Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54593.1
JCVISYN3A_0043
Uncharacterized methyltransferase.
M. mycoides homolog: Q6MUI7.
TIGRfam Classification: 2=Generic.
Category: Nonessential.
Statistics
Total GO Annotation: 164
Unique PROST Go: 46
Unique BLAST Go: 8
Unique Foldseek Go: 46
Total Homologs: 2226
Unique PROST Homologs: 988
Unique BLAST Homologs: 238
Unique Foldseek Homologs: 723
Literature
Danchin and Fang [1]: tRNA1(Val) (adenine(37)-N6)-methyltransferase|conserved PP dipeptide; TrmN6 in modomics, EcYfiC; similar to PrmC; could be promiscuous
Yang and Tsui [2]: tRNA1(Val) (Adenine(37)-N6)-methyltransferase
Antczak et al. [3]: RNA methyltransferase
Zhang et al. [4]: GO:0008170|N-methyltransferase activity
Bianchi et al. [5]: Methyltransferase Activity (hemK/yabD-like)
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A1AEA5
(tRNA1(Val) (adenine(37)-N6)-methyltransferase) with a FATCAT P-Value: 0 and RMSD of 2.12 angstrom. The sequence alignment identity is 24.3%.
Structural alignment shown in left. Query protein AVX54593.1 colored as red in alignment, homolog A1AEA5 colored as blue.
Query protein AVX54593.1 is also shown in right top, homolog A1AEA5 showed in right bottom. They are colored based on secondary structures.
AVX54593.1 MKVLNDLL---G--YKNRKLYQDNKMFNFTLDSILVARFCNLNSKKKKIC-DFGTNNAVIPLILSKYTKAKII--GVEIQNKAVEIAKQNIKLNGLEEQI 92 A1AEA5 MSQSTSVFRRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPVAGVKR--CLDIGAGSGLLALMLAQRTDDSVMIDAVELESEAAAQAQENINQSPWAERI 98 AVX54593.1 EIIH-ADIKEFSKLHNQ--EFDLVVCNPPFFKMDG----NPKLKEISLEVANARHELLITLE--DIIKSASRCLKNKGNFTIVHRSERLSEII-NLFYKY 182 A1AEA5 N-VHTADILQW--ITQQTVRFDLIISNPPYYQ-QGVECATPQ-RE------QARY--TTTLDHPSLLTCAAECITEEGFFCVV-----LPEQIGNGFTEL 180 AVX54593.1 NI-YPKRLRLIQSKKTD---N-AKM---ILLDGIYQGNEGMELL-PTLITHNDDETYTD---ELLKYFHD-- 240 A1AEA5 ALSMGWHLRL----RTDVAENEARLPHRVLL--AFSPQAG-ECFSDRLVIRGPDQNYSEAYTALTQAFYLFM 245
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0016430 | tRNA (adenine-N6-)-methyltransferase activity |
1. PBF | GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity |
1. PBF | GO:0008276 | protein methyltransferase activity |
1. PBF | GO:0000179 | rRNA (adenine-N6,N6-)-dimethyltransferase activity |
1. PBF | GO:0036009 | protein-glutamine N-methyltransferase activity |
1. PBF | GO:0008168 | methyltransferase activity |
1. PBF | GO:0003676 | nucleic acid binding |
1. PBF | GO:0046872 | metal ion binding |
1. PBF | GO:0008173 | RNA methyltransferase activity |
1. PBF | GO:0102559 | protein-(glutamine-N5) methyltransferase activity |
1. PBF | GO:0032259 | methylation |
1. PBF | GO:0008176 | tRNA (guanine-N7-)-methyltransferase activity |
1. PBF | GO:0018364 | peptidyl-glutamine methylation |
2. PF | GO:0102094 | S-adenosylmethionine:2-demethylmenaquinol methyltransferase activity |
2. PF | GO:0097697 | tRNA 5-carboxymethoxyuridine methyltransferase activity |
2. PF | GO:0006744 | ubiquinone biosynthetic process |
2. PF | GO:0030488 | tRNA methylation |
2. PF | GO:0043333 | 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity |
2. PF | GO:0005886 | plasma membrane |
2. PF | GO:0052729 | dimethylglycine N-methyltransferase activity |
2. PF | GO:0017174 | glycine N-methyltransferase activity |
2. PF | GO:0043776 | cobalt-precorrin-6B C5-methyltransferase activity |
2. PF | GO:0008689 | 3-demethylubiquinone-9 3-O-methyltransferase activity |
2. PF | GO:0102526 | 8-demethylnovobiocic acid C8-methyltransferase activity |
2. PF | GO:0052730 | sarcosine N-methyltransferase activity |
2. PF | GO:0019286 | glycine betaine biosynthetic process from glycine |
2. PF | GO:0030768 | 16-methoxy-2,3-dihydro-3-hydroxytabersonine N-methyltransferase activity |
2. PF | GO:0008171 | O-methyltransferase activity |
2. PF | GO:0016021 | integral component of membrane |
2. PF | GO:0002098 | tRNA wobble uridine modification |
2. PF | GO:0009236 | cobalamin biosynthetic process |
2. PF | GO:0043770 | demethylmenaquinone methyltransferase activity |
2. PF | GO:0017000 | antibiotic biosynthetic process |
2. PF | GO:0102082 | demethylrebeccamycin--D-glucose O-methyltransferase activity |
2. PF | GO:0009234 | menaquinone biosynthetic process |
2. PF | GO:0102208 | 2-polyprenyl-6-hydroxyphenol methylase activity |
2. PF | GO:0008425 | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
2. PF | GO:0008169 | C-methyltransferase activity |
2. PF | GO:0102308 | erythromycin D 3''-o-methyltransferase activity |
2. PF | GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups |
2. PF | GO:0102027 | S-adenosylmethionine:2-demethylquinol-8 methyltransferase activity |
2. PF | GO:0001510 | RNA methylation |
2. PF | GO:0046140 | corrin biosynthetic process |
2. PF | GO:0102307 | erythromycin C 3''-o-methyltransferase activity |
2. PF | GO:0102955 | S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity |
3. BF | GO:0052916 | 23S rRNA (guanine(1835)-N(2))-methyltransferase activity |
3. BF | GO:0016273 | arginine N-methyltransferase activity |
3. BF | GO:0003723 | RNA binding |
3. BF | GO:0070475 | rRNA base methylation |
3. BF | GO:0009383 | rRNA (cytosine-C5-)-methyltransferase activity |
3. BF | GO:0052907 | 23S rRNA (adenine(1618)-N(6))-methyltransferase activity |
