I4M1 Argininosuccinate synthase 8.02e-03 2.75e-11 NA NA
5. P P57877 Argininosuccinate synthase 8.72e-03 1.39e-11 NA NA
5. P A6M1Z4 Argininosuccinate synthase 5.82e-03 3.44e-11 NA NA
5. P A4IRS3 Argininosuccinate synthase 3.22e-03 7.35e-08 NA NA
5. P Q2GJG8 tRNA-specific 2-thiouridylase MnmA 1.84e-02 4.93e-07 NA NA
5. P Q97GY2 tRNA-specific 2-thiouridylase MnmA 6.20e-02 5.32e-06 NA NA
5. P A1STI9 tRNA-specific 2-thiouridylase MnmA 6.39e-02 7.29e-09 NA NA
5. P P59609 Argininosuccinate synthase 9.05e-03 5.06e-12 NA NA
5. P Q8TNY5 Argininosuccinate synthase 2.05e-03 7.89e-11 NA NA
5. P Q0TPH2 tRNA-specific 2-thiouridylase MnmA 2.79e-02 8.95e-07 NA NA
5. P C0MGQ2 tRNA-specific 2-thiouridylase MnmA 6.66e-03 6.94e-09 NA NA
5. P A6WV13 Argininosuccinate synthase 2.79e-03 6.46e-12 NA NA
5. P Q8DKY7 Argininosuccinate synthase 5.91e-03 5.74e-13 NA NA
5. P A5IYK6 tRNA-specific 2-thiouridylase MnmA 2.69e-02 2.64e-10 NA NA
5. P B9J9F7 tRNA-specific 2-thiouridylase MnmA 2.32e-02 2.26e-09 NA NA
5. P Q0HH61 Glycosyl hydrolase family 109 protein 2 1.34e-01 7.30e-03 NA NA
5. P Q82VV0 tRNA-specific 2-thiouridylase MnmA 7.31e-02 5.05e-11 NA NA
5. P Q9PKA7 tRNA-specific 2-thiouridylase MnmA 1.76e-02 1.10e-08 NA NA
5. P B3EN11 tRNA-specific 2-thiouridylase MnmA 1.98e-01 7.98e-08 NA NA
5. P Q2W896 Argininosuccinate synthase 6.24e-03 4.52e-13 NA NA
5. P Q2JWE1 Argininosuccinate synthase 3.80e-03 2.76e-13 NA NA
5. P B5RMM8 tRNA-specific 2-thiouridylase MnmA 7.21e-02 4.43e-08 NA NA
5. P A7IGW4 Argininosuccinate synthase 4.23e-03 3.36e-12 NA NA
5. P B1LAP4 Argininosuccinate synthase 6.72e-03 1.50e-09 NA NA
5. P A7ICB9 tRNA-specific 2-thiouridylase MnmA 2.31e-02 1.06e-07 NA NA
5. P Q1MAN9 Argininosuccinate synthase 2 5.85e-03 2.66e-12 NA NA
5. P Q2YA75 Argininosuccinate synthase 6.82e-03 8.24e-13 NA NA
5. P Q5L6D1 tRNA-specific 2-thiouridylase MnmA 1.99e-02 3.14e-11 NA NA
5. P B7J5X6 tRNA-specific 2-thiouridylase MnmA 1.74e-02 8.46e-08 NA NA
5. P Q1WTT7 tRNA-specific 2-thiouridylase MnmA 2.27e-02 3.92e-10 NA NA
5. P A9M4B1 Argininosuccinate synthase 8.45e-03 3.73e-11 NA NA
5. P B9KPT5 Argininosuccinate synthase 1.08e-02 7.99e-11 NA NA
5. P C1CP03 tRNA-specific 2-thiouridylase MnmA 2.05e-02 1.02e-09 NA NA
5. P Q97T38 tRNA-specific 2-thiouridylase MnmA 2.05e-02 1.02e-09 NA NA
5. P A5N749 tRNA-specific 2-thiouridylase MnmA 8.00e-02 4.60e-07 NA NA
5. P A0RJ05 tRNA-specific 2-thiouridylase MnmA 2.80e-02 2.75e-08 NA NA
5. P P13257 Argininosuccinate synthase 1.56e-03 1.27e-09 NA NA
5. P A6LSF2 tRNA-specific 2-thiouridylase MnmA 2.48e-02 8.10e-06 NA NA
5. P Q87DM0 tRNA-specific 2-thiouridylase MnmA 2.61e-02 1.20e-09 NA NA
5. P Q7U387 tRNA-specific 2-thiouridylase MnmA 2.33e-02 6.15e-09 NA NA
5. P A3PXL7 tRNA-specific 2-thiouridylase MnmA 1.76e-02 1.29e-07 NA NA
5. P C3JY68 tRNA-specific 2-thiouridylase MnmA 3.70e-02 2.43e-07 NA NA
5. P Q2RG67 Argininosuccinate synthase 2.82e-03 4.79e-12 NA NA
5. P Q5YYD3 Argininosuccinate synthase 3.20e-03 1.37e-08 NA NA
5. P C1KX43 Argininosuccinate synthase 2.94e-03 6.61e-08 NA NA
5. P B2SEJ7 tRNA-specific 2-thiouridylase MnmA 1.59e-02 6.86e-10 NA NA
5. P A0PP79 Argininosuccinate synthase 3.02e-03 4.85e-11 NA NA
5. P B2A5K1 tRNA-specific 2-thiouridylase MnmA 1.82e-02 1.72e-07 NA NA
5. P O94354 Argininosuccinate synthase 5.90e-03 8.46e-12 NA NA
5. P Q0IC49 tRNA-specific 2-thiouridylase MnmA 1.96e-02 2.79e-07 NA NA
5. P Q2GDU3 tRNA-specific 2-thiouridylase MnmA 4.28e-02 5.68e-06 NA NA
5. P Q8FQ01 tRNA-specific 2-thiouridylase MnmA 2.54e-02 1.02e-07 NA NA
5. P Q0I607 Argininosuccinate synthase 8.95e-03 1.20e-12 NA NA
5. P Q8ZPZ4 tRNA-specific 2-thiouridylase MnmA 9.75e-02 7.12e-09 NA NA
5. P A1AVI7 Argininosuccinate synthase 5.91e-03 1.25e-12 NA NA
5. P Q24US9 tRNA-specific 2-thiouridylase MnmA 1.50e-02 3.19e-06 NA NA
5. P B1AJ41 tRNA-specific 2-thiouridylase MnmA 7.97e-02 2.56e-09 NA NA
5. P Q2Y6T6 tRNA-specific 2-thiouridylase MnmA 8.99e-02 4.58e-09 NA NA
5. P P9WN72 Glucose-6-phosphate 1-dehydrogenase 2 7.13e-02 2.91e-02 NA NA
5. P Q8CY38 tRNA-specific 2-thiouridylase MnmA 1.72e-02 6.11e-07 NA NA
5. P B3ETH8 tRNA-specific 2-thiouridylase MnmA 1.41e-02 4.87e-08 NA NA
5. P A6LNA3 tRNA-specific 2-thiouridylase MnmA 1.17e-01 2.82e-08 NA NA
5. P Q7UZG0 Argininosuccinate synthase 7.34e-03 9.06e-12 NA NA
5. P A5U315 Argininosuccinate synthase 3.16e-03 3.49e-11 NA NA
5. P A7MFV2 tRNA-specific 2-thiouridylase MnmA 7.00e-02 2.36e-08 NA NA
5. P Q3IH16 tRNA-specific 2-thiouridylase MnmA 4.57e-02 8.44e-09 NA NA
5. P Q3IHT8 Argininosuccinate synthase 1.03e-02 4.04e-11 NA NA
5. P A5UFF8 Argininosuccinate synthase 8.12e-03 1.02e-11 NA NA
5. P C4L952 tRNA-specific 2-thiouridylase MnmA 2.98e-02 2.21e-09 NA NA
5. P A7FH61 tRNA-specific 2-thiouridylase MnmA 8.74e-02 1.47e-08 NA NA
5. P Q21RZ7 tRNA-specific 2-thiouridylase MnmA 3.80e-02 8.86e-08 NA NA
5. P C0QRH5 tRNA-specific 2-thiouridylase MnmA 2.03e-02 1.28e-08 NA NA
5. P Q49Y59 tRNA-specific 2-thiouridylase MnmA 9.52e-03 7.69e-10 NA NA
5. P P63644 Argininosuccinate synthase 4.23e-03 7.94e-09 NA NA
5. P A5GDA4 Argininosuccinate synthase 6.64e-03 2.97e-09 NA NA
5. P Q3AL87 tRNA-specific 2-thiouridylase MnmA 8.53e-03 6.38e-08 NA NA
5. P Q2KZ71 tRNA-specific 2-thiouridylase MnmA 2.35e-02 1.44e-08 NA NA
5. P A9AYA7 tRNA-specific 2-thiouridylase MnmA 2.79e-02 6.02e-08 NA NA
5. P Q9KNT8 Argininosuccinate synthase 7.91e-03 3.23e-12 NA NA
5. P B5QZW1 Argininosuccinate synthase 8.87e-03 4.18e-12 NA NA
5. P C1B1S2 tRNA-specific 2-thiouridylase MnmA 1.73e-02 1.09e-07 NA NA
5. P Q5M2K2 Argininosuccinate synthase 3.17e-03 3.00e-10 NA NA
5. P P61527 Argininosuccinate synthase 4.76e-03 2.25e-11 NA NA
5. P P66977 tRNA-specific 2-thiouridylase MnmA 2.24e-02 4.02e-06 NA NA
5. P Q9CHA1 tRNA-specific 2-thiouridylase MnmA 1.51e-02 1.86e-10 NA NA
5. P O85176 Argininosuccinate synthase 3.12e-03 1.74e-09 NA NA
5. P Q820U1 tRNA-specific 2-thiouridylase MnmA 3.71e-02 3.92e-10 NA NA
5. P P75365 tRNA-specific 2-thiouridylase MnmA 2.15e-02 2.99e-08 NA NA
5. P B2RHP0 tRNA-specific 2-thiouridylase MnmA 5.01e-02 1.79e-08 NA NA
5. P Q5ZKW0 Mitochondrial tRNA-specific 2-thiouridylase 1 9.68e-02 4.43e-08 NA NA
5. P Q9CC10 Argininosuccinate synthase 5.93e-03 3.14e-11 NA NA
5. P A7FT69 tRNA-specific 2-thiouridylase MnmA 1 2.96e-02 7.15e-07 NA NA
5. P B1X0U7 tRNA-specific 2-thiouridylase MnmA 5.54e-03 7.70e-08 NA NA
5. P Q8A0Y3 tRNA-specific 2-thiouridylase MnmA 3 2.07e-02 8.75e-09 NA NA
5. P Q5LST9 tRNA-specific 2-thiouridylase MnmA 6.31e-02 1.76e-06 NA NA
5. P A1UUF5 Argininosuccinate synthase 5.22e-03 1.32e-11 NA NA
5. P C1F510 Argininosuccinate synthase 1.13e-02 3.22e-11 NA NA
5. P A5UFX6 tRNA-specific 2-thiouridylase MnmA 3.06e-02 9.90e-07 NA NA
5. P A1KN20 tRNA-specific 2-thiouridylase MnmA 2.31e-02 4.02e-06 NA NA
5. P Q13D88 Argininosuccinate synthase 1.34e-02 2.14e-12 NA NA
5. P B1K5H3 Argininosuccinate synthase 1.17e-02 8.24e-12 NA NA
5. P A8G7L2 Argininosuccinate synthase 7.57e-03 2.98e-11 NA NA
5. P Q0BWI1 Argininosuccinate synthase 5.89e-03 1.72e-11 NA NA
5. P B2UV99 tRNA-specific 2-thiouridylase MnmA 3.54e-02 1.70e-09 NA NA
5. P A0K4M4 tRNA-specific 2-thiouridylase MnmA 9.41e-02 2.33e-08 NA NA
5. P C0R4S5 tRNA-specific 2-thiouridylase MnmA 6.55e-03 2.49e-05 NA NA
5. P Q8XMJ7 Argininosuccinate synthase 4.43e-03 6.05e-10 NA NA
5. P A4VXZ4 Argininosuccinate synthase 2.93e-03 1.21e-10 NA NA
5. P B1KZE1 tRNA-specific 2-thiouridylase MnmA 1 9.72e-03 3.97e-06 NA NA
5. P Q4A634 tRNA-specific 2-thiouridylase MnmA 2.06e-02 1.07e-07 NA NA
5. P C3PN11 tRNA-specific 2-thiouridylase MnmA 6.88e-03 2.46e-07 NA NA
5. P A0L251 Argininosuccinate synthase 4.38e-03 5.32e-10 NA NA
5. P Q8P8J4 Argininosuccinate synthase 4.87e-03 2.82e-07 NA NA
5. P Q6HCP7 Argininosuccinate synthase 3.22e-03 3.71e-09 NA NA
5. P Q1IPC9 tRNA-specific 2-thiouridylase MnmA 1.21e-02 5.54e-08 NA NA
5. P B1HUL3 tRNA-specific 2-thiouridylase MnmA 3.12e-02 6.07e-09 NA NA
5. P Q3SNT5 Argininosuccinate synthase 5.04e-03 9.40e-14 NA NA
5. P Q8X735 tRNA-specific 2-thiouridylase MnmA 9.57e-02 3.20e-09 NA NA
5. P Q8KBD3 tRNA-specific 2-thiouridylase MnmA 1.61e-01 4.40e-07 NA NA
5. P B5YAL9 Argininosuccinate synthase 4.16e-03 2.03e-12 NA NA
5. P Q8UC31 Argininosuccinate synthase 3.37e-03 7.11e-11 NA NA
5. P Q2RSS1 tRNA-specific 2-thiouridylase MnmA 5.43e-02 9.71e-06 NA NA
5. P A0LEL7 tRNA-specific 2-thiouridylase MnmA 3.09e-02 3.58e-09 NA NA
5. P A5FHA9 tRNA-specific 2-thiouridylase MnmA 1.46e-02 1.12e-08 NA NA
5. P C3L9T6 Argininosuccinate synthase 3.38e-03 4.87e-09 NA NA
5. P Q1GAS1 tRNA-specific 2-thiouridylase MnmA 1.36e-02 5.53e-10 NA NA
5. P B2V3V9 tRNA-specific 2-thiouridylase MnmA 2.41e-02 1.24e-05 NA NA
5. P P9WG53 tRNA(Ile)-lysidine synthase 3.33e-16 4.14e-05 NA NA
5. P A0KW11 tRNA-specific 2-thiouridylase MnmA 2.90e-02 3.63e-10 NA NA
5. P Q7MB22 tRNA-specific 2-thiouridylase MnmA 7.33e-02 1.51e-08 NA NA