3. BF | GO:0052915 | 23S rRNA (guanine(2445)-N(2))-methyltransferase activity |
3. BF | GO:0009007 | site-specific DNA-methyltransferase (adenine-specific) activity |
3. BF | GO:0070041 | rRNA (uridine-C5-)-methyltransferase activity |
3. BF | GO:0005737 | cytoplasm |
3. BF | GO:0035246 | peptidyl-arginine N-methylation |
3. BF | GO:0070043 | rRNA (guanine-N7-)-methyltransferase activity |
3. BF | GO:0016434 | rRNA (cytosine) methyltransferase activity |
3. BF | GO:0016277 | [myelin basic protein]-arginine N-methyltransferase activity |
4. PB | GO:0035657 | eRF1 methyltransferase complex |
4. PB | GO:0008990 | rRNA (guanine-N2-)-methyltransferase activity |
4. PB | GO:0008988 | rRNA (adenine-N6-)-methyltransferase activity |
4. PB | GO:0048863 | stem cell differentiation |
4. PB | GO:0031167 | rRNA methylation |
5. P | GO:1904047 | S-adenosyl-L-methionine binding |
5. P | GO:0005829 | cytosol |
5. P | GO:0046539 | histamine N-methyltransferase activity |
5. P | GO:0006555 | methionine metabolic process |
5. P | GO:0009102 | biotin biosynthetic process |
5. P | GO:0016743 | carboxyl- or carbamoyltransferase activity |
5. P | GO:0052909 | 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity |
5. P | GO:0010586 | miRNA metabolic process |
5. P | GO:0008650 | rRNA (uridine-2'-O-)-methyltransferase activity |
5. P | GO:0106217 | tRNA C3-cytosine methylation |
5. P | GO:0030792 | methylarsonite methyltransferase activity |
5. P | GO:0036265 | RNA (guanine-N7)-methylation |
5. P | GO:0061715 | miRNA 2'-O-methylation |
5. P | GO:0098603 | selenol Se-methyltransferase activity |
5. P | GO:1901052 | sarcosine metabolic process |
5. P | GO:0005739 | mitochondrion |
5. P | GO:1990276 | RNA 5'-methyltransferase activity |
5. P | GO:0030651 | peptide antibiotic biosynthetic process |
5. P | GO:0046406 | magnesium protoporphyrin IX methyltransferase activity |
5. P | GO:2000234 | positive regulation of rRNA processing |
5. P | GO:0010340 | carboxyl-O-methyltransferase activity |
5. P | GO:0040031 | snRNA modification |
5. P | GO:0009060 | aerobic respiration |
5. P | GO:0005977 | glycogen metabolic process |
5. P | GO:0052624 | 2-phytyl-1,4-naphthoquinone methyltransferase activity |
5. P | GO:2000632 | negative regulation of pre-miRNA processing |
5. P | GO:0001695 | histamine catabolic process |
5. P | GO:0042372 | phylloquinone biosynthetic process |
5. P | GO:1990273 | snRNA 5'-end processing |
5. P | GO:0016594 | glycine binding |
5. P | GO:0043527 | tRNA methyltransferase complex |
5. P | GO:0030791 | arsenite methyltransferase activity |
5. P | GO:0046498 | S-adenosylhomocysteine metabolic process |
5. P | GO:0018872 | arsonoacetate metabolic process |
5. P | GO:0005542 | folic acid binding |
5. P | GO:0034968 | histone lysine methylation |
5. P | GO:0009404 | toxin metabolic process |
5. P | GO:0030580 | quinone cofactor methyltransferase activity |
5. P | GO:0034708 | methyltransferase complex |
5. P | GO:0044550 | secondary metabolite biosynthetic process |
5. P | GO:0032775 | DNA methylation on adenine |
5. P | GO:0006111 | regulation of gluconeogenesis |
5. P | GO:0070042 | rRNA (uridine-N3-)-methyltransferase activity |
5. P | GO:0102130 | malonyl-CoA methyltransferase activity |
5. P | GO:0110142 | ubiquinone biosynthesis complex |
5. P | GO:0046500 | S-adenosylmethionine metabolic process |
6. F | GO:0003677 | DNA binding |
6. F | GO:0008175 | tRNA methyltransferase activity |
6. F | GO:0071768 | mycolic acid biosynthetic process |
6. F | GO:0052913 | 16S rRNA (guanine(966)-N(2))-methyltransferase activity |
6. F | GO:0005759 | mitochondrial matrix |
6. F | GO:0006355 | regulation of transcription, DNA-templated |
6. F | GO:0003838 | sterol 24-C-methyltransferase activity |
6. F | GO:0006696 | ergosterol biosynthetic process |
6. F | GO:0008170 | N-methyltransferase activity |
6. F | GO:0004719 | protein-L-isoaspartate (D-aspartate) O-methyltransferase activity |
6. F | GO:0071424 | rRNA (cytosine-N4-)-methyltransferase activity |
6. F | GO:0016126 | sterol biosynthetic process |
6. F | GO:0008469 | histone-arginine N-methyltransferase activity |
6. F | GO:0004809 | tRNA (guanine-N2-)-methyltransferase activity |
6. F | GO:0051539 | 4 iron, 4 sulfur cluster binding |
6. F | GO:0034969 | histone arginine methylation |
6. F | GO:0030091 | protein repair |
6. F | GO:1901663 | quinone biosynthetic process |
6. F | GO:0016429 | tRNA (adenine-N1-)-methyltransferase activity |
6. F | GO:0006694 | steroid biosynthetic process |
6. F | GO:0018216 | peptidyl-arginine methylation |
6. F | GO:0044020 | histone methyltransferase activity (H4-R3 specific) |
6. F | GO:0043046 | DNA methylation involved in gamete generation |
6. F | GO:0008610 | lipid biosynthetic process |
6. F | GO:0030747 | indolepyruvate C-methyltransferase activity |
6. F | GO:0006349 | regulation of gene expression by genomic imprinting |
6. F | GO:0052906 | tRNA (guanine(37)-N(1))-methyltransferase activity |
6. F | GO:0070901 | mitochondrial tRNA methylation |
6. F | GO:0005506 | iron ion binding |
6. F | GO:0035243 | protein-arginine omega-N symmetric methyltransferase activity |