5. P A4J2K1 tRNA-specific 2-thiouridylase MnmA 1.34e-02 1.43e-07 NA NA
5. P B1I814 Argininosuccinate synthase 2.69e-03 1.26e-09 NA NA
5. P Q8G5F2 Argininosuccinate synthase 8.06e-03 5.68e-11 NA NA
5. P B3CLZ0 tRNA-specific 2-thiouridylase MnmA 1.60e-02 1.44e-05 NA NA
5. P A4QDZ4 Argininosuccinate synthase 5.56e-03 1.92e-09 NA NA
5. P B7HRS7 Argininosuccinate synthase 3.48e-03 4.10e-09 NA NA
5. P Q9JTJ9 tRNA-specific 2-thiouridylase MnmA 8.10e-02 2.68e-06 NA NA
5. P B1KND6 Argininosuccinate synthase 3.38e-03 1.57e-11 NA NA
5. P B3EJ62 Argininosuccinate synthase 4.15e-03 1.07e-09 NA NA
5. P B2UL75 Glycosyl hydrolase family 109 protein 1 1.73e-01 3.20e-02 NA NA
5. P P63645 Argininosuccinate synthase 3.93e-03 7.94e-09 NA NA
5. P A1SMB0 tRNA-specific 2-thiouridylase MnmA 1.54e-02 7.94e-09 NA NA
5. P Q9W5B6 Mitochondrial tRNA-specific 2-thiouridylase 1 2.17e-02 2.76e-09 NA NA
5. P Q2G2Z1 tRNA-specific 2-thiouridylase MnmA 4.98e-02 2.43e-07 NA NA
5. P Q07SU0 tRNA-specific 2-thiouridylase MnmA 1.64e-02 7.82e-07 NA NA
5. P Q4A7U1 tRNA-specific 2-thiouridylase MnmA 1.73e-02 1.66e-09 NA NA
5. P Q1JED4 tRNA-specific 2-thiouridylase MnmA 6.97e-03 3.95e-09 NA NA
5. P C3PB97 Argininosuccinate synthase 3.55e-03 4.87e-09 NA NA
5. P A9HMI3 tRNA-specific 2-thiouridylase MnmA 9.87e-03 2.54e-07 NA NA
5. P A9BBQ7 tRNA-specific 2-thiouridylase MnmA 2.69e-02 4.38e-06 NA NA
5. P A9HIQ4 Argininosuccinate synthase 9.70e-03 9.18e-12 NA NA
5. P B9E0B1 Argininosuccinate synthase 5.19e-03 5.61e-11 NA NA
5. P O75648 Mitochondrial tRNA-specific 2-thiouridylase 1 4.91e-02 8.07e-08 NA NA
5. P Q8F625 tRNA-specific 2-thiouridylase MnmA 1.78e-02 1.69e-06 NA NA
5. P A4SD47 tRNA-specific 2-thiouridylase MnmA 1.60e-01 2.04e-08 NA NA
5. P A7X0H5 Argininosuccinate synthase 4.19e-03 7.94e-09 NA NA
5. P Q0AKJ6 Argininosuccinate synthase 4.65e-03 3.46e-12 NA NA
5. P Q1B7R1 Argininosuccinate synthase 3.12e-03 2.38e-11 NA NA
5. P P09034 Argininosuccinate synthase 9.20e-03 3.19e-10 NA NA
5. P A7HV69 tRNA-specific 2-thiouridylase MnmA 2.00e-02 1.30e-07 NA NA
5. P B0SJR2 Argininosuccinate synthase 3.21e-03 1.42e-08 NA NA
5. P Q5KWT8 tRNA-specific 2-thiouridylase MnmA 2 7.49e-02 3.58e-11 NA NA
5. P B3Q9D3 Argininosuccinate synthase 8.44e-03 3.41e-12 NA NA
5. P Q39XA9 tRNA-specific 2-thiouridylase MnmA 1.91e-02 4.48e-08 NA NA
5. P A7HNX2 tRNA-specific 2-thiouridylase MnmA 4.87e-02 7.74e-07 NA NA
5. P P9WPW7 Argininosuccinate synthase 3.20e-03 3.49e-11 NA NA
5. P A0Q454 tRNA-specific 2-thiouridylase MnmA 1.61e-02 2.76e-09 NA NA
5. P Q3A9W5 Argininosuccinate synthase 3.41e-03 1.38e-10 NA NA
5. P A7Z745 tRNA-specific 2-thiouridylase MnmA 1.18e-02 1.79e-10 NA NA
5. P B8FWX2 Argininosuccinate synthase 3.26e-03 1.97e-09 NA NA
5. P Q5LXJ9 tRNA-specific 2-thiouridylase MnmA 6.52e-03 6.78e-09 NA NA
5. P B9DVV9 Argininosuccinate synthase 2.59e-03 5.84e-11 NA NA
5. P Q93JQ8 Argininosuccinate synthase 5.16e-03 4.43e-08 NA NA
5. P Q0S8E7 tRNA(Ile)-lysidine synthase 1.11e-16 1.27e-04 NA NA
5. P A4VYE7 tRNA-specific 2-thiouridylase MnmA 6.46e-03 1.83e-08 NA NA
5. P A8GDD5 tRNA-specific 2-thiouridylase MnmA 7.64e-02 2.89e-08 NA NA
5. P A1VEQ0 Argininosuccinate synthase 1.04e-02 1.07e-10 NA NA
5. P Q04TZ4 tRNA-specific 2-thiouridylase MnmA 2.53e-02 9.96e-08 NA NA
5. P B6IZW5 tRNA-specific 2-thiouridylase MnmA 1.08e-02 1.93e-07 NA NA
5. P B1XN65 Argininosuccinate synthase 3.79e-03 9.43e-12 NA NA
5. P P73755 tRNA-specific 2-thiouridylase MnmA 1.05e-02 2.32e-09 NA NA
5. P Q17Z16 tRNA-specific 2-thiouridylase MnmA 7.57e-02 2.53e-09 NA NA
5. P B0SWD8 tRNA-specific 2-thiouridylase MnmA 1.79e-02 1.41e-05 NA NA
5. P B7N0V6 Argininosuccinate synthase 1.17e-02 6.29e-12 NA NA
5. P A1B9H0 tRNA-specific 2-thiouridylase MnmA 5.71e-02 2.18e-04 NA NA
5. P Q1IIZ2 Argininosuccinate synthase 3.51e-03 7.40e-10 NA NA
5. P Q8ZU97 Argininosuccinate synthase 9.89e-03 4.92e-11 NA NA
5. P Q5PBB1 tRNA-specific 2-thiouridylase MnmA 9.18e-03 9.41e-06 NA NA
5. P A6U290 tRNA-specific 2-thiouridylase MnmA 1.04e-02 8.65e-09 NA NA
5. P B4RQS8 Argininosuccinate synthase 8.39e-03 2.06e-10 NA NA
5. P Q2A5X5 tRNA-specific 2-thiouridylase MnmA 1.66e-02 6.69e-10 NA NA
5. P P59460 tRNA-specific 2-thiouridylase MnmA 2.50e-02 3.21e-08 NA NA
5. P Q5WHN4 tRNA-specific 2-thiouridylase MnmA 6.83e-02 9.06e-10 NA NA
5. P B1WTK3 Argininosuccinate synthase 6.21e-03 2.16e-11 NA NA
5. P B7UVV5 Argininosuccinate synthase 8.10e-03 4.99e-12 NA NA
5. P A6UCQ0 tRNA-specific 2-thiouridylase MnmA 1.52e-02 1.00e-09 NA NA
5. P B7LHN6 Argininosuccinate synthase 1.18e-02 6.37e-12 NA NA
5. P A1BI85 tRNA-specific 2-thiouridylase MnmA 1.51e-01 9.30e-09 NA NA
5. P A1BG29 Argininosuccinate synthase 4.16e-03 2.96e-10 NA NA
5. P B0K584 tRNA-specific 2-thiouridylase MnmA 1 2.10e-02 2.92e-08 NA NA
5. P A2SK99 Argininosuccinate synthase 8.77e-03 8.46e-12 NA NA
5. P A9IL50 Argininosuccinate synthase 7.73e-03 1.83e-13 NA NA
5. P A2SLT0 tRNA-specific 2-thiouridylase MnmA 2.19e-01 3.41e-09 NA NA
5. P A4SKS0 tRNA-specific 2-thiouridylase MnmA 3.05e-02 1.27e-09 NA NA
5. P B9KEW8 tRNA-specific 2-thiouridylase MnmA 1.29e-02 5.22e-08 NA NA
5. P B5YS62 Argininosuccinate synthase 1.18e-02 6.29e-12 NA NA
5. P Q057R1 tRNA-specific 2-thiouridylase MnmA 2.44e-02 1.23e-07 NA NA
5. P Q0BVJ1 Argininosuccinate synthase 5.28e-03 6.20e-12 NA NA
5. P A0RP84 Argininosuccinate synthase 6.48e-03 8.15e-14 NA NA
5. P Q2FGA5 tRNA-specific 2-thiouridylase MnmA 9.94e-03 8.65e-09 NA NA
5. P Q5M249 tRNA-specific 2-thiouridylase MnmA 6.61e-03 6.78e-09 NA NA
5. P Q89ES7 tRNA-specific 2-thiouridylase MnmA 1.45e-02 1.69e-06 NA NA
5. P B7LR40 Argininosuccinate synthase 1.16e-02 4.54e-12 NA NA
5. P A3MP84 tRNA-specific 2-thiouridylase MnmA 9.14e-02 3.89e-08 NA NA
5. P Q21DC6 Argininosuccinate synthase 8.46e-03 5.87e-12 NA NA
5. P B0SG84 tRNA-specific 2-thiouridylase MnmA 1.39e-02 4.64e-08 NA NA
5. P Q7ZWM4 Argininosuccinate synthase 7.13e-03 1.34e-11 NA NA
5. P B4TJ09 Argininosuccinate synthase 1.13e-02 2.47e-11 NA NA
5. P A2S7V6 Argininosuccinate synthase 1.07e-02 9.47e-11 NA NA
5. P Q2ISK2 tRNA-specific 2-thiouridylase MnmA 1.97e-02 1.13e-07 NA NA
5. P B8E945 tRNA-specific 2-thiouridylase MnmA 9.97e-03 1.29e-09 NA NA
5. P Q2J6U1 tRNA-specific 2-thiouridylase MnmA 1.23e-02 1.12e-09 NA NA
5. P B1ZGZ6 tRNA-specific 2-thiouridylase MnmA 2.28e-02 4.76e-07 NA NA
5. P Q03EZ6 tRNA-specific 2-thiouridylase MnmA 3.53e-02 3.63e-10 NA NA
5. P Q5NPG7 tRNA-specific 2-thiouridylase MnmA 3.88e-02 2.40e-07 NA NA
5. P B2GKD7 Argininosuccinate synthase 7.18e-03 2.21e-09 NA NA
5. P Q8ZFV7 Argininosuccinate synthase 1.27e-02 1.68e-11 NA NA
5. P C1KVF9 tRNA-specific 2-thiouridylase MnmA 9.47e-02 3.07e-10 NA NA
5. P C0RGD6 Argininosuccinate synthase 4.23e-03 3.49e-11 NA NA
5. P P0DC34 tRNA-specific 2-thiouridylase MnmA 7.15e-03 3.90e-09 NA NA
5. P A5I5A4 Argininosuccinate synthase 4.14e-03 9.35e-11 NA NA
5. P B2GL48 tRNA-specific 2-thiouridylase MnmA 8.34e-03 1.24e-08 NA NA
5. P Q633G4 Argininosuccinate synthase 3.37e-03 4.99e-09 NA NA
5. P Q8R7F0 tRNA-specific 2-thiouridylase MnmA 2 2.15e-02 2.82e-08 NA NA
5. P A1V7X3 Argininosuccinate synthase 1.05e-02 9.47e-11 NA NA
5. P A5GUP6 tRNA-specific 2-thiouridylase MnmA 1.31e-02 1.32e-08 NA NA
5. P Q2LWA6 tRNA-specific 2-thiouridylase MnmA 1 4.81e-02 5.93e-06 NA NA
5. P B0UW58 Argininosuccinate synthase 8.08e-03 1.87e-11 NA NA
5. P Q02BG1 tRNA-specific 2-thiouridylase MnmA 9.16e-03 1.42e-10 NA NA
5. P A2BXZ8 tRNA-specific 2-thiouridylase MnmA 4.60e-02 2.89e-08 NA NA
5. P A5FR85 tRNA-specific 2-thiouridylase MnmA 2.70e-02 1.04e-07 NA NA
5. P Q3Z727 Argininosuccinate synthase 4.17e-03 3.62e-08 NA NA
5. P A5FWI5 Argininosuccinate synthase 1.02e-02 1.11e-10 NA NA
5. P A9WFH2 tRNA-specific 2-thiouridylase MnmA 2.31e-02 5.44e-09 NA NA
5. P Q72DX2 tRNA-specific 2-thiouridylase MnmA 4.35e-02 6.16e-08 NA NA
5. P Q039P7 tRNA-specific 2-thiouridylase MnmA 1.12e-02 5.89e-10 NA NA
5. P A9WMS3 tRNA-specific 2-thiouridylase MnmA 1.81e-02 9.42e-09 NA NA
5. P Q1QVN0 Argininosuccinate synthase 6.23e-03 8.02e-12 NA NA
5. P Q92IL0 tRNA-specific 2-thiouridylase MnmA 4.59e-03 1.49e-06 NA NA
5. P Q8YX56 tRNA-specific 2-thiouridylase MnmA 6.36e-03 3.70e-08 NA NA
5. P A1VFH0 tRNA-specific 2-thiouridylase MnmA 4.38e-02 5.61e-08 NA NA
5. P Q2RZN9 tRNA-specific 2-thiouridylase MnmA 1.37e-02 2.43e-07 NA NA
5. P Q04P84 Argininosuccinate synthase 3.04e-03 1.21e-08 NA NA
5. P A6KZV1 tRNA-specific 2-thiouridylase MnmA 3 1.35e-02 1.20e-08 NA NA
5. P Q9PHK7 Argininosuccinate synthase 9.01e-03 3.93e-11 NA NA
5. P B2U204 Argininosuccinate synthase 1.18e-02 4.86e-12 NA NA
5. P A7ZS69 Argininosuccinate synthase 9.09e-03 6.37e-12 NA NA
5. P A1VTY5 tRNA-specific 2-thiouridylase MnmA 3.12e-02 3.89e-08 NA NA
5. P O34347 Argininosuccinate synthase 3.46e-03 1.12e-08 NA NA
5. P A3PFJ6 Argininosuccinate synthase 1.04e-02 4.48e-12 NA NA
5. P Q5SLN5 tRNA-specific 2-thiouridylase MnmA 6.05e-03 2.14e-08 NA NA