6. F | GO:0000287 | magnesium ion binding |
6. F | GO:0061953 | mRNA (adenine-N1-)-methyltransferase activity |
6. F | GO:0102084 | L-dopa O-methyltransferase activity |
6. F | GO:0035241 | protein-arginine omega-N monomethyltransferase activity |
6. F | GO:0009019 | tRNA (guanine-N1-)-methyltransferase activity |
6. F | GO:0102522 | tRNA 4-demethylwyosine alpha-amino-alpha-carboxypropyltransferase activity |
6. F | GO:0000387 | spliceosomal snRNP assembly |
6. F | GO:0052908 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity |
6. F | GO:0002939 | tRNA N1-guanine methylation |
6. F | GO:0016206 | catechol O-methyltransferase activity |
6. F | GO:0008649 | rRNA methyltransferase activity |
6. F | GO:0043642 | novobiocin biosynthetic process |
6. F | GO:0042214 | terpene metabolic process |
6. F | GO:0008825 | cyclopropane-fatty-acyl-phospholipid synthase activity |
6. F | GO:0102938 | orcinol O-methyltransferase activity |
6. F | GO:0016274 | protein-arginine N-methyltransferase activity |
7. B | GO:0006479 | protein methylation |
7. B | GO:0006396 | RNA processing |
7. B | GO:0120048 | U6 snRNA (adenine-(43)-N(6))-methyltransferase activity |
7. B | GO:0052914 | 16S rRNA (guanine(1207)-N(2))-methyltransferase activity |
7. B | GO:0000154 | rRNA modification |
7. B | GO:0140381 | 4-hydroxytryptamine 4-phosphate methyltransferase activity |
7. B | GO:0120049 | snRNA (adenine-N6)-methylation |
7. B | GO:0001734 | mRNA (N6-adenosine)-methyltransferase activity |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0016740 | transferase activity |
GO:0043412 | macromolecule modification |
GO:0006807 | nitrogen compound metabolic process |
GO:0008168 | methyltransferase activity |
GO:0003676 | nucleic acid binding |
GO:0044260 | cellular macromolecule metabolic process |
GO:0032259 | methylation |
GO:0044238 | primary metabolic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | B8E5T2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.00e-36 | 3.56e-12 | 0.8158 |
1. PBF | B7MIR0 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.61e-40 | 9.26e-10 | 0.8356 |
1. PBF | Q3IG80 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.10e-34 | 3.46e-08 | 0.8356 |
1. PBF | A3QAZ2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.57e-35 | 3.46e-10 | 0.8237 |
1. PBF | Q8XA22 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.52e-38 | 8.44e-11 | 0.8409 |
1. PBF | A8H0P3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.67e-27 | 5.83e-11 | 0.8094 |
1. PBF | B4F055 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.66e-31 | 1.27e-12 | 0.8018 |
1. PBF | B1IVQ2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8383 |
1. PBF | A8FRM9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.64e-35 | 4.20e-13 | 0.7886 |
1. PBF | B1LP88 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8384 |
1. PBF | C6Y2G0 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.12e-34 | 9.22e-08 | 0.7976 |
1. PBF | C6CB42 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.11e-41 | 1.82e-10 | 0.8119 |
1. PBF | B2KA56 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.01e-41 | 1.16e-11 | 0.8293 |
1. PBF | Q15NR8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.17e-34 | 1.69e-05 | 0.8212 |
1. PBF | P44702 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.08e-34 | 1.11e-07 | 0.8214 |
1. PBF | B6I5E9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.01e-41 | 7.21e-11 | 0.8367 |
1. PBF | B1KF36 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.06e-30 | 1.37e-13 | 0.8229 |
1. PBF | Q667U2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 2.98e-13 | 4.01e-41 | 1.16e-11 | 0.8012 |
1. PBF | B3H2W9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.12e-40 | 2.46e-08 | 0.831 |
1. PBF | Q5PNB8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.41e-38 | 1.24e-09 | 0.829 |
1. PBF | B7UH15 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.61e-40 | 9.26e-10 | 0.8366 |
1. PBF | C6DC08 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.32e-42 | 1.50e-11 | 0.8633 |
1. PBF | B2VI36 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 7.33e-35 | 3.25e-12 | 0.834 |
1. PBF | A5FKD7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.36e-34 | 3.88e-14 | 0.8357 |
1. PBF | Q4QNC1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.04e-31 | 2.42e-09 | 0.822 |
1. PBF | Q0T1T1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.01e-41 | 7.21e-11 | 0.8349 |
1. PBF | B5Z149 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.41e-39 | 9.68e-11 | 0.8302 |
1. PBF | Q119M4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.44e-31 | 6.23e-12 | 0.8492 |
1. PBF | Q8Z4J9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.56e-39 | 2.22e-09 | 0.8258 |
1. PBF | C5BAI6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.00e-38 | 7.70e-10 | 0.8575 |
1. PBF | A6TCI9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.10e-37 | 2.11e-08 | 0.8309 |
1. PBF | A1S987 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.09e-40 | 4.88e-09 | 0.8432 |
1. PBF | B0TUD3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.87e-35 | 1.31e-14 | 0.8314 |
1. PBF | Q7MNQ4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.33e-38 | 8.31e-10 | 0.8153 |
1. PBF | A8GI34 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.05e-23 | 1.44e-11 | 0.849 |
1. PBF | B5XNG1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.64e-35 | 1.18e-08 | 0.8385 |
1. PBF | C6AQR4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 8.39e-33 | 4.51e-12 | 0.7752 |
1. PBF | C6CNL2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 8.12e-40 | 5.45e-12 | 0.8253 |
1. PBF | B7MYK8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.50e-40 | 5.53e-10 | 0.8373 |
1. PBF | Q1R8F7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.61e-40 | 9.26e-10 | 0.831 |
1. PBF | A9MGW2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.14e-39 | 9.13e-09 | 0.8325 |
1. PBF | B6EMW5 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.98e-37 | 1.62e-10 | 0.8526 |
1. PBF | Q8FF14 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.61e-40 | 9.26e-10 | 0.8256 |
1. PBF | A0LXM6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.04e-27 | 2.76e-11 | 0.8233 |
1. PBF | Q57L59 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.90e-33 | 1.63e-09 | 0.8316 |
1. PBF | A9N0W9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.41e-38 | 1.24e-09 | 0.8435 |
1. PBF | Q087P4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.30e-36 | 5.63e-14 | 0.8192 |
1. PBF | C6X2D2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.89e-41 | 1.16e-09 | 0.8529 |
1. PBF | Q6LUN9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.10e-36 | 2.18e-08 | 0.8395 |
1. PBF | Q57060 | Uncharacterized protein HI_0095 | 1.84e-09 | 1.03e-02 | 0.019 | 0.5287 |
1. PBF | B1JRB8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.18e-40 | 1.04e-11 | 0.8074 |
1. PBF | Q1C564 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.67e-42 | 1.08e-11 | 0.7951 |
1. PBF | B5F9T8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.07e-38 | 1.01e-08 | 0.832 |
1. PBF | B8F678 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.08e-34 | 4.43e-08 | 0.8377 |
1. PBF | A1AEA5 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.61e-40 | 9.26e-10 | 0.8256 |
1. PBF | A3N3J4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.36e-39 | 7.66e-08 | 0.8175 |
1. PBF | C5W7S9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8356 |
1. PBF | A6WS64 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.68e-34 | 2.00e-11 | 0.8248 |
1. PBF | B7NRM8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.44e-40 | 3.36e-10 | 0.8378 |
1. PBF | A4TKY7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.67e-42 | 1.08e-11 | 0.8337 |
1. PBF | A4Y3T4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.85e-39 | 1.58e-11 | 0.8155 |
1. PBF | Q0HM44 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.80e-38 | 6.58e-14 | 0.8334 |
1. PBF | Q0HRP2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.22e-38 | 3.28e-13 | 0.8164 |
1. PBF | Q6D211 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.70e-39 | 2.55e-13 | 0.865 |
1. PBF | B7M8I9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.01e-41 | 7.21e-11 | 0.8652 |
1. PBF | A1RN54 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.38e-38 | 6.61e-11 | 0.8378 |
1. PBF | A6VKA4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.12e-35 | 2.46e-08 | 0.8348 |
1. PBF | A0KPC4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 9.81e-39 | 1.56e-12 | 0.8307 |
1. PBF | Q32CU6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 7.77e-41 | 2.96e-10 | 0.8349 |
1. PBF | A9R3Z3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.67e-42 | 1.08e-11 | 0.8126 |
1. PBF | A8A386 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.829 |
1. PBF | Q9CJZ9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 8.82e-34 | 4.25e-12 | 0.8272 |
1. PBF | Q8A9H7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.96e-31 | 3.82e-17 | 0.8401 |
1. PBF | A7FFT0 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.67e-42 | 1.08e-11 | 0.8215 |
1. PBF | B7LDG8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.92e-41 | 1.03e-10 | 0.8374 |
1. PBF | Q74SR9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 6.92e-13 | 4.01e-41 | 1.16e-11 | 0.8006 |
1. PBF | A8AD10 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.11e-40 | 1.14e-10 | 0.8233 |
1. PBF | C4LCN4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.86e-29 | 8.00e-16 | 0.8335 |
1. PBF | Q8EI95 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.61e-35 | 1.84e-11 | 0.8363 |
1. PBF | B0UWL8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.66e-36 | 1.11e-09 | 0.843 |
1. PBF | Q87SB8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.25e-34 | 3.07e-11 | 0.8317 |
1. PBF | C0PVY6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.61e-39 | 1.34e-09 | 0.8323 |
1. PBF | B5QTV6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.81e-39 | 1.14e-09 | 0.8265 |
1. PBF | A7MXM2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.74e-39 | 4.81e-13 | 0.8204 |
1. PBF | C6UQY1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.41e-39 | 9.68e-11 | 0.8471 |
1. PBF | B8CU29 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.29e-31 | 7.47e-10 | 0.8496 |
1. PBF | B7LUY9 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.41e-42 | 1.71e-11 | 0.8638 |