5. P Q8K9Q8 tRNA-specific 2-thiouridylase MnmA 1.38e-01 1.58e-09 NA NA
5. P A4SEI8 Argininosuccinate synthase 4.10e-03 2.09e-10 NA NA
5. P A2CE29 Argininosuccinate synthase 6.56e-03 6.88e-13 NA NA
5. P Q8U9M5 tRNA-specific 2-thiouridylase MnmA 2.07e-02 7.56e-09 NA NA
5. P B7JVH4 Argininosuccinate synthase 5.00e-03 3.58e-11 NA NA
5. P Q4L4X7 Argininosuccinate synthase 3.51e-03 7.29e-09 NA NA
5. P A0LE34 Argininosuccinate synthase 6.95e-03 1.92e-12 NA NA
5. P A0KI53 tRNA-specific 2-thiouridylase MnmA 3.11e-02 1.46e-09 NA NA
5. P B2TQ23 Argininosuccinate synthase 4.14e-03 7.11e-11 NA NA
5. P Q6L1N7 Argininosuccinate synthase 4.12e-03 7.60e-12 NA NA
5. P A9KPI9 tRNA-specific 2-thiouridylase MnmA 1.36e-02 6.57e-05 NA NA
5. P Q31H63 Argininosuccinate synthase 7.71e-03 4.92e-12 NA NA
5. P Q87ZR6 tRNA-specific 2-thiouridylase MnmA 5.30e-02 3.50e-07 NA NA
5. P Q3Z2Y6 tRNA-specific 2-thiouridylase MnmA 9.58e-02 3.67e-09 NA NA
5. P Q04ZN1 tRNA-specific 2-thiouridylase MnmA 1.36e-02 9.96e-08 NA NA
5. P B1JBJ1 tRNA-specific 2-thiouridylase MnmA 1.07e-01 3.03e-08 NA NA
5. P A8AUN6 Argininosuccinate synthase 3.17e-03 1.00e-09 NA NA
5. P B3DSY7 Argininosuccinate synthase 8.08e-03 6.23e-11 NA NA
5. P Q7VAT9 tRNA-specific 2-thiouridylase MnmA 2.84e-02 4.92e-08 NA NA
5. P Q6G8U8 tRNA-specific 2-thiouridylase MnmA 1.05e-02 4.99e-09 NA NA
5. P A6LIF1 tRNA-specific 2-thiouridylase MnmA 4.76e-02 4.43e-08 NA NA
5. P B0KC14 tRNA-specific 2-thiouridylase MnmA 1 1.98e-02 2.85e-08 NA NA
5. P Q489P3 Argininosuccinate synthase 1.12e-02 5.76e-11 NA NA
5. P Q6MTG1 tRNA-specific 2-thiouridylase MnmA 1.15e-02 1.70e-08 NA NA
5. P B2UBA3 Argininosuccinate synthase 9.20e-03 3.50e-12 NA NA
5. P Q5F5G5 Argininosuccinate synthase 8.55e-03 2.06e-10 NA NA
5. P A5N6U2 Argininosuccinate synthase 5.06e-03 5.61e-11 NA NA
5. P B9IYG1 tRNA-specific 2-thiouridylase MnmA 2.75e-02 2.75e-08 NA NA
5. P Q04B58 tRNA-specific 2-thiouridylase MnmA 1.37e-02 4.51e-10 NA NA
5. P A9N4K8 tRNA-specific 2-thiouridylase MnmA 9.40e-02 5.71e-09 NA NA
5. P B6EMN8 Argininosuccinate synthase 5.48e-03 8.21e-11 NA NA
5. P A5ITE6 tRNA-specific 2-thiouridylase MnmA 1.02e-02 8.65e-09 NA NA
5. P A5VJH1 Argininosuccinate synthase 4.89e-03 2.05e-09 NA NA
5. P B5RQ24 tRNA-specific 2-thiouridylase MnmA 9.53e-02 3.21e-08 NA NA
5. P A2C457 tRNA-specific 2-thiouridylase MnmA 2.22e-02 7.65e-07 NA NA
5. P Q6NA79 tRNA-specific 2-thiouridylase MnmA 1.89e-02 8.46e-07 NA NA
5. P B8DH28 Argininosuccinate synthase 2.94e-03 6.61e-08 NA NA
5. P Q47AW0 tRNA-specific 2-thiouridylase MnmA 8.99e-02 2.13e-09 NA NA
5. P B9MRP5 Argininosuccinate synthase 5.78e-03 2.28e-11 NA NA
5. P C4Z4C1 Argininosuccinate synthase 5.98e-03 2.79e-11 NA NA
5. P Q9KDF2 tRNA-specific 2-thiouridylase MnmA 4.82e-02 2.63e-09 NA NA
5. P B2JP23 Argininosuccinate synthase 1.11e-02 3.93e-11 NA NA
5. P P66979 tRNA-specific 2-thiouridylase MnmA 6.70e-03 5.75e-10 NA NA
5. P Q47N84 Argininosuccinate synthase 2.33e-03 4.75e-08 NA NA
5. P Q042R4 tRNA-specific 2-thiouridylase MnmA 8.93e-03 3.16e-09 NA NA
5. P Q7VTJ9 Argininosuccinate synthase 3.91e-02 5.39e-11 NA NA
5. P Q62H98 tRNA-specific 2-thiouridylase MnmA 7.76e-02 3.89e-08 NA NA
5. P Q0B4C4 Argininosuccinate synthase 1.17e-02 1.20e-11 NA NA
5. P A7H4E9 Argininosuccinate synthase 6.51e-03 6.31e-11 NA NA
5. P A0KYQ9 Glycosyl hydrolase family 109 protein 2 1.95e-01 6.73e-03 NA NA
5. P C0MB53 tRNA-specific 2-thiouridylase MnmA 6.55e-03 5.11e-09 NA NA
5. P Q609X7 Argininosuccinate synthase 9.73e-03 6.15e-13 NA NA
5. P Q15T93 tRNA-specific 2-thiouridylase MnmA 9.64e-02 1.75e-02 NA NA
5. P A1SJJ3 Argininosuccinate synthase 1.41e-02 1.55e-08 NA NA
5. P Q16D10 Argininosuccinate synthase 1.02e-02 5.54e-11 NA NA
5. P B0TFA7 tRNA-specific 2-thiouridylase MnmA 1.33e-02 4.78e-05 NA NA
5. P Q4L6W8 tRNA-specific 2-thiouridylase MnmA 1.05e-02 3.58e-09 NA NA
5. P P9WJS4 tRNA-specific 2-thiouridylase MnmA 1.68e-02 4.02e-06 NA NA
5. P Q0HTG8 Glycosyl hydrolase family 109 protein 2 1.56e-01 7.37e-03 NA NA
5. P A4SIM5 Argininosuccinate synthase 3.94e-03 1.12e-10 NA NA
5. P A1WWV9 tRNA-specific 2-thiouridylase MnmA 2.90e-02 6.78e-09 NA NA
5. P Q6LVG8 Argininosuccinate synthase 4.48e-03 2.96e-10 NA NA
5. P B9K8S7 Argininosuccinate synthase 6.67e-03 1.76e-09 NA NA
5. P A5ED38 tRNA-specific 2-thiouridylase MnmA 2.18e-02 4.73e-06 NA NA
5. P Q0SMH1 tRNA-specific 2-thiouridylase MnmA 6.77e-02 1.03e-08 NA NA
5. P Q02QZ6 Argininosuccinate synthase 8.30e-03 4.99e-12 NA NA
5. P A5CSJ0 Argininosuccinate synthase 3.55e-03 1.39e-08 NA NA
5. P A7N9A5 tRNA-specific 2-thiouridylase MnmA 1.49e-02 6.69e-10 NA NA
5. P Q71XS4 Argininosuccinate synthase 2.80e-03 6.61e-08 NA NA
5. P A1W9F9 Argininosuccinate synthase 8.98e-03 4.54e-12 NA NA
5. P A1UH96 Argininosuccinate synthase 3.29e-03 2.38e-11 NA NA
5. P Q3K7K0 Argininosuccinate synthase 8.06e-03 8.58e-12 NA NA
5. P A6SW90 Argininosuccinate synthase 9.05e-03 1.28e-11 NA NA
5. P A8FFP0 tRNA-specific 2-thiouridylase MnmA 8.16e-02 5.57e-09 NA NA
5. P C4K1W0 tRNA-specific 2-thiouridylase MnmA 6.41e-03 3.62e-07 NA NA
5. P A3NDE4 tRNA-specific 2-thiouridylase MnmA 9.27e-02 3.79e-08 NA NA
5. P A8F172 tRNA-specific 2-thiouridylase MnmA 6.33e-03 8.56e-07 NA NA
5. P Q73FR5 tRNA-specific 2-thiouridylase MnmA 7.25e-03 4.54e-05 NA NA
5. P C1BA63 tRNA(Ile)-lysidine synthase 2.22e-16 1.45e-03 NA NA
5. P Q03IP8 Argininosuccinate synthase 3.16e-03 3.00e-10 NA NA
5. P A9MG80 tRNA-specific 2-thiouridylase MnmA 9.37e-02 9.30e-09 NA NA
5. P Q1MQL7 Argininosuccinate synthase 7.75e-03 2.34e-11 NA NA
5. P Q2YQB2 tRNA-specific 2-thiouridylase MnmA 1.68e-02 6.11e-07 NA NA
5. P Q9RWJ4 Argininosuccinate synthase 7.29e-03 2.09e-10 NA NA
5. P A8GVU7 tRNA-specific 2-thiouridylase MnmA 7.44e-03 1.00e-06 NA NA
5. P B9DWD3 tRNA-specific 2-thiouridylase MnmA 6.76e-03 5.39e-10 NA NA
5. P Q83HX5 tRNA-specific 2-thiouridylase MnmA 1.69e-02 3.81e-09 NA NA
5. P A5IRD9 Argininosuccinate synthase 3.81e-03 7.94e-09 NA NA
5. P A3CRB2 tRNA-specific 2-thiouridylase MnmA 7.08e-03 1.08e-10 NA NA
5. P Q07935 Nitrogenase iron-iron protein beta chain 1.06e-01 1.48e-02 NA NA
5. P B9KR64 tRNA-specific 2-thiouridylase MnmA 6.65e-02 3.00e-05 NA NA
5. P Q9RTK1 tRNA-specific 2-thiouridylase MnmA 1.16e-02 1.75e-06 NA NA
5. P A4J081 tRNA-specific 2-thiouridylase MnmA 1.51e-02 8.40e-10 NA NA
5. P A1VZ24 Argininosuccinate synthase 8.48e-03 2.44e-11 NA NA
5. P Q0C4H3 tRNA-specific 2-thiouridylase MnmA 2.35e-02 1.82e-05 NA NA
5. P Q8ZLT0 Argininosuccinate synthase 1.11e-02 8.13e-12 NA NA
5. P A5WG08 Argininosuccinate synthase 5.65e-03 1.20e-12 NA NA
5. P Q1RD20 tRNA-specific 2-thiouridylase MnmA 9.65e-02 4.20e-09 NA NA
5. P P59605 Argininosuccinate synthase 3.97e-03 4.92e-13 NA NA
5. P Q820Y1 tRNA-specific 2-thiouridylase MnmA 1.68e-02 3.58e-09 NA NA
5. P A8LYQ9 Argininosuccinate synthase 3.57e-03 4.52e-09 NA NA
5. P B8CWH7 tRNA-specific 2-thiouridylase MnmA 1.38e-02 2.43e-07 NA NA
5. P B1L8X5 tRNA-specific 2-thiouridylase MnmA 7.33e-02 1.46e-08 NA NA
5. P Q0ADM9 tRNA-specific 2-thiouridylase MnmA 8.06e-02 2.09e-10 NA NA
5. P Q6F152 tRNA-specific 2-thiouridylase MnmA 1.32e-02 4.07e-10 NA NA
5. P Q820W2 tRNA-specific 2-thiouridylase MnmA 1.00e-02 9.30e-09 NA NA
5. P B0U6Q7 tRNA-specific 2-thiouridylase MnmA 2.85e-02 7.79e-10 NA NA
5. P B4U0P1 tRNA-specific 2-thiouridylase MnmA 6.26e-03 5.11e-09 NA NA
5. P B0RHD5 Argininosuccinate synthase 3.68e-03 1.20e-07 NA NA
5. P B1YJ35 Argininosuccinate synthase 3.40e-03 4.75e-08 NA NA
5. P Q8CPU3 Argininosuccinate synthase 4.05e-03 8.14e-09 NA NA
5. P B9KBD1 tRNA-specific 2-thiouridylase MnmA 7.13e-02 1.12e-07 NA NA
5. P Q8Y5H2 Argininosuccinate synthase 3.02e-03 3.84e-08 NA NA
5. P Q7M7P6 Argininosuccinate synthase 7.22e-03 1.30e-12 NA NA
5. P Q9ZDM1 tRNA-specific 2-thiouridylase MnmA 2.09e-02 1.46e-07 NA NA
5. P A0Q152 tRNA-specific 2-thiouridylase MnmA 2.48e-02 1.95e-07 NA NA
5. P Q5GZR1 tRNA-specific 2-thiouridylase MnmA 1.40e-02 1.70e-09 NA NA
5. P B1W3B3 Argininosuccinate synthase 3.79e-03 6.20e-10 NA NA
5. P Q2NEC4 Argininosuccinate synthase 1.45e-03 5.49e-12 NA NA
5. P Q6HDD0 tRNA-specific 2-thiouridylase MnmA 2.62e-02 2.75e-08 NA NA
5. P Q39Z72 Argininosuccinate synthase 6.44e-03 1.42e-10 NA NA
5. P Q3KM75 tRNA-specific 2-thiouridylase MnmA 1.44e-02 3.08e-09 NA NA
5. P B2SMD7 tRNA-specific 2-thiouridylase MnmA 2.69e-02 1.70e-09 NA NA
5. P Q6AR59 Argininosuccinate synthase 8.85e-03 3.41e-10 NA NA
5. P Q5ZJ23 Argininosuccinate synthase 6.69e-03 2.70e-10 NA NA
5. P Q8FTM9 Argininosuccinate synthase 3.50e-03 5.46e-10 NA NA
5. P B2JGI9 tRNA-specific 2-thiouridylase MnmA 5.24e-02 1.62e-08 NA NA
5. P Q12XK3 Argininosuccinate synthase 2.21e-03 9.43e-12 NA NA
5. P A8HVS0 tRNA-specific 2-thiouridylase MnmA 2.08e-02 1.33e-07 NA NA
5. P A1KWJ8 Argininosuccinate synthase 8.47e-03 1.05e-10 NA NA
5. P Q1C6S0 tRNA-specific 2-thiouridylase MnmA 9.77e-02 9.53e-09 NA NA