1. PBF | A3D0V3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.00e-36 | 3.56e-12 | 0.7877 |
1. PBF | Q65W50 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.13e-38 | 1.03e-11 | 0.826 |
1. PBF | A4SRS5 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.39e-40 | 2.15e-10 | 0.827 |
1. PBF | C6UBI3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8387 |
1. PBF | B7N6G4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8381 |
1. PBF | Q11RK8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.32e-30 | 1.21e-12 | 0.8236 |
1. PBF | A7ZQ20 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.92e-41 | 1.03e-10 | 0.8358 |
1. PBF | Q7N1W7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.31e-34 | 3.48e-11 | 0.8207 |
1. PBF | B2RK25 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.00e-36 | 2.13e-14 | 0.8355 |
1. PBF | A6GWI6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 9.28e-33 | 3.24e-17 | 0.8636 |
1. PBF | Q3YYU0 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.84e-41 | 7.36e-11 | 0.8187 |
1. PBF | B2TYI8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.23e-41 | 1.29e-10 | 0.834 |
1. PBF | Q31XR1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.23e-41 | 1.29e-10 | 0.844 |
1. PBF | Q8DEQ3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 3.10e-40 | 1.31e-09 | 0.8455 |
1. PBF | A5UA66 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.38e-32 | 6.28e-09 | 0.8185 |
1. PBF | B7VJ58 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.63e-34 | 8.64e-09 | 0.7889 |
1. PBF | A9L1L1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.04e-35 | 1.71e-11 | 0.7842 |
1. PBF | A0L0I8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.25e-34 | 8.50e-15 | 0.8004 |
1. PBF | Q0TER3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.23e-40 | 1.19e-09 | 0.8285 |
1. PBF | C3LSR6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.95e-39 | 1.12e-07 | 0.7938 |
1. PBF | Q9KU62 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 1.11e-16 | 6.95e-39 | 1.12e-07 | 0.7952 |
1. PBF | A6LD46 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.37e-28 | 4.24e-14 | 0.7983 |
1. PBF | A1JKJ4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.66e-36 | 2.37e-08 | 0.8605 |
1. PBF | B5BAS2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.41e-38 | 1.24e-09 | 0.8308 |
1. PBF | A6L532 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.80e-37 | 9.02e-17 | 0.811 |
1. PBF | B5RD57 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.81e-39 | 1.14e-09 | 0.8252 |
1. PBF | Q8ZMX8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.61e-39 | 1.34e-09 | 0.8315 |
1. PBF | P37543 | Uncharacterized protein YabB | 0.00e+00 | 1.67e-65 | 2.98e-51 | 0.9603 |
1. PBF | C4ZYJ8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8215 |
1. PBF | Q7MVG0 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.17e-35 | 3.28e-14 | 0.8381 |
1. PBF | Q83QI2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.01e-41 | 7.21e-11 | 0.8327 |
1. PBF | B1XBQ2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | 0.8393 |
1. PBF | Q0I4T7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 8.57e-37 | 1.39e-09 | 0.8257 |
1. PBF | Q5LCS1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.22e-38 | 6.54e-18 | 0.8343 |
1. PBF | A4WDE6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.52e-44 | 5.40e-07 | 0.8078 |
1. PBF | A7MH06 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 6.39e-36 | 1.52e-07 | 0.8515 |
1. PBF | C6VS84 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 4.78e-25 | 3.77e-10 | 0.8515 |
1. PBF | Q12R91 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.41e-32 | 7.56e-06 | 0.8169 |
1. PBF | A5UGT6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 1.54e-31 | 2.92e-10 | 0.8114 |
1. PBF | Q1CKF3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 5.67e-42 | 1.08e-11 | 0.8365 |
1. PBF | Q64TX7 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.41e-37 | 2.11e-18 | 0.8336 |
1. PBF | Q5E7Q6 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 8.46e-35 | 3.99e-06 | 0.8398 |
2. PF | C3MTW8 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 7.48e-12 | 7.49e-03 | NA | 0.6339 |
2. PF | C6CWS7 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.51e-08 | 1.84e-05 | NA | 0.5747 |
2. PF | Q8SR66 | mRNA cap guanine-N7 methyltransferase | 1.43e-03 | 3.49e-02 | NA | 0.483 |
2. PF | Q75FL1 | Demethylmenaquinone methyltransferase | 6.07e-05 | 5.52e-06 | NA | 0.5247 |
2. PF | Q97WC7 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 9.06e-12 | 2.83e-02 | NA | 0.6326 |
2. PF | C3NJQ5 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 7.49e-12 | 1.00e-02 | NA | 0.6128 |
2. PF | O26249 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 4.80e-11 | 3.51e-03 | NA | 0.6671 |
2. PF | A5FZ96 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.51e-05 | 9.57e-03 | NA | 0.5014 |
2. PF | B2UUE3 | tRNA U34 carboxymethyltransferase | 2.33e-09 | 1.25e-02 | NA | 0.5623 |
2. PF | C3N8G6 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 9.66e-12 | 7.49e-03 | NA | 0.6162 |
2. PF | Q1GC56 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 8.92e-06 | 8.69e-03 | NA | 0.5727 |