5. P A4XUY9 tRNA-specific 2-thiouridylase MnmA 2.21e-02 3.45e-08 NA NA
5. P A3DDC8 tRNA-specific 2-thiouridylase MnmA 1.09e-02 6.97e-06 NA NA
5. P Q6FZ46 tRNA-specific 2-thiouridylase MnmA 2.67e-02 1.08e-07 NA NA
5. P B2GB92 tRNA-specific 2-thiouridylase MnmA 2.28e-02 1.04e-09 NA NA
5. P A8F446 Argininosuccinate synthase 5.15e-03 3.45e-10 NA NA
5. P Q12N64 tRNA-specific 2-thiouridylase MnmA 2.67e-02 3.63e-11 NA NA
5. P P0DC35 tRNA-specific 2-thiouridylase MnmA 7.24e-03 3.90e-09 NA NA
5. P Q8X9M0 Argininosuccinate synthase 8.95e-03 6.29e-12 NA NA
5. P A8Z067 Argininosuccinate synthase 3.70e-03 7.94e-09 NA NA
5. P A0AYH4 Argininosuccinate synthase 1.18e-02 8.24e-12 NA NA
5. P A1KJ75 Argininosuccinate synthase 3.21e-03 3.49e-11 NA NA
5. P B3PM68 tRNA-specific 2-thiouridylase MnmA 2.69e-02 5.11e-09 NA NA
5. P Q1J455 tRNA-specific 2-thiouridylase MnmA 7.09e-03 1.88e-09 NA NA
5. P Q8XJH3 tRNA-specific 2-thiouridylase MnmA 6.72e-02 8.95e-07 NA NA
5. P A3NQI1 Argininosuccinate synthase 1.06e-02 9.47e-11 NA NA
5. P A5VFM2 tRNA-specific 2-thiouridylase MnmA 1.20e-02 1.78e-05 NA NA
5. P Q7NWJ5 Argininosuccinate synthase 8.03e-03 4.57e-10 NA NA
5. P Q03I88 tRNA-specific 2-thiouridylase MnmA 6.65e-03 1.04e-08 NA NA
5. P Q122U9 tRNA-specific 2-thiouridylase MnmA 3.87e-02 4.53e-08 NA NA
5. P A3M7G3 tRNA-specific 2-thiouridylase MnmA 1.50e-02 8.26e-08 NA NA
5. P Q5FUA8 Argininosuccinate synthase 3.97e-03 6.12e-12 NA NA
5. P Q2YPQ8 Argininosuccinate synthase 3.27e-03 3.49e-11 NA NA
5. P B2UYI0 Argininosuccinate synthase 3.68e-03 2.04e-10 NA NA
5. P A4YJX9 Argininosuccinate synthase 8.86e-03 4.30e-12 NA NA
5. P Q166E3 tRNA-specific 2-thiouridylase MnmA 7.06e-02 8.75e-07 NA NA
5. P Q2P2Q7 tRNA-specific 2-thiouridylase MnmA 1.47e-02 5.97e-10 NA NA
5. P B8IU32 tRNA-specific 2-thiouridylase MnmA 1.51e-02 1.83e-05 NA NA
5. P A0QUW3 tRNA-specific 2-thiouridylase MnmA 1.17e-02 8.86e-08 NA NA
5. P Q9HMQ2 Argininosuccinate synthase 1.37e-03 1.92e-12 NA NA
5. P B8FH30 Argininosuccinate synthase 6.09e-03 5.18e-11 NA NA
5. P B1MZP4 Argininosuccinate synthase 3.59e-03 1.66e-09 NA NA
5. P B1H0L3 Argininosuccinate synthase 3.84e-03 1.55e-11 NA NA
5. P C5CB51 tRNA-specific 2-thiouridylase MnmA 1.83e-02 1.92e-08 NA NA
5. P Q99TM8 tRNA-specific 2-thiouridylase MnmA 1.01e-02 8.65e-09 NA NA
5. P Q5FR73 tRNA-specific 2-thiouridylase MnmA 2.27e-02 1.45e-06 NA NA
5. P Q12D55 Argininosuccinate synthase 8.70e-03 4.42e-12 NA NA
5. P A5VN19 Argininosuccinate synthase 7.73e-03 3.49e-11 NA NA
5. P Q1R6G5 Argininosuccinate synthase 1.17e-02 7.30e-12 NA NA
5. P Q8E272 Argininosuccinate synthase 5.47e-03 1.11e-10 NA NA
5. P Q2SCE5 Argininosuccinate synthase 1.07e-02 2.67e-10 NA NA
5. P Q8R5X3 tRNA-specific 2-thiouridylase MnmA 1 4.35e-02 6.60e-06 NA NA
5. P A0PPW5 tRNA-specific 2-thiouridylase MnmA 2.09e-02 1.90e-08 NA NA
5. P B1LFS3 Argininosuccinate synthase 1.19e-02 6.29e-12 NA NA
5. P Q032X6 Argininosuccinate synthase 2.75e-03 6.53e-08 NA NA
5. P Q46XF1 tRNA-specific 2-thiouridylase MnmA 1.61e-02 6.78e-10 NA NA
5. P Q8Z3H5 Argininosuccinate synthase 1.14e-02 8.58e-12 NA NA
5. P Q6ACL1 Argininosuccinate synthase 1.99e-02 2.02e-08 NA NA
5. P O13947 Mitochondrial tRNA-specific 2-thiouridylase 1 1.44e-02 1.35e-05 NA NA
5. P A9NFP7 tRNA-specific 2-thiouridylase MnmA 2.90e-02 6.37e-09 NA NA
5. P A9KE87 tRNA-specific 2-thiouridylase MnmA 6.05e-02 1.08e-08 NA NA
5. P B7I4K8 tRNA-specific 2-thiouridylase MnmA 1.67e-02 8.26e-08 NA NA
5. P Q8XVV4 tRNA-specific 2-thiouridylase MnmA 9.02e-02 1.17e-09 NA NA
5. P Q634E9 tRNA-specific 2-thiouridylase MnmA 2.75e-02 2.75e-08 NA NA
5. P Q6GG82 tRNA-specific 2-thiouridylase MnmA 1.06e-02 8.65e-09 NA NA
5. P A8EZE8 tRNA-specific 2-thiouridylase MnmA 6.48e-03 3.58e-07 NA NA
5. P Q5NNQ0 Argininosuccinate synthase 5.20e-03 8.24e-13 NA NA
5. P B9J0E1 Argininosuccinate synthase 3.39e-03 3.53e-09 NA NA
5. P A1AG76 Argininosuccinate synthase 1.17e-02 7.30e-12 NA NA
5. P A5CQU4 tRNA-specific 2-thiouridylase MnmA 2.25e-02 8.04e-09 NA NA
5. P P9WPW6 Argininosuccinate synthase 3.19e-03 3.49e-11 NA NA
5. P A4TDZ4 tRNA-specific 2-thiouridylase MnmA 1.87e-02 6.31e-08 NA NA
5. P Q033U7 Argininosuccinate synthase 3.58e-03 5.78e-09 NA NA
5. P Q7TTR0 tRNA-specific 2-thiouridylase MnmA 1.71e-02 1.84e-07 NA NA
5. P P9WJS5 tRNA-specific 2-thiouridylase MnmA 1.75e-02 4.02e-06 NA NA
5. P A7GT74 tRNA-specific 2-thiouridylase MnmA 2.73e-02 1.47e-08 NA NA
5. P Q4UUJ7 tRNA-specific 2-thiouridylase MnmA 2.93e-02 5.30e-09 NA NA
5. P Q01Y56 Argininosuccinate synthase 9.57e-03 1.77e-10 NA NA
5. P Q9JXC1 Argininosuccinate synthase 8.54e-03 5.46e-11 NA NA
5. P Q11G66 tRNA-specific 2-thiouridylase MnmA 1.71e-02 1.42e-08 NA NA
5. P Q8XWC1 Argininosuccinate synthase 8.86e-03 3.23e-12 NA NA
5. P Q4ZRK0 tRNA-specific 2-thiouridylase MnmA 5.44e-02 4.02e-07 NA NA
5. P A6VLY4 tRNA-specific 2-thiouridylase MnmA 3.05e-02 2.97e-05 NA NA
5. P Q1QBM4 tRNA-specific 2-thiouridylase MnmA 1.28e-02 1.65e-05 NA NA
5. P Q31SC8 Argininosuccinate synthase 4.67e-03 2.70e-12 NA NA
5. P P61526 Argininosuccinate synthase 9.52e-03 9.41e-10 NA NA
5. P A1SRI3 Argininosuccinate synthase 4.73e-03 1.35e-10 NA NA
5. P Q8GDU2 Argininosuccinate synthase (Fragment) 5.52e-03 9.85e-11 NA NA
5. P A1AX17 tRNA-specific 2-thiouridylase MnmA 2.14e-02 3.71e-09 NA NA
5. P Q660I8 tRNA-specific 2-thiouridylase MnmA 7.17e-02 2.36e-08 NA NA
5. P P0A6E5 Argininosuccinate synthase 8.98e-03 6.29e-12 NA NA
5. P O67213 Argininosuccinate synthase 5.96e-03 1.16e-06 NA NA
5. P Q5HVA9 Argininosuccinate synthase 7.12e-03 1.89e-11 NA NA
5. P Q1D6N0 tRNA-specific 2-thiouridylase MnmA 4.40e-02 1.26e-07 NA NA
5. P B1KZJ2 tRNA-specific 2-thiouridylase MnmA 2 2.17e-02 2.82e-08 NA NA
5. P Q5N1Z2 Argininosuccinate synthase 7.22e-03 2.70e-12 NA NA
5. P Q6AIZ6 tRNA-specific 2-thiouridylase MnmA 9.80e-03 5.81e-08 NA NA
5. P B2K711 tRNA-specific 2-thiouridylase MnmA 8.81e-02 9.53e-09 NA NA
5. P A8FG70 Argininosuccinate synthase 3.68e-03 1.70e-09 NA NA
5. P Q2J866 Argininosuccinate synthase 2.53e-03 4.81e-09 NA NA
5. P B0BS63 tRNA-specific 2-thiouridylase MnmA 1.19e-02 3.88e-07 NA NA
5. P Q5HXB2 tRNA-specific 2-thiouridylase MnmA 2.25e-02 1.07e-09 NA NA
5. P Q04MW7 Argininosuccinate synthase 5.32e-03 4.81e-10 NA NA
5. P Q8CXQ3 tRNA-specific 2-thiouridylase MnmA 1.63e-02 5.19e-10 NA NA
5. P P59846 Argininosuccinate synthase 5.19e-03 6.86e-10 NA NA
5. P A5UBF3 Argininosuccinate synthase 8.18e-03 1.34e-11 NA NA
5. P A1A1W7 Argininosuccinate synthase 4.90e-03 1.55e-10 NA NA
5. P Q0BP64 tRNA-specific 2-thiouridylase MnmA 1.39e-02 6.69e-10 NA NA
5. P Q7MYD8 Argininosuccinate synthase 8.50e-03 3.10e-12 NA NA
5. P Q7U359 tRNA-specific 2-thiouridylase MnmA 2.45e-02 6.15e-09 NA NA
5. P B2HVN5 tRNA-specific 2-thiouridylase MnmA 1.51e-02 7.61e-08 NA NA
5. P B4U7E2 tRNA-specific 2-thiouridylase MnmA 1.01e-02 9.42e-09 NA NA
5. P A1RIW8 tRNA-specific 2-thiouridylase MnmA 2.81e-02 1.28e-10 NA NA
5. P B7NKP0 Argininosuccinate synthase 9.01e-03 6.29e-12 NA NA
5. P Q8CWM0 tRNA-specific 2-thiouridylase MnmA 6.33e-03 9.65e-09 NA NA
5. P Q8YMX6 Argininosuccinate synthase 5.36e-03 1.55e-10 NA NA
5. P A2BTT9 Argininosuccinate synthase 8.09e-03 6.20e-12 NA NA
5. P Q9PEM9 Argininosuccinate synthase 3.08e-03 2.32e-09 NA NA
5. P Q0T0B0 Argininosuccinate synthase 1.18e-02 5.06e-12 NA NA
5. P P44551 tRNA-specific 2-thiouridylase MnmA 3.27e-02 7.56e-07 NA NA
5. P B2TZ86 tRNA-specific 2-thiouridylase MnmA 9.49e-02 3.28e-09 NA NA
5. P Q117P0 Argininosuccinate synthase 5.59e-03 2.64e-11 NA NA
5. P A9WQ90 Argininosuccinate synthase 6.99e-03 4.07e-10 NA NA
5. P C1ANT1 Argininosuccinate synthase 3.21e-03 3.49e-11 NA NA
5. P Q3ZXD7 tRNA-specific 2-thiouridylase MnmA 2.63e-02 1.04e-07 NA NA
5. P B7GZ21 tRNA-specific 2-thiouridylase MnmA 1.68e-02 8.26e-08 NA NA
5. P Q2JM78 tRNA-specific 2-thiouridylase MnmA 6.02e-03 7.79e-08 NA NA
5. P A4WVX3 Argininosuccinate synthase 1.05e-02 1.93e-10 NA NA
5. P B1XM11 tRNA-specific 2-thiouridylase MnmA 8.12e-03 1.14e-09 NA NA
5. P A8ES36 tRNA-specific 2-thiouridylase MnmA 2 1.16e-04 1.55e-06 NA NA
5. P Q1AS35 Argininosuccinate synthase 2.88e-03 3.76e-09 NA NA
5. P Q30YB8 Argininosuccinate synthase 9.97e-03 8.58e-12 NA NA
5. P Q5L8X6 tRNA-specific 2-thiouridylase MnmA 3 2.07e-02 6.28e-10 NA NA
5. P B2J6U2 Argininosuccinate synthase 7.85e-03 1.32e-12 NA NA
5. P Q9K4Y8 Argininosuccinate synthase 1.14e-02 5.00e-14 NA NA
5. P Q503J2 Mitochondrial tRNA-specific 2-thiouridylase 1 6.85e-02 1.17e-08 NA NA
5. P Q3YSN0 tRNA-specific 2-thiouridylase MnmA 1.62e-02 1.36e-05 NA NA
5. P Q056F0 Argininosuccinate synthase 3.67e-03 1.21e-08 NA NA
5. P A3NZ55 tRNA-specific 2-thiouridylase MnmA 9.00e-02 3.17e-08 NA NA
5. P Q929S9 Argininosuccinate synthase 2.96e-03 7.70e-08 NA NA
5. P A4Y7M1 tRNA-specific 2-thiouridylase MnmA 2.88e-02 3.92e-10 NA NA
5. P B0KUE7 Argininosuccinate synthase 7.93e-03 8.02e-12 NA NA