2. PF | O25173 | tRNA U34 carboxymethyltransferase | 2.25e-09 | 2.14e-02 | NA | 0.5688 |
2. PF | C3N0H8 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 9.66e-12 | 7.49e-03 | NA | 0.6027 |
2. PF | B9KQJ8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.27e-05 | 9.73e-04 | NA | 0.553 |
2. PF | C4KJM8 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 1.02e-11 | 7.49e-03 | NA | 0.6021 |
2. PF | Q9L9F3 | 8-demethylnovobiocic acid C(8)-methyltransferase | 6.77e-09 | 4.89e-03 | NA | 0.5334 |
2. PF | Q1CSN0 | tRNA U34 carboxymethyltransferase | 2.32e-09 | 2.07e-02 | NA | 0.5589 |
2. PF | Q8XDG3 | tRNA 5-carboxymethoxyuridine methyltransferase | 6.24e-10 | 4.13e-03 | NA | 0.5453 |
2. PF | A9AWD7 | (+)-O-methylkolavelool synthase | 5.63e-09 | 1.36e-03 | NA | 0.5576 |
2. PF | W5U2K2 | 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase | 1.29e-06 | 5.25e-03 | NA | 0.5646 |
2. PF | Q8KZ94 | Demethylrebeccamycin-D-glucose O-methyltransferase | 2.67e-07 | 2.73e-02 | NA | 0.5702 |
2. PF | Q83WC3 | Sarcosine/dimethylglycine N-methyltransferase | 3.09e-09 | 4.45e-02 | NA | 0.5348 |
2. PF | Q17Y58 | tRNA U34 carboxymethyltransferase | 2.34e-09 | 1.10e-02 | NA | 0.5736 |
2. PF | Q16DL1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 8.76e-06 | 1.93e-02 | NA | 0.5721 |
2. PF | Q7U4Z9 | Dimethylglycine N-methyltransferase | 6.10e-07 | 8.03e-03 | NA | 0.533 |
2. PF | A4F7P5 | Erythromycin 3''-O-methyltransferase | 2.14e-08 | 3.86e-02 | NA | 0.5211 |
2. PF | Q9F8T9 | C-methyltransferase CouO | 7.29e-09 | 1.49e-03 | NA | 0.5342 |
2. PF | Q8EXJ3 | Demethylmenaquinone methyltransferase | 6.31e-05 | 5.52e-06 | NA | 0.5237 |
2. PF | B6JMM9 | tRNA U34 carboxymethyltransferase | 3.61e-09 | 2.21e-02 | NA | 0.5432 |
2. PF | Q0VQX7 | Carboxy-S-adenosyl-L-methionine synthase | 8.24e-05 | 1.18e-03 | NA | 0.4911 |
2. PF | C3MJI5 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 9.39e-12 | 7.49e-03 | NA | 0.602 |
2. PF | G0FUS0 | 27-O-demethylrifamycin SV methyltransferase | 1.42e-09 | 8.07e-04 | NA | 0.5722 |
2. PF | Q9KJ21 | Sarcosine/dimethylglycine N-methyltransferase | 5.99e-09 | 8.85e-03 | NA | 0.6332 |
2. PF | A4FG18 | Geranyl diphosphate 2-C-methyltransferase | 4.60e-10 | 2.31e-02 | NA | 0.5823 |
2. PF | Q9ZKH1 | tRNA U34 carboxymethyltransferase | 2.93e-09 | 3.86e-02 | NA | 0.5697 |
2. PF | Q8PY64 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 5.56e-10 | 2.51e-02 | NA | 0.7107 |
3. BF | Q83RX5 | Ribosomal RNA large subunit methyltransferase K/L | 3.17e-05 | NA | 0.002 | 0.5825 |
3. BF | Q04QV8 | Ribosomal protein L11 methyltransferase | 6.93e-08 | NA | 6.34e-04 | 0.5816 |
3. BF | Q11GT9 | Ribosomal protein L11 methyltransferase | 1.84e-10 | NA | 0.002 | 0.6615 |
3. BF | Q97F67 | Release factor glutamine methyltransferase | 5.46e-13 | NA | 2.31e-08 | 0.6961 |
3. BF | Q8FJ88 | Ribosomal RNA large subunit methyltransferase K/L | 3.08e-05 | NA | 0.004 | 0.573 |
3. BF | B5YDR3 | Ribosomal protein L11 methyltransferase | 1.11e-09 | NA | 0.004 | 0.6715 |
3. BF | B0UUM5 | Ribosomal RNA large subunit methyltransferase K/L | 3.57e-05 | NA | 0.002 | 0.6214 |
3. BF | Q5NEL0 | 50S ribosomal protein L3 glutamine methyltransferase | 2.49e-09 | NA | 3.13e-06 | 0.5666 |
3. BF | C3LQP9 | Ribosomal protein L11 methyltransferase | 1.53e-08 | NA | 3.85e-05 | 0.651 |
3. BF | P60094 | Ribosomal protein L11 methyltransferase | 2.71e-08 | NA | 0.015 | 0.6314 |
3. BF | Q7ULT2 | Release factor glutamine methyltransferase | 5.70e-12 | NA | 3.93e-04 | 0.6093 |
3. BF | Q0WDE1 | 50S ribosomal protein L3 glutamine methyltransferase | 4.30e-09 | NA | 8.61e-05 | 0.6351 |
3. BF | B8CHY3 | Ribosomal protein L11 methyltransferase | 8.51e-09 | NA | 8.28e-04 | 0.6759 |
3. BF | Q9KRZ5 | Ribosomal RNA large subunit methyltransferase K/L | 4.31e-05 | NA | 0.031 | 0.5811 |
3. BF | Q9KQ83 | 50S ribosomal protein L3 glutamine methyltransferase | 4.11e-09 | NA | 8.11e-08 | 0.623 |
3. BF | B5FC65 | Ribosomal protein L11 methyltransferase | 2.40e-08 | NA | 5.25e-04 | 0.6334 |
3. BF | Q9CNN7 | 50S ribosomal protein L3 glutamine methyltransferase | 4.99e-09 | NA | 8.68e-05 | 0.6504 |
3. BF | A8GK75 | Ribosomal protein L11 methyltransferase | 4.48e-08 | NA | 8.91e-04 | 0.6189 |
3. BF | B9LZ49 | Ribosomal protein L11 methyltransferase | 1.42e-09 | NA | 0.034 | 0.6217 |
3. BF | Q3Z3H3 | Ribosomal RNA large subunit methyltransferase K/L | 2.86e-05 | NA | 0.002 | 0.5838 |
3. BF | Q9Z721 | Uncharacterized RNA methyltransferase CPn_0885/CP_0981/CPj0885/CpB0914 | 1.60e-08 | NA | 3.79e-04 | 0.6652 |
3. BF | Q15UB5 | Ribosomal RNA large subunit methyltransferase K/L | 1.59e-05 | NA | 1.04e-04 | 0.6077 |
3. BF | B4S130 | Ribosomal protein L11 methyltransferase | 1.24e-08 | NA | 0.034 | 0.6553 |
3. BF | Q9ZCB3 | Bifunctional methyltransferase | 7.48e-09 | NA | 3.25e-07 | 0.6291 |
3. BF | Q8KCD5 | Release factor glutamine methyltransferase | 1.37e-11 | NA | 3.63e-07 | 0.7077 |
3. BF | Q1RDR6 | Ribosomal RNA large subunit methyltransferase K/L | 3.14e-05 | NA | 0.004 | 0.5903 |
3. BF | Q5E263 | Ribosomal protein L11 methyltransferase | 2.05e-08 | NA | 5.25e-04 | 0.6338 |
3. BF | Q821Q5 | Uncharacterized RNA methyltransferase CCA_00883 | 2.40e-08 | NA | 8.94e-05 | 0.6646 |
3. BF | A8GCM8 | Ribosomal RNA large subunit methyltransferase I | 2.44e-08 | NA | 8.86e-04 | 0.6056 |
3. BF | A8GZI2 | Ribosomal protein L11 methyltransferase | 7.73e-09 | NA | 0.020 | 0.6385 |
3. BF | A0KHV5 | Ribosomal RNA large subunit methyltransferase F | 1.51e-09 | NA | 0.003 | 0.547 |
3. BF | P57444 | Ribosomal RNA large subunit methyltransferase K/L | 1.54e-05 | NA | 0.008 | 0.5935 |
3. BF | B4EVC6 | Ribosomal RNA large subunit methyltransferase K/L | 3.68e-05 | NA | 0.008 | 0.608 |
3. BF | A8G0U8 | Ribosomal protein L11 methyltransferase | 1.52e-08 | NA | 0.004 | 0.6876 |
3. BF | Q0AWM5 | Ribosomal protein L11 methyltransferase | 5.60e-11 | NA | 0.002 | 0.6779 |
3. BF | Q9WYV8 | Release factor glutamine methyltransferase | 2.93e-10 | NA | 4.48e-06 | 0.6016 |
3. BF | Q68VR6 | Bifunctional methyltransferase | 8.48e-09 | NA | 7.98e-08 | 0.6254 |
3. BF | Q89AT0 | Release factor glutamine methyltransferase | 2.10e-12 | NA | 1.16e-06 | 0.7128 |
3. BF | B2K467 | Ribosomal protein L11 methyltransferase | 3.67e-08 | NA | 0.004 | 0.6219 |
3. BF | Q133Y8 | Ribosomal protein L11 methyltransferase | 1.51e-09 | NA | 3.35e-05 | 0.6944 |
3. BF | A7FDQ3 | Ribosomal protein L11 methyltransferase | 3.87e-08 | NA | 0.004 | 0.6559 |
3. BF | Q63SZ9 | 50S ribosomal protein L3 glutamine methyltransferase | 4.60e-09 | NA | 0.005 | 0.577 |
3. BF | B6ENA3 | Ribosomal protein L11 methyltransferase | 1.97e-08 | NA | 0.005 | 0.6339 |
3. BF | Q89DG5 | 50S ribosomal protein L3 glutamine methyltransferase | 1.77e-09 | NA | 4.00e-06 | 0.643 |
3. BF | Q3AF06 | Ribosomal protein L11 methyltransferase | 1.21e-10 | NA | 0.014 | 0.6801 |
3. BF | Q31IC8 | Ribosomal RNA large subunit methyltransferase K/L | 1.02e-04 | NA | 0.016 | 0.5821 |
3. BF | Q4UJU4 | Bifunctional methyltransferase | 9.79e-09 | NA | 1.03e-08 | 0.6296 |
3. BF | P0A294 | 50S ribosomal protein L3 glutamine methyltransferase | 3.31e-09 | NA | 7.37e-05 | 0.627 |
3. BF | Q04Z65 | Ribosomal protein L11 methyltransferase | 8.07e-08 | NA | 6.34e-04 | 0.611 |
3. BF | A5F836 | Ribosomal RNA large subunit methyltransferase K/L | 3.84e-05 | NA | 0.031 | 0.5948 |
3. BF | Q89XT8 | Release factor glutamine methyltransferase | 7.36e-12 | NA | 0.011 | 0.6855 |
3. BF | Q9CHX0 | Release factor glutamine methyltransferase | 2.33e-11 | NA | 0.015 | 0.6953 |
3. BF | Q8ZAX6 | Ribosomal protein L11 methyltransferase | 2.71e-08 | NA | 0.004 | 0.6567 |
3. BF | Q8F6B7 | Ribosomal protein L11 methyltransferase | 4.42e-08 | NA | 3.49e-04 | 0.6835 |
3. BF | Q5E3U5 | 50S ribosomal protein L3 glutamine methyltransferase | 3.62e-09 | NA | 4.18e-04 | 0.638 |
3. BF | B1KDN0 | Ribosomal RNA large subunit methyltransferase K/L | 4.53e-05 | NA | 0.001 | 0.6125 |
3. BF | Q8K9W9 | Release factor glutamine methyltransferase | 5.27e-13 | NA | 2.44e-07 | 0.7519 |
3. BF | A8MG53 | Ribosomal protein L11 methyltransferase | 4.80e-10 | NA | 0.007 | 0.6491 |
3. BF | B1JKF2 | Ribosomal protein L11 methyltransferase | 3.38e-08 | NA | 0.004 | 0.6555 |
3. BF | C5BEW8 | Ribosomal protein L11 methyltransferase | 3.24e-08 | NA | 0.016 | 0.5944 |
3. BF | P0DD18 | Ribosomal protein L11 methyltransferase | 1.36e-09 | NA | 0.037 | 0.6445 |
3. BF | P39200 | 50S ribosomal protein L3 glutamine methyltransferase | 3.10e-09 | NA | 1.39e-06 | 0.6386 |
3. BF | B4RZ48 | Ribosomal RNA large subunit methyltransferase K/L | 3.20e-05 | NA | 0.006 | 0.611 |
3. BF | B5XND9 | Ribosomal protein L11 methyltransferase | 2.36e-08 | NA | 0.038 | 0.6482 |
3. BF | Q72PX0 | Ribosomal protein L11 methyltransferase | 4.40e-08 | NA | 3.49e-04 | 0.6227 |
3. BF | A7MXI3 | Ribosomal protein L11 methyltransferase | 3.47e-08 | NA | 0.007 | 0.6357 |
3. BF | Q1ICL2 | Ribosomal RNA large subunit methyltransferase K/L | 3.38e-05 | NA | 0.030 | 0.5425 |
3. BF | A4SJL7 | Ribosomal protein L11 methyltransferase | 1.45e-08 | NA | 1.73e-04 | 0.6717 |
3. BF | A6V328 | Ribosomal RNA large subunit methyltransferase K/L | 4.06e-05 | NA | 0.003 | 0.5918 |
3. BF | Q665E3 | Ribosomal protein L11 methyltransferase | 2.73e-08 | NA | 0.004 | 0.6566 |
3. BF | B0TJ37 | Ribosomal protein L11 methyltransferase | 8.94e-09 | NA | 0.011 | 0.6724 |
3. BF | Q1RH40 | Bifunctional methyltransferase | 9.23e-09 | NA | 4.13e-08 | 0.6181 |
3. BF | A1JMW5 | Ribosomal RNA large subunit methyltransferase I | 1.83e-08 | NA | 0.028 | 0.61 |
3. BF | A0LQ64 | Ribosomal protein L11 methyltransferase | 2.00e-09 | NA | 1.94e-04 | 0.6686 |
3. BF | Q9V2G1 | tRNA (guanine(37)-N1)/4-demethylwyosine(37)-methyltransferase Taw22 | 2.10e-08 | NA | 0.010 | 0.6071 |
3. BF | Q9HZG0 | Ribosomal RNA large subunit methyltransferase K/L | 5.46e-05 | NA | 0.005 | 0.5821 |
3. BF | Q8A1D7 | Release factor glutamine methyltransferase | 7.47e-12 | NA | 0.005 | 0.6918 |
3. BF | Q87PC0 | Ribosomal RNA large subunit methyltransferase K/L | 4.42e-05 | NA | 0.002 | 0.5958 |
3. BF | Q8DD03 | Ribosomal protein L11 methyltransferase | 2.90e-08 | NA | 0.014 | 0.6253 |
3. BF | C6DIJ9 | Ribosomal protein L11 methyltransferase | 5.35e-08 | NA | 0.001 | 0.6298 |
3. BF | P0DD19 | Ribosomal protein L11 methyltransferase | 1.35e-09 | NA | 0.037 | 0.6062 |
3. BF | Q8UDP9 | Ribosomal protein L11 methyltransferase | 3.80e-10 | NA | 0.004 | 0.6923 |