5. P B8CLH4 tRNA-specific 2-thiouridylase MnmA 8.39e-02 8.34e-09 NA NA
5. P Q3AG78 Argininosuccinate synthase 7.26e-03 3.93e-13 NA NA
5. P B5FI16 Argininosuccinate synthase 1.17e-02 4.79e-12 NA NA
5. P A4IR87 tRNA-specific 2-thiouridylase MnmA 6.52e-02 8.21e-11 NA NA
5. P A8M5E1 tRNA-specific 2-thiouridylase MnmA 1.30e-02 2.29e-07 NA NA
5. P A5UV64 tRNA-specific 2-thiouridylase MnmA 1.25e-02 3.89e-08 NA NA
5. P Q931Q6 tRNA-specific 2-thiouridylase MnmA 9.90e-03 5.11e-09 NA NA
5. P B4S9U5 Argininosuccinate synthase 8.60e-03 2.23e-10 NA NA
5. P C3KBZ2 Argininosuccinate synthase 7.17e-03 1.22e-11 NA NA
5. P Q32EZ1 tRNA-specific 2-thiouridylase MnmA 5.83e-02 4.36e-09 NA NA
5. P B1JVW3 tRNA-specific 2-thiouridylase MnmA 1.01e-01 2.56e-08 NA NA
5. P A9M0Y5 tRNA-specific 2-thiouridylase MnmA 4.98e-02 2.25e-06 NA NA
5. P C4LJJ9 tRNA-specific 2-thiouridylase MnmA 1.28e-02 8.28e-07 NA NA
5. P A0M3J2 tRNA-specific 2-thiouridylase MnmA 8.53e-03 1.46e-08 NA NA
5. P Q1JJD5 tRNA-specific 2-thiouridylase MnmA 7.00e-03 2.26e-09 NA NA
5. P Q1CI58 tRNA-specific 2-thiouridylase MnmA 9.99e-02 9.53e-09 NA NA
5. P P57349 tRNA-specific 2-thiouridylase MnmA 1.15e-01 5.37e-09 NA NA
5. P Q3A1V1 Argininosuccinate synthase 7.92e-03 6.12e-10 NA NA
5. P Q8EYP7 Argininosuccinate synthase 3.14e-03 2.09e-08 NA NA
5. P B1IIY2 tRNA-specific 2-thiouridylase MnmA 2 3.18e-02 3.37e-06 NA NA
5. P A7NPB0 Argininosuccinate synthase 4.85e-03 2.20e-10 NA NA
5. P B7H6Y5 Argininosuccinate synthase 5.03e-03 6.00e-09 NA NA
5. P A5VZI0 Argininosuccinate synthase 8.18e-03 7.91e-12 NA NA
5. P B2G6L9 tRNA-specific 2-thiouridylase MnmA 2.05e-02 7.69e-11 NA NA
5. P Q1GZF5 tRNA-specific 2-thiouridylase MnmA 4.99e-02 4.34e-10 NA NA
5. P Q48QM8 tRNA-specific 2-thiouridylase MnmA 7.24e-03 2.66e-09 NA NA
5. P Q88FR9 tRNA-specific 2-thiouridylase MnmA 5.19e-02 6.78e-09 NA NA
5. P Q30SP2 tRNA-specific 2-thiouridylase MnmA 1.53e-02 1.53e-07 NA NA
5. P Q9ZJQ0 tRNA-specific 2-thiouridylase MnmA 3.61e-02 1.11e-10 NA NA
5. P B7KHE5 tRNA-specific 2-thiouridylase MnmA 5.22e-03 3.79e-08 NA NA
6. F Q5GUF3 tRNA-cytidine(32) 2-sulfurtransferase 3.60e-06 NA NA 0.6919
6. F A3M828 tRNA-cytidine(32) 2-sulfurtransferase 2.13e-05 NA NA 0.6849
6. F A0L6E2 Sulfate adenylyltransferase subunit 2 7.46e-04 NA NA 0.5637
6. F Q9WY40 tRNA-5-methyluridine(54) 2-sulfurtransferase 1.51e-08 NA NA 0.7516
6. F A5G7Y9 NH(3)-dependent NAD(+) synthetase 7.05e-06 NA NA 0.4303
6. F Q4K882 tRNA-cytidine(32) 2-sulfurtransferase 7.50e-10 NA NA 0.7134
6. F Q1H4T8 tRNA-cytidine(32) 2-sulfurtransferase 6.66e-08 NA NA 0.5203
6. F Q8PZP6 NH(3)-dependent NAD(+) synthetase 4.63e-05 NA NA 0.4725
6. F O27554 NH(3)-dependent NAD(+) synthetase 1.04e-04 NA NA 0.6186
6. F Q7CIP8 tRNA-cytidine(32) 2-sulfurtransferase 8.63e-07 NA NA 0.6949
6. F A5DSD3 Cytoplasmic tRNA 2-thiolation protein 2 1.76e-03 NA NA 0.5027
6. F B3ELI1 GMP synthase [glutamine-hydrolyzing] 7.90e-03 NA NA 0.6412
6. F A1BD85 GMP synthase [glutamine-hydrolyzing] 1.06e-02 NA NA 0.6077
6. F O57921 NH(3)-dependent NAD(+) synthetase 8.65e-06 NA NA 0.4375
6. F B7K8T7 GMP synthase [glutamine-hydrolyzing] 1.18e-02 NA NA 0.5813
6. F Q124R0 tRNA-cytidine(32) 2-sulfurtransferase 1.08e-05 NA NA 0.7222
6. F B5BJ71 tRNA-cytidine(32) 2-sulfurtransferase 7.21e-07 NA NA 0.7027
6. F Q5X752 tRNA-cytidine(32) 2-sulfurtransferase 1.69e-05 NA NA 0.658
6. F P65671 Sulfate adenylyltransferase subunit 2 9.66e-04 NA NA 0.5989
6. F A3N1A3 7-cyano-7-deazaguanine synthase 5.23e-04 NA NA 0.4858
6. F A3QEG3 tRNA-cytidine(32) 2-sulfurtransferase 6.57e-10 NA NA 0.7346
6. F Q1C7C2 tRNA-cytidine(32) 2-sulfurtransferase 9.23e-07 NA NA 0.6995
6. F A3MND8 tRNA-cytidine(32) 2-sulfurtransferase 1.16e-04 NA NA 0.6443
6. F B9M1Y2 tRNA-cytidine(32) 2-sulfurtransferase 1.39e-06 NA NA 0.6595
6. F B4RQ61 7-cyano-7-deazaguanine synthase 4.09e-03 NA NA 0.5344
6. F Q4ZQ35 tRNA-cytidine(32) 2-sulfurtransferase 5.50e-10 NA NA 0.6361
6. F A6T886 tRNA-cytidine(32) 2-sulfurtransferase 5.81e-07 NA NA 0.7076
6. F Q0BYJ5 tRNA-cytidine(32) 2-sulfurtransferase 9.20e-10 NA NA 0.6822
6. F Q477W2 tRNA-cytidine(32) 2-sulfurtransferase 2.53e-10 NA NA 0.6605
6. F A4VJ19 tRNA-cytidine(32) 2-sulfurtransferase 4.94e-10 NA NA 0.7361
6. F Q74GW7 tRNA-cytidine(32) 2-sulfurtransferase 9.21e-11 NA NA 0.6777
6. F A9MQT5 tRNA-cytidine(32) 2-sulfurtransferase 7.14e-07 NA NA 0.7027
6. F Q6AB49 tRNA(Ile)-lysidine synthase 1.11e-16 NA NA 0.7266
6. F B7NHP6 tRNA-cytidine(32) 2-sulfurtransferase 7.91e-07 NA NA 0.7121
6. F A0KKM7 tRNA-cytidine(32) 2-sulfurtransferase 6.35e-06 NA NA 0.649
6. F A9R7Z2 GMP synthase [glutamine-hydrolyzing] 6.00e-03 NA NA 0.632
6. F Q72LF3 tRNA-5-methyluridine(54) 2-sulfurtransferase 8.65e-09 NA NA 0.7046
6. F A3N4V9 tRNA-cytidine(32) 2-sulfurtransferase 1.32e-04 NA NA 0.7101
6. F A7ZZT7 tRNA-cytidine(32) 2-sulfurtransferase 9.05e-07 NA NA 0.7124
6. F Q3JAS2 tRNA-cytidine(32) 2-sulfurtransferase 7.53e-06 NA NA 0.7181
6. F B1JZU7 tRNA-cytidine(32) 2-sulfurtransferase 1.51e-04 NA NA 0.6793
6. F A6UUS4 NH(3)-dependent NAD(+) synthetase 6.08e-05 NA NA 0.4601
6. F Q9WZB3 NH(3)-dependent NAD(+) synthetase 1.78e-04 NA NA 0.4156
6. F A7ZLH4 tRNA-cytidine(32) 2-sulfurtransferase 7.38e-07 NA NA 0.6618
6. F A7MLI7 tRNA-cytidine(32) 2-sulfurtransferase 7.56e-07 NA NA 0.7118
6. F A1VJK9 tRNA-cytidine(32) 2-sulfurtransferase 6.34e-10 NA NA 0.6462
6. F B5R4D8 tRNA-cytidine(32) 2-sulfurtransferase 7.76e-06 NA NA 0.6413
6. F B3E4K8 NH(3)-dependent NAD(+) synthetase 1.08e-05 NA NA 0.4815
6. F Q985Q5 Sulfate adenylyltransferase subunit 2 1.38e-03 NA NA 0.5421
6. F Q2A3F9 tRNA-cytidine(32) 2-sulfurtransferase 2 3.02e-10 NA NA 0.5985
6. F Q1BSY9 tRNA-cytidine(32) 2-sulfurtransferase 1.19e-04 NA NA 0.7218
6. F Q11IV8 tRNA-cytidine(32) 2-sulfurtransferase 6.71e-10 NA NA 0.6751
6. F B5Z0R4 tRNA-cytidine(32) 2-sulfurtransferase 8.35e-07 NA NA 0.7359
6. F Q8U4I9 NH(3)-dependent NAD(+) synthetase 2.54e-04 NA NA 0.4276
6. F Q96Y49 7-cyano-7-deazaguanine synthase 2 1.86e-02 NA NA 0.4978
6. F Q2RS06 Sulfate adenylyltransferase subunit 2 1.44e-04 NA NA 0.575
6. F P52995 Sulfate adenylyltransferase subunit 2 3.22e-03 NA NA 0.548
6. F B1XSG8 tRNA-cytidine(32) 2-sulfurtransferase 7.11e-06 NA NA 0.6804
6. F B7UWY4 tRNA-cytidine(32) 2-sulfurtransferase 9.52e-06 NA NA 0.6473
6. F B2K5E0 tRNA-cytidine(32) 2-sulfurtransferase 8.49e-07 NA NA 0.7299
6. F Q48FG8 tRNA-cytidine(32) 2-sulfurtransferase 5.45e-10 NA NA 0.6516
6. F A4WAT7 tRNA-cytidine(32) 2-sulfurtransferase 9.93e-07 NA NA 0.7216
6. F A9L1D4 tRNA-cytidine(32) 2-sulfurtransferase 1.82e-07 NA NA 0.7107
6. F B6J7A4 tRNA-cytidine(32) 2-sulfurtransferase 2.62e-10 NA NA 0.6883
6. F Q8ZP88 tRNA-cytidine(32) 2-sulfurtransferase 8.34e-07 NA NA 0.6993
6. F Q7VRS2 GMP synthase [glutamine-hydrolyzing] 1.91e-03 NA NA 0.6233
6. F B2T6U6 tRNA-cytidine(32) 2-sulfurtransferase 4.16e-05 NA NA 0.6609
6. F A6T3N1 tRNA-cytidine(32) 2-sulfurtransferase 1.41e-09 NA NA 0.7077
6. F B0U453 tRNA-cytidine(32) 2-sulfurtransferase 2.71e-06 NA NA 0.6773
6. F A3D4P4 tRNA-cytidine(32) 2-sulfurtransferase 3.68e-06 NA NA 0.7114
6. F A3Q3I2 Sulfate adenylyltransferase subunit 2 8.98e-04 NA NA 0.5805
6. F A4SFG4 NH(3)-dependent NAD(+) synthetase 1.30e-05 NA NA 0.5913
6. F O07308 Sulfate adenylyltransferase subunit 2 3.47e-03 NA NA 0.5678
6. F B6IA61 tRNA-cytidine(32) 2-sulfurtransferase 7.95e-07 NA NA 0.6546
6. F B4P3W7 Cytoplasmic tRNA 2-thiolation protein 1 4.72e-06 NA NA 0.7216
6. F B1LG84 tRNA-cytidine(32) 2-sulfurtransferase 8.49e-07 NA NA 0.7209
6. F Q05AW7 Cytoplasmic tRNA 2-thiolation protein 1 1.63e-06 NA NA 0.7513
6. F A6VQW6 7-cyano-7-deazaguanine synthase 2.56e-04 NA NA 0.4617
6. F A8FVF7 tRNA-cytidine(32) 2-sulfurtransferase 2.50e-07 NA NA 0.7539
6. F C4L8F7 tRNA-cytidine(32) 2-sulfurtransferase 2.69e-10 NA NA 0.7673
6. F Q21IJ4 tRNA-cytidine(32) 2-sulfurtransferase 2.74e-07 NA NA 0.7369
6. F B1J1K3 tRNA-cytidine(32) 2-sulfurtransferase 1.91e-10 NA NA 0.6761
6. F A6VXH3 tRNA-cytidine(32) 2-sulfurtransferase 2.10e-10 NA NA 0.5748
6. F B5RA25 tRNA-cytidine(32) 2-sulfurtransferase 8.51e-06 NA NA 0.6324
6. F A2SD77 tRNA-cytidine(32) 2-sulfurtransferase 3.84e-07 NA NA 0.6631
6. F A9R8Q5 tRNA-cytidine(32) 2-sulfurtransferase 8.65e-07 NA NA 0.6999
6. F A1V7Z5 tRNA-cytidine(32) 2-sulfurtransferase 3.87e-05 NA NA 0.6809
6. F B4LM02 Cytoplasmic tRNA 2-thiolation protein 1 6.65e-06 NA NA 0.7106
6. F A5DAK5 Cytoplasmic tRNA 2-thiolation protein 2 3.10e-03 NA NA 0.5059
6. F A5F888 tRNA-cytidine(32) 2-sulfurtransferase 2.63e-09 NA NA 0.6853
6. F Q82EF1 tRNA(Ile)-lysidine synthase 0.00e+00 NA NA 0.7428
6. F C0RIG5 tRNA-cytidine(32) 2-sulfurtransferase 9.09e-10 NA NA 0.6675
6. F Q7WEL6 tRNA-cytidine(32) 2-sulfurtransferase 1.87e-09 NA NA 0.7395
6. F A5VQ10 tRNA-cytidine(32) 2-sulfurtransferase 1.44e-10 NA NA 0.631
6. F C6A5B5 NH(3)-dependent NAD(+) synthetase 1.12e-05 NA NA 0.5114
6. F B0CLF8 tRNA-cytidine(32) 2-sulfurtransferase 1.70e-10 NA NA 0.6253
6. F B2FU61 tRNA-cytidine(32) 2-sulfurtransferase 7.47e-08 NA NA 0.7074
6. F B1YP61 tRNA-cytidine(32) 2-sulfurtransferase 1.15e-05 NA NA 0.715
6. F Q87D47 Glutamine-dependent NAD(+) synthetase 2.27e-03 NA NA 0.6282
6. F B3N7L9 Cytoplasmic tRNA 2-thiolation protein 1 4.81e-06 NA NA 0.723
6. F Q3KHY6 Sulfate adenylyltransferase subunit 2 3.28e-03 NA NA 0.5499
6. F Q98NP4 tRNA-cytidine(32) 2-sulfurtransferase 3.85e-10 NA NA 0.7126
6. F Q8TK88 NH(3)-dependent NAD(+) synthetase 4.16e-05 NA NA 0.4552
6. F Q66A78 tRNA-cytidine(32) 2-sulfurtransferase 9.19e-07 NA NA 0.6982
6. F Q57DS4 tRNA-cytidine(32) 2-sulfurtransferase 3.02e-10 NA NA 0.6465
6. F Q65RE8 7-cyano-7-deazaguanine synthase 4.61e-03 NA NA 0.5059
6. F Q8PEW6 tRNA-cytidine(32) 2-sulfurtransferase 3.77e-06 NA NA 0.7165
6. F A9NCM4 tRNA-cytidine(32) 2-sulfurtransferase 2.99e-06 NA NA 0.6733
6. F Q8YGM6 tRNA-cytidine(32) 2-sulfurtransferase 9.40e-10 NA NA 0.7156
6. F Q72RB7 Probable GMP synthase [glutamine-hydrolyzing] 2.77e-03 NA NA 0.5088
6. F C6DJ78 tRNA-cytidine(32) 2-sulfurtransferase 1.03e-06 NA NA 0.7109
6. F B5Y8Q4 NH(3)-dependent NAD(+) synthetase 3.40e-03 NA NA 0.4128
6. F Q0C438 Sulfate adenylyltransferase subunit 2 3.59e-03 NA NA 0.575
6. F B0U092 tRNA-cytidine(32) 2-sulfurtransferase 2 4.37e-10 NA NA 0.5785
6. F Q3B1J3 GMP synthase [glutamine-hydrolyzing] 1.09e-02 NA NA 0.632
6. F Q2NSV5 tRNA-cytidine(32) 2-sulfurtransferase 1.88e-05 NA NA 0.6395
6. F P47623 NH(3)-dependent NAD(+) synthetase 1.76e-05 NA NA 0.4817
6. F Q1QZ76 tRNA-cytidine(32) 2-sulfurtransferase 2.59e-08 NA NA 0.5591
6. F A3NQK2 tRNA-cytidine(32) 2-sulfurtransferase 1.07e-05 NA NA 0.6822
6. F Q39QC5 tRNA-cytidine(32) 2-sulfurtransferase 4.67e-11 NA NA 0.6902
6. F C1DPQ6 tRNA-cytidine(32) 2-sulfurtransferase 4.57e-10 NA NA 0.7273
6. F O67091 Glutamine-dependent NAD(+) synthetase 2.22e-03 NA NA 0.5205
6. F Q220I8 tRNA-cytidine(32) 2-sulfurtransferase 8.46e-10 NA NA 0.6503
6. F B6ELU0 tRNA-cytidine(32) 2-sulfurtransferase 6.96e-06 NA NA 0.7147
6. F A1SWS4 tRNA-cytidine(32) 2-sulfurtransferase 3.54e-05 NA NA 0.7188
6. F Q14HG9 tRNA-cytidine(32) 2-sulfurtransferase 1 1.46e-07 NA NA 0.6042
6. F A9MAK8 tRNA-cytidine(32) 2-sulfurtransferase 1.01e-09 NA NA 0.6839
6. F Q8Z783 tRNA-cytidine(32) 2-sulfurtransferase 7.00e-07 NA NA 0.7047
6. F A4T8Q2 Sulfate adenylyltransferase subunit 2 8.65e-04 NA NA 0.5654
6. F B0TUN8 tRNA-cytidine(32) 2-sulfurtransferase 5.13e-10 NA NA 0.706
6. F Q9JZJ6 tRNA-cytidine(32) 2-sulfurtransferase 1.44e-09 NA NA 0.695
6. F Q9V2A9 NH(3)-dependent NAD(+) synthetase 5.78e-06 NA NA 0.6432
6. F Q8D9J0 tRNA-cytidine(32) 2-sulfurtransferase 1.14e-05 NA NA 0.644
6. F Q9I4E6 tRNA-cytidine(32) 2-sulfurtransferase 3.46e-10 NA NA 0.6565
6. F Q9KS29 tRNA-cytidine(32) 2-sulfurtransferase 2.59e-09 NA NA 0.6716
6. F Q7MKU7 tRNA-cytidine(32) 2-sulfurtransferase 2.13e-09 NA NA 0.6672
6. F Q0AI06 tRNA-cytidine(32) 2-sulfurtransferase 1.02e-05 NA NA 0.6949
6. F A9M1Y9 7-cyano-7-deazaguanine synthase 6.12e-03 NA NA 0.521
6. F Q1MG13 tRNA-cytidine(32) 2-sulfurtransferase 9.10e-10 NA NA 0.6793
6. F B0BPR8 tRNA-cytidine(32) 2-sulfurtransferase 1.28e-06 NA NA 0.7093
6. F Q0IE37 GMP synthase [glutamine-hydrolyzing] 7.90e-03 NA NA 0.5735
6. F A2BNG3 GMP synthase [glutamine-hydrolyzing] 1.17e-02 NA NA 0.5895
6. F Q5F956 tRNA-cytidine(32) 2-sulfurtransferase 2.07e-09 NA NA 0.7224
6. F A6WNB3 tRNA-cytidine(32) 2-sulfurtransferase 1.82e-07 NA NA 0.7437
6. F Q62EN9 tRNA-cytidine(32) 2-sulfurtransferase 3.55e-05 NA NA 0.7206
6. F A1KU93 tRNA-cytidine(32) 2-sulfurtransferase 1.49e-09 NA NA 0.7388
6. F B4SEZ8 NH(3)-dependent NAD(+) synthetase 1.23e-05 NA NA 0.4272
6. F Q7VHF9 NH(3)-dependent NAD(+) synthetase 9.78e-05 NA NA 0.4286
6. F P44124 7-cyano-7-deazaguanine synthase 9.90e-04 NA NA 0.5476
6. F B5F5C0 tRNA-cytidine(32) 2-sulfurtransferase 7.98e-06 NA NA 0.7376
6. F Q4UNZ5 tRNA-cytidine(32) 2-sulfurtransferase 5.46e-06 NA NA 0.6717
6. F C6E087 tRNA-cytidine(32) 2-sulfurtransferase 1.47e-06 NA NA 0.7203
6. F B7N4F3 tRNA-cytidine(32) 2-sulfurtransferase 8.76e-07 NA NA 0.7681
6. F B6J031 tRNA-cytidine(32) 2-sulfurtransferase 2.98e-06 NA NA 0.6721
6. F Q57184 tRNA-cytidine(32) 2-sulfurtransferase 1.60e-09 NA NA 0.7075
6. F Q9TLW9 tRNA(Ile)-lysidine synthase, chloroplastic 0.00e+00 NA NA 0.7049
6. F B7LRU9 tRNA-cytidine(32) 2-sulfurtransferase 9.29e-06 NA NA 0.6092
6. F Q85G85 tRNA(Ile)-lysidine synthase, chloroplastic 1.20e-08 NA NA 0.5866
6. F Q2KU24 tRNA-cytidine(32) 2-sulfurtransferase 5.12e-10 NA NA 0.6392
6. F Q13T64 tRNA-cytidine(32) 2-sulfurtransferase 1.66e-04 NA NA 0.7146
6. F B3QM51 NH(3)-dependent NAD(+) synthetase 1.49e-05 NA NA 0.411
6. F Q1QCP2 tRNA-cytidine(32) 2-sulfurtransferase 5.12e-09 NA NA 0.5625
6. F A5IGL1 tRNA-cytidine(32) 2-sulfurtransferase 8.71e-08 NA NA 0.6596
6. F B4TWA6 tRNA-cytidine(32) 2-sulfurtransferase 5.86e-07 NA NA 0.7346
6. F Q9HJR8 NH(3)-dependent NAD(+) synthetase 4.31e-06 NA NA 0.5038
6. F Q1RC21 tRNA-cytidine(32) 2-sulfurtransferase 8.66e-06 NA NA 0.6573
6. F A1UK27 Sulfate adenylyltransferase subunit 2 9.83e-04 NA NA 0.5814
6. F A4TIV5 tRNA-cytidine(32) 2-sulfurtransferase 8.58e-06 NA NA 0.7026
6. F P49057 GMP synthase [glutamine-hydrolyzing] 1.30e-02 NA NA 0.5923
6. F Q9A881 Sulfate adenylyltransferase subunit 2 1.20e-03 NA NA 0.5512
6. F B2SGI4 tRNA-cytidine(32) 2-sulfurtransferase 8.05e-11 NA NA 0.6148
6. F C3LMC8 tRNA-cytidine(32) 2-sulfurtransferase 1.73e-09 NA NA 0.7194
6. F A7FHP9 tRNA-cytidine(32) 2-sulfurtransferase 3.64e-09 NA NA 0.6909
6. F Q3IHG8 tRNA-cytidine(32) 2-sulfurtransferase 3.09e-06 NA NA 0.7793
6. F A9LZH0 tRNA-cytidine(32) 2-sulfurtransferase 1.31e-09 NA NA 0.7332
6. F A7H8W2 tRNA-cytidine(32) 2-sulfurtransferase 1.32e-06 NA NA 0.5927
6. F Q3B5D4 NH(3)-dependent NAD(+) synthetase 1.56e-05 NA NA 0.437
6. F Q8EWK9 NH(3)-dependent NAD(+) synthetase 2.77e-05 NA NA 0.4837
6. F A5GBX4 tRNA-cytidine(32) 2-sulfurtransferase 1.04e-06 NA NA 0.6737
6. F P74292 Glutamine-dependent NAD(+) synthetase 2.06e-03 NA NA 0.6281
6. F B1ISR7 tRNA-cytidine(32) 2-sulfurtransferase 8.07e-07 NA NA 0.7019
6. F Q03638 Glutamine-dependent NAD(+) synthetase 2.34e-03 NA NA 0.5916
6. F Q14H45 tRNA-cytidine(32) 2-sulfurtransferase 2 1.32e-10 NA NA 0.5992
6. F B4GHY8 Cytoplasmic tRNA 2-thiolation protein 1 7.70e-06 NA NA 0.7469
6. F Q755T1 Cytoplasmic tRNA 2-thiolation protein 1 2.01e-07 NA NA 0.7375
6. F B7LYL5 tRNA-cytidine(32) 2-sulfurtransferase 8.96e-07 NA NA 0.7011
6. F Q1CIQ7 tRNA-cytidine(32) 2-sulfurtransferase 3.67e-09 NA NA 0.6931
6. F Q4FTN3 tRNA-cytidine(32) 2-sulfurtransferase 7.96e-09 NA NA 0.6347
6. F B5FUP1 tRNA-cytidine(32) 2-sulfurtransferase 6.39e-07 NA NA 0.7221
6. F Q8P610 Sulfate adenylyltransferase subunit 2 7.32e-04 NA NA 0.5463
6. F Q02J28 tRNA-cytidine(32) 2-sulfurtransferase 5.24e-10 NA NA 0.6369
6. F Q9CP69 7-cyano-7-deazaguanine synthase 4.96e-04 NA NA 0.4907
6. F Q7NQK6 tRNA-cytidine(32) 2-sulfurtransferase 7.36e-06 NA NA 0.6724
6. F A6VMR9 GMP synthase [glutamine-hydrolyzing] 4.77e-03 NA NA 0.6434
6. F A8GF18 tRNA-cytidine(32) 2-sulfurtransferase 7.92e-07 NA NA 0.6944
6. F Q8KFZ5 GMP synthase [glutamine-hydrolyzing] 8.37e-03 NA NA 0.6321
6. F Q1LS06 tRNA-cytidine(32) 2-sulfurtransferase 1.68e-06 NA NA 0.7641
6. F Q8ZXL4 NH(3)-dependent NAD(+) synthetase 1.11e-04 NA NA 0.6057
6. F B2JIL8 tRNA-cytidine(32) 2-sulfurtransferase 1.02e-04 NA NA 0.7152
6. F Q5E590 tRNA-cytidine(32) 2-sulfurtransferase 3.27e-09 NA NA 0.7255
6. F Q2YBQ4 tRNA-cytidine(32) 2-sulfurtransferase 9.60e-10 NA NA 0.6578
6. F A1IS67 tRNA-cytidine(32) 2-sulfurtransferase 7.82e-05 NA NA 0.6713
6. F A1U1K6 tRNA-cytidine(32) 2-sulfurtransferase 6.07e-10 NA NA 0.6568
6. F A1WZK4 Sulfate adenylyltransferase subunit 2 4.75e-04 NA NA 0.5642
6. F B5Z842 GMP synthase [glutamine-hydrolyzing] 3.39e-03 NA NA 0.6104
6. F Q87PG9 tRNA-cytidine(32) 2-sulfurtransferase 3.78e-10 NA NA 0.6604
6. F C3JY43 tRNA-cytidine(32) 2-sulfurtransferase 4.06e-06 NA NA 0.6104
6. F B2VKN8 tRNA-cytidine(32) 2-sulfurtransferase 2.43e-09 NA NA 0.714
6. F Q3JWX0 tRNA-cytidine(32) 2-sulfurtransferase 1.64e-04 NA NA 0.6733
6. F A6ZTX8 Cytoplasmic tRNA 2-thiolation protein 1 2.12e-07 NA NA 0.7228
6. F Q5PHS1 tRNA-cytidine(32) 2-sulfurtransferase 1.07e-05 NA NA 0.7695
6. F A4IXY7 tRNA-cytidine(32) 2-sulfurtransferase 1 8.73e-11 NA NA 0.6141
6. F B3QYF4 GMP synthase [glutamine-hydrolyzing] 1.00e-02 NA NA 0.6573
6. F Q9YAI1 NH(3)-dependent NAD(+) synthetase 5.85e-06 NA NA 0.5652
6. F Q0AA41 tRNA-cytidine(32) 2-sulfurtransferase 1.78e-05 NA NA 0.7438
6. F B3LHQ7 Cytoplasmic tRNA 2-thiolation protein 1 3.17e-07 NA NA 0.7226
6. F A9KE14 tRNA-cytidine(32) 2-sulfurtransferase 2.73e-06 NA NA 0.6743
6. F Q6D5P6 tRNA-cytidine(32) 2-sulfurtransferase 7.70e-07 NA NA 0.7204
6. F Q5FA99 7-cyano-7-deazaguanine synthase 4.03e-03 NA NA 0.5057
6. F Q476S4 tRNA-cytidine(32) 2-sulfurtransferase 1.73e-06 NA NA 0.502
6. F Q8P3H2 tRNA-cytidine(32) 2-sulfurtransferase 2.16e-06 NA NA 0.7074
6. F A4XWK1 tRNA-cytidine(32) 2-sulfurtransferase 7.00e-08 NA NA 0.7286
6. F Q3AT13 GMP synthase [glutamine-hydrolyzing] 1.06e-02 NA NA 0.5974
6. F Q83KS7 tRNA-cytidine(32) 2-sulfurtransferase 6.45e-07 NA NA 0.6949
6. F A3N0Y3 tRNA-cytidine(32) 2-sulfurtransferase 2.35e-09 NA NA 0.7096
6. F B1JJU2 tRNA-cytidine(32) 2-sulfurtransferase 9.16e-07 NA NA 0.7015
6. F P9WIK0 Sulfate adenylyltransferase subunit 2 7.89e-04 NA NA 0.5821
6. F C4ZV92 tRNA-cytidine(32) 2-sulfurtransferase 8.90e-06 NA NA 0.6506
6. F Q0HVA7 tRNA-cytidine(32) 2-sulfurtransferase 3.94e-06 NA NA 0.7441
6. F B4UF77 tRNA-cytidine(32) 2-sulfurtransferase 7.55e-05 NA NA 0.6786
6. F Q9PC24 Glutamine-dependent NAD(+) synthetase 2.20e-03 NA NA 0.6286
6. F Q83CP2 tRNA-cytidine(32) 2-sulfurtransferase 4.43e-06 NA NA 0.6669
6. F B0BQ32 7-cyano-7-deazaguanine synthase 5.99e-04 NA NA 0.4857
6. F Q39C93 tRNA-cytidine(32) 2-sulfurtransferase 1.35e-04 NA NA 0.6983
6. F Q5RA96 GMP synthase [glutamine-hydrolyzing] 6.74e-03 NA NA 0.5238
6. F O29262 NH(3)-dependent NAD(+) synthetase 5.53e-06 NA NA 0.4665
6. F B5XRN3 tRNA-cytidine(32) 2-sulfurtransferase 9.05e-06 NA NA 0.7252
6. F Q9CN39 tRNA-cytidine(32) 2-sulfurtransferase 6.95e-06 NA NA 0.7063
6. F Q6MLE7 tRNA-cytidine(32) 2-sulfurtransferase 1.54e-10 NA NA 0.6432
6. F A9MXN4 tRNA-cytidine(32) 2-sulfurtransferase 6.22e-07 NA NA 0.7042
6. F A8PVM6 Cytoplasmic tRNA 2-thiolation protein 1 5.12e-07 NA NA 0.634
6. F B7I610 tRNA-cytidine(32) 2-sulfurtransferase 8.29e-08 NA NA 0.7279
6. F A5E3Q3 Cytoplasmic tRNA 2-thiolation protein 1 6.70e-07 NA NA 0.6902
6. F A5UBX9 tRNA-cytidine(32) 2-sulfurtransferase 1.84e-09 NA NA 0.7056
6. F A1UT10 tRNA-cytidine(32) 2-sulfurtransferase 1.43e-10 NA NA 0.614
6. F Q6C8R5 Cytoplasmic tRNA 2-thiolation protein 1 6.67e-06 NA NA 0.7537
6. F Q97WN9 NH(3)-dependent NAD(+) synthetase 1.90e-05 NA NA 0.4331
6. F Q8G189 tRNA-cytidine(32) 2-sulfurtransferase 7.50e-06 NA NA 0.696
6. F B3MI77 Cytoplasmic tRNA 2-thiolation protein 1 4.75e-06 NA NA 0.7035
6. F Q7V3N7 GMP synthase [glutamine-hydrolyzing] 1.14e-02 NA NA 0.5585
6. F A7NBC6 tRNA-cytidine(32) 2-sulfurtransferase 1 1.30e-07 NA NA 0.6143
6. F A2S7T4 tRNA-cytidine(32) 2-sulfurtransferase 3.58e-05 NA NA 0.6792
6. F A1K2P7 tRNA-cytidine(32) 2-sulfurtransferase 7.80e-06 NA NA 0.6847
6. F B3GXW8 tRNA-cytidine(32) 2-sulfurtransferase 9.88e-07 NA NA 0.7041
6. F Q8EEM4 tRNA-cytidine(32) 2-sulfurtransferase 4.72e-10 NA NA 0.7168
6. F A7N0R3 tRNA-cytidine(32) 2-sulfurtransferase 1.00e-09 NA NA 0.6109
6. F C5CBZ4 GMP synthase [glutamine-hydrolyzing] 1.52e-02 NA NA 0.5371
6. F B1Y629 tRNA-cytidine(32) 2-sulfurtransferase 7.81e-07 NA NA 0.7549
6. F P0CS70 Cytoplasmic tRNA 2-thiolation protein 1 3.70e-08 NA NA 0.6991
6. F B2U0Z1 tRNA-cytidine(32) 2-sulfurtransferase 5.95e-07 NA NA 0.7289
6. F Q0VC66 Cytoplasmic tRNA 2-thiolation protein 1 4.71e-06 NA NA 0.6241
6. F Q1IHK6 7-cyano-7-deazaguanine synthase 1.22e-03 NA NA 0.5498
6. F A0Q736 tRNA-cytidine(32) 2-sulfurtransferase 2 1.36e-06 NA NA 0.6489
6. F A4IYL5 tRNA-cytidine(32) 2-sulfurtransferase 2 1.29e-10 NA NA 0.6087
6. F Q9PFT8 tRNA-cytidine(32) 2-sulfurtransferase 2.30e-06 NA NA 0.6942
6. F B2UD46 tRNA-cytidine(32) 2-sulfurtransferase 1.40e-05 NA NA 0.6251
6. F A4SMC4 tRNA-cytidine(32) 2-sulfurtransferase 2.56e-07 NA NA 0.7645
6. F A7IAS7 NH(3)-dependent NAD(+) synthetase 5.56e-06 NA NA 0.5826
6. F Q30U93 Sulfate adenylyltransferase subunit 2 2.93e-03 NA NA 0.5569
6. F B2SIG7 tRNA-cytidine(32) 2-sulfurtransferase 3.79e-06 NA NA 0.6901
6. F Q1IDN2 tRNA-cytidine(32) 2-sulfurtransferase 4.04e-10 NA NA 0.7393
6. F A8LMA2 tRNA-cytidine(32) 2-sulfurtransferase 2.60e-10 NA NA 0.7373
6. F Q96YL5 NH(3)-dependent NAD(+) synthetase 1.68e-05 NA NA 0.4271
6. F Q2YNH1 tRNA-cytidine(32) 2-sulfurtransferase 9.80e-10 NA NA 0.6781
6. F B5RV24 Cytoplasmic tRNA 2-thiolation protein 1 6.96e-07 NA NA 0.7284
6. F Q0I3K3 tRNA-cytidine(32) 2-sulfurtransferase 4.78e-07 NA NA 0.7298
6. F B4SRP3 tRNA-cytidine(32) 2-sulfurtransferase 4.77e-07 NA NA 0.7266
6. F A1AUS1 tRNA-cytidine(32) 2-sulfurtransferase 3.34e-06 NA NA 0.646
6. F C5CNK9 tRNA-cytidine(32) 2-sulfurtransferase 4.40e-10 NA NA 0.7183
6. F B7MM21 tRNA-cytidine(32) 2-sulfurtransferase 8.05e-07 NA NA 0.7212
6. F Q2IPE3 tRNA-cytidine(32) 2-sulfurtransferase 2.14e-06 NA NA 0.673
6. F B4SFX7 GMP synthase [glutamine-hydrolyzing] 1.13e-02 NA NA 0.6252
6. F A3PNA9 tRNA-cytidine(32) 2-sulfurtransferase 1.17e-07 NA NA 0.679
6. F A1KI72 Sulfate adenylyltransferase subunit 2 9.62e-04 NA NA 0.5832
6. F Q3K8D5 tRNA-cytidine(32) 2-sulfurtransferase 4.50e-10 NA NA 0.6136
6. F A9BER7 GMP synthase [glutamine-hydrolyzing] 4.60e-03 NA NA 0.6037
6. F A1B0E2 tRNA-cytidine(32) 2-sulfurtransferase 3.28e-10 NA NA 0.6724
6. F Q0ALV0 Sulfate adenylyltransferase subunit 2 1.46e-03 NA NA 0.5485
6. F B4J5B3 Cytoplasmic tRNA 2-thiolation protein 1 3.93e-06 NA NA 0.6934
6. F A5WG99 tRNA-cytidine(32) 2-sulfurtransferase 1.28e-09 NA NA 0.6157
6. F A5E8X6 Sulfate adenylyltransferase subunit 2 2.41e-03 NA NA 0.5659
6. F B7URE9 tRNA-cytidine(32) 2-sulfurtransferase 3.38e-07 NA NA 0.7223
6. F B5FE41 tRNA-cytidine(32) 2-sulfurtransferase 3.31e-09 NA NA 0.7254
6. F Q6G5E1 tRNA-cytidine(32) 2-sulfurtransferase 1.34e-10 NA NA 0.7072
6. F Q9RX35 tRNA-cytidine(32) 2-sulfurtransferase 1.47e-09 NA NA 0.6728
6. F B5ED57 tRNA-cytidine(32) 2-sulfurtransferase 1.46e-06 NA NA 0.7197
6. F Q4P6R3 Cytoplasmic tRNA 2-thiolation protein 1 2.03e-05 NA NA 0.4873
6. F A7TER7 Cytoplasmic tRNA 2-thiolation protein 1 2.56e-07 NA NA 0.6966
6. F Q5ZXN3 tRNA-cytidine(32) 2-sulfurtransferase 6.44e-08 NA NA 0.6754
6. F C0Q3V6 tRNA-cytidine(32) 2-sulfurtransferase 8.72e-07 NA NA 0.7023
6. F Q16QI1 Cytoplasmic tRNA 2-thiolation protein 1 6.45e-06 NA NA 0.692
6. F Q9HNM7 NH(3)-dependent NAD(+) synthetase 1.35e-04 NA NA 0.4256
6. F A7NC76 tRNA-cytidine(32) 2-sulfurtransferase 2 6.41e-11 NA NA 0.6001
6. F A4G9W3 tRNA-cytidine(32) 2-sulfurtransferase 1.46e-04 NA NA 0.7229
6. F B4NN33 Cytoplasmic tRNA 2-thiolation protein 1 5.05e-06 NA NA 0.7036
6. F A5EXQ4 tRNA-cytidine(32) 2-sulfurtransferase 5.33e-08 NA NA 0.7276
6. F Q1B510 Sulfate adenylyltransferase subunit 2 9.07e-04 NA NA 0.5819
6. F Q5NFP3 tRNA-cytidine(32) 2-sulfurtransferase 2 3.27e-11 NA NA 0.6147
6. F B7GY44 tRNA-cytidine(32) 2-sulfurtransferase 5.19e-08 NA NA 0.7245
6. F Q1CZQ8 tRNA-cytidine(32) 2-sulfurtransferase 5.44e-06 NA NA 0.6965
6. F B4KLL0 Cytoplasmic tRNA 2-thiolation protein 1 4.71e-06 NA NA 0.7034
6. F Q2NXR3 tRNA-cytidine(32) 2-sulfurtransferase 1.06e-07 NA NA 0.733
6. F B3H1X8 7-cyano-7-deazaguanine synthase 3.45e-03 NA NA 0.5187
6. F B2HXA8 tRNA-cytidine(32) 2-sulfurtransferase 2.54e-07 NA NA 0.6846
6. F A4T0E0 tRNA-cytidine(32) 2-sulfurtransferase 2.07e-07 NA NA 0.7167
6. F Q5P3T7 tRNA-cytidine(32) 2-sulfurtransferase 3.37e-07 NA NA 0.7617
6. F A1BEN4 NH(3)-dependent NAD(+) synthetase 1.30e-05 NA NA 0.4652
6. F A8WR63 Cytoplasmic tRNA 2-thiolation protein 1 5.59e-05 NA NA 0.7454
6. F Q8TVH1 NH(3)-dependent NAD(+) synthetase 7.71e-05 NA NA 0.6123
6. F B0RYY8 tRNA-cytidine(32) 2-sulfurtransferase 1.79e-06 NA NA 0.6885
6. F Q5NG17 tRNA-cytidine(32) 2-sulfurtransferase 1 3.04e-10 NA NA 0.6008
6. F Q0A977 Sulfate adenylyltransferase subunit 2 1 7.84e-04 NA NA 0.5551
6. F Q32GI6 tRNA-cytidine(32) 2-sulfurtransferase 8.60e-07 NA NA 0.7291
6. F Q8Y306 tRNA-cytidine(32) 2-sulfurtransferase 4.96e-06 NA NA 0.5885
6. F A4JIF6 tRNA-cytidine(32) 2-sulfurtransferase 4.35e-05 NA NA 0.6445
6. F B0DK66 Cytoplasmic tRNA 2-thiolation protein 1 8.52e-07 NA NA 0.7417
6. F Q8KEX2 NH(3)-dependent NAD(+) synthetase 1.04e-04 NA NA 0.435
6. F Q2A447 tRNA-cytidine(32) 2-sulfurtransferase 1 3.30e-11 NA NA 0.6155
6. F Q9JVT8 7-cyano-7-deazaguanine synthase 4.11e-03 NA NA 0.5423
6. F A6VP68 tRNA-cytidine(32) 2-sulfurtransferase 1.37e-09 NA NA 0.7252
6. F Q5LW09 tRNA-cytidine(32) 2-sulfurtransferase 1.35e-07 NA NA 0.6368
6. F A1TDE9 Sulfate adenylyltransferase subunit 2 8.95e-04 NA NA 0.5657
6. F Q0HIM8 tRNA-cytidine(32) 2-sulfurtransferase 2.29e-07 NA NA 0.7581
6. F Q6LR31 tRNA-cytidine(32) 2-sulfurtransferase 6.98e-10 NA NA 0.6627
6. F Q6BKN2 Cytoplasmic tRNA 2-thiolation protein 2 3.23e-03 NA NA 0.5172
6. F Q7VKY7 tRNA-cytidine(32) 2-sulfurtransferase 6.99e-06 NA NA 0.7384
6. F B0KT32 tRNA-cytidine(32) 2-sulfurtransferase 4.33e-06 NA NA 0.7304
6. F Q7N3Y7 tRNA-cytidine(32) 2-sulfurtransferase 6.27e-07 NA NA 0.7186
6. F Q603C7 tRNA-cytidine(32) 2-sulfurtransferase 3.24e-08 NA NA 0.6108
6. F A9HY25 tRNA-cytidine(32) 2-sulfurtransferase 3.97e-06 NA NA 0.7408
6. F Q3A6S7 tRNA-cytidine(32) 2-sulfurtransferase 1.61e-06 NA NA 0.6643
6. F B2AGH6 tRNA-cytidine(32) 2-sulfurtransferase 3.34e-06 NA NA 0.7567
6. F B4RMM2 tRNA-cytidine(32) 2-sulfurtransferase 1.88e-09 NA NA 0.6062
6. F Q9K0Q9 7-cyano-7-deazaguanine synthase 4.72e-03 NA NA 0.5321
6. F Q4QK81 tRNA-cytidine(32) 2-sulfurtransferase 6.28e-07 NA NA 0.7325
6. F Q0KF09 tRNA-cytidine(32) 2-sulfurtransferase 2.29e-06 NA NA 0.7659
6. F A0KB51 tRNA-cytidine(32) 2-sulfurtransferase 1.41e-04 NA NA 0.6817
6. F Q320D9 tRNA-cytidine(32) 2-sulfurtransferase 8.90e-07 NA NA 0.7103
6. F Q2T1V1 tRNA-cytidine(32) 2-sulfurtransferase 1.28e-04 NA NA 0.6441
6. F Q6ACP8 tRNA(Ile)-lysidine synthase 0.00e+00 NA NA 0.679
6. F Q4QLA8 7-cyano-7-deazaguanine synthase 4.31e-03 NA NA 0.5204
6. F A1TUY3 tRNA-cytidine(32) 2-sulfurtransferase 3.48e-10 NA NA 0.687
6. F C5BRQ7 tRNA-cytidine(32) 2-sulfurtransferase 3.46e-10 NA NA 0.7096
6. F Q0T3Z1 tRNA-cytidine(32) 2-sulfurtransferase 8.69e-06 NA NA 0.6398
6. F Q0BB90 tRNA-cytidine(32) 2-sulfurtransferase 8.60e-05 NA NA 0.7157
6. F A4Y6T9 tRNA-cytidine(32) 2-sulfurtransferase 4.11e-10 NA NA 0.7171
6. F O58038 tRNA-5-methyluridine(54) 2-sulfurtransferase 8.50e-12 NA NA 0.7877
6. F A1WHW6 tRNA-cytidine(32) 2-sulfurtransferase 3.03e-06 NA NA 0.6898
6. F B0UU61 tRNA-cytidine(32) 2-sulfurtransferase 6.82e-07 NA NA 0.7263
6. F A3GGB3 Cytoplasmic tRNA 2-thiolation protein 1 5.54e-07 NA NA 0.6961
6. F Q9X8I6 tRNA(Ile)-lysidine synthase 1.11e-16 NA NA 0.7486
6. F A5U1Y3 Sulfate adenylyltransferase subunit 2 8.84e-04 NA NA 0.5735
6. F Q2SK22 tRNA-cytidine(32) 2-sulfurtransferase 1.47e-10 NA NA 0.6314
6. F Q11B05 7-cyano-7-deazaguanine synthase 4.12e-03 NA NA 0.5284
6. F B9KNZ4 tRNA-cytidine(32) 2-sulfurtransferase 8.28e-10 NA NA 0.7161
6. F Q82UJ4 tRNA-cytidine(32) 2-sulfurtransferase 8.74e-07 NA NA 0.7024
6. F A6V906 tRNA-cytidine(32) 2-sulfurtransferase 5.80e-10 NA NA 0.7165
6. F Q12N51 tRNA-cytidine(32) 2-sulfurtransferase 2.35e-07 NA NA 0.6628
6. F Q1QVW9 7-cyano-7-deazaguanine synthase 1.82e-03 NA NA 0.5453
6. F Q5WYK1 tRNA-cytidine(32) 2-sulfurtransferase 1.03e-07 NA NA 0.6676
6. F B7MUI7 tRNA-cytidine(32) 2-sulfurtransferase 7.76e-07 NA NA 0.7379
6. F B0CEK4 tRNA-cytidine(32) 2-sulfurtransferase 8.12e-10 NA NA 0.7214
6. F Q7Q9I4 Cytoplasmic tRNA 2-thiolation protein 1 7.84e-06 NA NA 0.7389
6. F Q6CWX6 Cytoplasmic tRNA 2-thiolation protein 1 6.10e-06 NA NA 0.6993
6. F A6X1K4 tRNA-cytidine(32) 2-sulfurtransferase 1.05e-07 NA NA 0.6803
6. F Q3SZG9 Cytoplasmic tRNA 2-thiolation protein 2 3.76e-04 NA NA 0.5043
6. F Q88MD2 tRNA-cytidine(32) 2-sulfurtransferase 4.63e-10 NA NA 0.7348
6. F Q0BMI3 tRNA-cytidine(32) 2-sulfurtransferase 1 1.17e-10 NA NA 0.6088
6. F Q8F4F4 Probable GMP synthase [glutamine-hydrolyzing] 3.79e-03 NA NA 0.4594
6. F Q63Y74 tRNA-cytidine(32) 2-sulfurtransferase 9.91e-06 NA NA 0.6995
6. F B2I7H1 tRNA-cytidine(32) 2-sulfurtransferase 6.00e-06 NA NA 0.6762
6. F A9AKB0 tRNA-cytidine(32) 2-sulfurtransferase 3.68e-05 NA NA 0.7173
6. F Q3IYY8 tRNA-cytidine(32) 2-sulfurtransferase 1.73e-10 NA NA 0.6754
6. F Q9X0Y0 Glutamine-dependent NAD(+) synthetase 2.19e-03 NA NA 0.6157
6. F A8JF71 Cytoplasmic tRNA 2-thiolation protein 1 6.16e-06 NA NA 0.7225
6. F Q57P06 tRNA-cytidine(32) 2-sulfurtransferase 6.46e-07 NA NA 0.7045
6. F Q082E9 tRNA-cytidine(32) 2-sulfurtransferase 4.07e-06 NA NA 0.6431
6. F Q0TI22 tRNA-cytidine(32) 2-sulfurtransferase 8.02e-07 NA NA 0.7036
6. F A0KX28 tRNA-cytidine(32) 2-sulfurtransferase 2.62e-06 NA NA 0.7448
6. F A1KSD4 7-cyano-7-deazaguanine synthase 3.85e-03 NA NA 0.5352
6. F B0VDQ2 tRNA-cytidine(32) 2-sulfurtransferase 4.77e-08 NA NA 0.7339
6. F A5DPQ4 Cytoplasmic tRNA 2-thiolation protein 1 6.65e-07 NA NA 0.7289
6. F B4TIS7 tRNA-cytidine(32) 2-sulfurtransferase 6.96e-07 NA NA 0.7041
6. F Q6NF90 tRNA(Ile)-lysidine synthase 1.91e-14 NA NA 0.6551
6. F Q6MLD2 GMP synthase [glutamine-hydrolyzing] 9.40e-03 NA NA 0.5713
6. F Q604B7 Sulfate adenylyltransferase subunit 2 2.26e-03 NA NA 0.5624
6. F Q0BLX1 tRNA-cytidine(32) 2-sulfurtransferase 2 7.96e-11 NA NA 0.7319
6. F A6QB13 Sulfate adenylyltransferase subunit 2 2.62e-03 NA NA 0.5707
6. F F9UST4 Pyridinium-3,5-bisthiocarboxylic acid mononucleotide synthase 6.69e-05 NA NA 0.6191
6. F A0Q6E3 tRNA-cytidine(32) 2-sulfurtransferase 1 1.11e-07 NA NA 0.7173
6. F A5W7U0 tRNA-cytidine(32) 2-sulfurtransferase 4.80e-10 NA NA 0.7372
6. F B8F6L5 7-cyano-7-deazaguanine synthase 6.10e-03 NA NA 0.4875
6. F A8H4Q7 tRNA-cytidine(32) 2-sulfurtransferase 3.46e-10 NA NA 0.6222
6. F Q5FW05 Cytoplasmic tRNA 2-thiolation protein 1 2.21e-06 NA NA 0.7391
6. F B1XCH3 tRNA-cytidine(32) 2-sulfurtransferase 7.97e-07 NA NA 0.7123
6. F A6QBI5 GMP synthase [glutamine-hydrolyzing] 6.54e-03 NA NA 0.6635
6. F A1W3C0 tRNA-cytidine(32) 2-sulfurtransferase 1.08e-07 NA NA 0.6567
6. F P0CS71 Cytoplasmic tRNA 2-thiolation protein 1 5.93e-08 NA NA 0.7167
6. F A1JND8 tRNA-cytidine(32) 2-sulfurtransferase 8.34e-07 NA NA 0.6922
6. F Q6L0D1 NH(3)-dependent NAD(+) synthetase 4.77e-06 NA NA 0.492
6. F A9IUA2 tRNA-cytidine(32) 2-sulfurtransferase 2.67e-10 NA NA 0.7264
6. F Q8REA7 NH(3)-dependent NAD(+) synthetase 4.07e-06 NA NA 0.4849
6. F Q0VQ34 tRNA-cytidine(32) 2-sulfurtransferase 2.11e-07 NA NA 0.7001
6. F Q7NSB9 7-cyano-7-deazaguanine synthase 7.32e-03 NA NA 0.5396
6. F A5UCR9 7-cyano-7-deazaguanine synthase 3.92e-03 NA NA 0.5329
6. F Q5JJ65 NH(3)-dependent NAD(+) synthetase 9.39e-06 NA NA 0.4243
6. F B3PID5 tRNA-cytidine(32) 2-sulfurtransferase 8.79e-06 NA NA 0.7406
6. F Q12V31 NH(3)-dependent NAD(+) synthetase 2.82e-04 NA NA 0.4627
6. F Q6FMB5 Cytoplasmic tRNA 2-thiolation protein 1 2.00e-07 NA NA 0.7295
6. F A1RJP0 tRNA-cytidine(32) 2-sulfurtransferase 4.17e-10 NA NA 0.7131
6. F B1KFY6 tRNA-cytidine(32) 2-sulfurtransferase 3.86e-10 NA NA 0.6251
6. F B0VT10 tRNA-cytidine(32) 2-sulfurtransferase 4.55e-07 NA NA 0.5161
6. F B9MCI6 tRNA-cytidine(32) 2-sulfurtransferase 3.72e-07 NA NA 0.7102
6. F Q7VG78 Probable GMP synthase [glutamine-hydrolyzing] 2.11e-01 NA NA 0.6435
6. F Q7W398 tRNA-cytidine(32) 2-sulfurtransferase 1.62e-04 NA NA 0.711
6. F A2Q879 Cytoplasmic tRNA 2-thiolation protein 1 7.81e-06 NA NA 0.709
6. F B3ELE3 NH(3)-dependent NAD(+) synthetase 4.70e-04 NA NA 0.5927
6. F A6TD44 Sulfate adenylyltransferase subunit 2 1.37e-04 NA NA 0.5432
6. F A1S6K0 tRNA-cytidine(32) 2-sulfurtransferase 1.46e-07 NA NA 0.6666
6. F B7L5B2 tRNA-cytidine(32) 2-sulfurtransferase 8.04e-07 NA NA 0.7004
6. F Q8X8Q5 tRNA-cytidine(32) 2-sulfurtransferase 8.03e-07 NA NA 0.74
6. F A2BLB9 NH(3)-dependent NAD(+) synthetase 5.40e-06 NA NA 0.6487
6. F Q87B85 tRNA-cytidine(32) 2-sulfurtransferase 3.91e-06 NA NA 0.6829
6. F Q28ZC1 Cytoplasmic tRNA 2-thiolation protein 1 4.96e-06 NA NA 0.7078
6. F Q11U13 tRNA-cytidine(32) 2-sulfurtransferase 3.95e-10 NA NA 0.7334
6. F Q6L1Q1 GMP synthase [glutamine-hydrolyzing] subunit B 6.05e-04 NA NA 0.6512
6. F B0R6W9 NH(3)-dependent NAD(+) synthetase 5.22e-04 NA NA 0.5715
6. F B4HSL7 Cytoplasmic tRNA 2-thiolation protein 1 4.74e-06 NA NA 0.7252
6. F B0TY35 tRNA-cytidine(32) 2-sulfurtransferase 1 1.72e-10 NA NA 0.6467
6. F Q2K7U6 tRNA-cytidine(32) 2-sulfurtransferase 6.22e-10 NA NA 0.704
6. F Q979W4 NH(3)-dependent NAD(+) synthetase 2.56e-06 NA NA 0.4745
6. F Q3BMF4 tRNA-cytidine(32) 2-sulfurtransferase 4.19e-07 NA NA 0.6737
6. F B2S568 tRNA-cytidine(32) 2-sulfurtransferase 7.55e-06 NA NA 0.6928
6. F Q8FHP6 tRNA-cytidine(32) 2-sulfurtransferase 7.55e-07 NA NA 0.7125
6. F B8JEH9 tRNA-cytidine(32) 2-sulfurtransferase 2.50e-06 NA NA 0.6517
6. F A4YYA7 Sulfate adenylyltransferase subunit 2 1.39e-04 NA NA 0.5596
6. F B8IRX8 Sulfate adenylyltransferase subunit 2 4.69e-03 NA NA 0.5583
6. F Q1IX43 tRNA-cytidine(32) 2-sulfurtransferase 6.60e-06 NA NA 0.7418
6. F A9BXV6 tRNA-cytidine(32) 2-sulfurtransferase 2.56e-10 NA NA 0.6563
6. F Q65TL6 tRNA-cytidine(32) 2-sulfurtransferase 1.35e-09 NA NA 0.6986
6. F B9KAZ2 NH(3)-dependent NAD(+) synthetase 1.56e-04 NA NA 0.4226
6. F Q7VU56 tRNA-cytidine(32) 2-sulfurtransferase 6.42e-06 NA NA 0.7041
6. F Q15U56 tRNA-cytidine(32) 2-sulfurtransferase 6.79e-10 NA NA 0.719
6. F A9G6U6 tRNA-cytidine(32) 2-sulfurtransferase 1.73e-07 NA NA 0.6481
6. F Q7VNH6 7-cyano-7-deazaguanine synthase 3.31e-03 NA NA 0.4949
6. F A8AGE0 tRNA-cytidine(32) 2-sulfurtransferase 8.39e-07 NA NA 0.7667
6. F Q9X5U0 Sulfate adenylyltransferase subunit 2 1.32e-03 NA NA 0.5791
6. F Q5QZ01 tRNA-cytidine(32) 2-sulfurtransferase 6.00e-10 NA NA 0.7799
6. F Q3Z194 tRNA-cytidine(32) 2-sulfurtransferase 7.02e-07 NA NA 0.7265
6. F B4T6P5 tRNA-cytidine(32) 2-sulfurtransferase 7.43e-06 NA NA 0.6417
6. F A4SGJ0 GMP synthase [glutamine-hydrolyzing] 9.36e-03 NA NA 0.6216
6. F P72338 Sulfate adenylyltransferase subunit 2 1.49e-03 NA NA 0.5516
6. F A3DP41 NH(3)-dependent NAD(+) synthetase 4.51e-06 NA NA 0.6015
6. F Q6F8Q3 tRNA-cytidine(32) 2-sulfurtransferase 8.59e-08 NA NA 0.6714
6. F A1AAV5 tRNA-cytidine(32) 2-sulfurtransferase 6.29e-07 NA NA 0.7024
6. F Q885Z7 tRNA-cytidine(32) 2-sulfurtransferase 9.57e-06 NA NA 0.6563