3. BF | Q7VP04 | Ribosomal RNA large subunit methyltransferase K/L | 2.83e-05 | NA | 0.043 | 0.606 |
3. BF | A5F3S3 | Ribosomal protein L11 methyltransferase | 1.55e-08 | NA | 3.57e-05 | 0.68 |
3. BF | P45106 | 50S ribosomal protein L3 glutamine methyltransferase | 4.18e-09 | NA | 0.013 | 0.6503 |
3. BF | Q9A9T7 | Release factor glutamine methyltransferase | 7.26e-13 | NA | 1.93e-04 | 0.7093 |
3. BF | C4L423 | Ribosomal protein L11 methyltransferase | 2.41e-10 | NA | 1.23e-04 | 0.5805 |
3. BF | A9CG70 | Release factor glutamine methyltransferase | 8.24e-13 | NA | 3.62e-07 | 0.6519 |
3. BF | A0KNJ1 | Ribosomal protein L11 methyltransferase | 1.05e-08 | NA | 2.68e-05 | 0.6723 |
3. BF | A4SKI2 | Ribosomal RNA large subunit methyltransferase F | 1.43e-09 | NA | 0.001 | 0.546 |
3. BF | Q7NJS7 | Release factor glutamine methyltransferase | 9.24e-12 | NA | 1.08e-07 | 0.6796 |
3. BF | Q9RU72 | Ribosomal protein L11 methyltransferase | 3.62e-10 | NA | 0.017 | 0.7098 |
3. BF | C4LAF1 | Ribosomal protein L11 methyltransferase | 8.74e-09 | NA | 1.65e-04 | 0.6264 |
3. BF | B9JH32 | Ribosomal protein L11 methyltransferase | 2.26e-10 | NA | 0.012 | 0.6893 |
3. BF | A1AT86 | Ribosomal protein L11 methyltransferase | 1.07e-08 | NA | 1.55e-04 | 0.6327 |
3. BF | A4J7F1 | Ribosomal protein L11 methyltransferase | 7.13e-10 | NA | 0.001 | 0.6529 |
3. BF | Q6DAJ5 | Ribosomal protein L11 methyltransferase | 4.86e-08 | NA | 8.55e-04 | 0.6662 |
3. BF | Q9KV64 | Ribosomal protein L11 methyltransferase | 1.52e-08 | NA | 3.29e-05 | 0.6452 |
3. BF | B8E004 | Release factor glutamine methyltransferase | 4.50e-11 | NA | 0.006 | 0.6751 |
3. BF | A1JRL5 | Ribosomal protein L11 methyltransferase | 2.99e-08 | NA | 0.001 | 0.6571 |
3. BF | B1KQE8 | Ribosomal protein L11 methyltransferase | 1.32e-08 | NA | 0.002 | 0.6833 |
3. BF | Q92G13 | Bifunctional methyltransferase | 6.58e-09 | NA | 4.14e-05 | 0.6312 |
3. BF | Q32DK7 | 50S ribosomal protein L3 glutamine methyltransferase | 4.91e-09 | NA | 1.56e-05 | 0.6242 |
3. BF | Q582G4 | Protein arginine N-methyltransferase 7 | 8.08e-06 | NA | 0.025 | 0.6388 |
3. BF | B7VM52 | Ribosomal protein L11 methyltransferase | 2.97e-08 | NA | 6.09e-04 | 0.627 |
3. BF | B1MZ55 | Ribosomal protein L11 methyltransferase | 2.62e-10 | NA | 0.019 | 0.641 |
4. PB | Q58292 | Probable S-adenosylmethionine-dependent methyltransferase MJ0882 | 1.24e-14 | 4.98e-03 | 6.91e-06 | NA |
4. PB | F1QVR8 | rRNA N6-adenosine-methyltransferase METTL5 | 1.09e-10 | 9.33e-13 | 0.042 | NA |
4. PB | P31825 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 0.00e+00 | 2.61e-40 | 3.11e-10 | NA |
4. PB | Q58338 | Putative protein N5-glutamine methyltransferase MJ0928 | 1.11e-16 | 4.48e-17 | 8.91e-05 | NA |
4. PB | Q18511 | rRNA N6-adenosine-methyltransferase metl-5 | 6.77e-11 | 2.01e-12 | 1.25e-04 | NA |
4. PB | Q8K1A0 | rRNA N6-adenosine-methyltransferase METTL5 | 1.37e-10 | 1.19e-08 | 0.012 | NA |
5. P | Q2FRP5 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 8.57e-06 | 9.83e-03 | NA | NA |
5. P | Q3J8U2 | Ubiquinone biosynthesis O-methyltransferase | 5.04e-11 | 2.47e-02 | NA | NA |
5. P | B7NV33 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.28e-05 | 5.09e-04 | NA | NA |
5. P | Q2SRA2 | tRNA (guanine-N(7)-)-methyltransferase | 9.07e-07 | 2.52e-06 | NA | NA |
5. P | A1R990 | Demethylmenaquinone methyltransferase | 9.29e-05 | 3.10e-04 | NA | NA |
5. P | C3PLF4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.50e-05 | 5.29e-05 | NA | NA |
5. P | P94298 | Demethylmenaquinone methyltransferase | 1.74e-05 | 1.75e-04 | NA | NA |
5. P | B5BIX9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 1.68e-04 | NA | NA |
5. P | B0KV19 | Carboxy-S-adenosyl-L-methionine synthase | 4.93e-04 | 1.96e-03 | NA | NA |
5. P | Q9F411 | tRNA (guanine-N(7)-)-methyltransferase | 9.38e-07 | 1.63e-07 | NA | NA |
5. P | Q7WF12 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.12e-05 | 2.27e-02 | NA | NA |
5. P | Q9JV83 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.54e-05 | 6.80e-05 | NA | NA |
5. P | Q5ZRH9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.70e-05 | 1.23e-05 | NA | NA |
5. P | Q0PAS7 | Carboxy-S-adenosyl-L-methionine synthase | 1.66e-04 | 8.29e-05 | NA | NA |
5. P | Q2A524 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.08e-05 | 1.80e-02 | NA | NA |
5. P | Q8FBJ0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.82e-05 | 4.76e-04 | NA | NA |
5. P | B7GHP8 | Demethylmenaquinone methyltransferase | 1.68e-05 | 7.36e-05 | NA | NA |
5. P | A6TB39 | Carboxy-S-adenosyl-L-methionine synthase | 1.59e-04 | 3.82e-04 | NA | NA |
5. P | Q730F9 | Uncharacterized methyltransferase BCE_4457 | 2.15e-07 | 8.92e-03 | NA | NA |
5. P | B4T803 | Carboxy-S-adenosyl-L-methionine synthase | 1.68e-04 | 6.44e-04 | NA | NA |
5. P | Q48EV8 | Carboxy-S-adenosyl-L-methionine synthase | 4.47e-05 | 2.33e-02 | NA | NA |
5. P | B0JUK5 | tRNA (guanine-N(7)-)-methyltransferase | 1.61e-05 | 4.85e-04 | NA | NA |
5. P | O66128 | Demethylmenaquinone methyltransferase | 5.52e-05 | 1.70e-05 | NA | NA |
5. P | B9J1A0 | tRNA (guanine-N(7)-)-methyltransferase | 1.75e-06 | 8.26e-07 | NA | NA |
5. P | A1RAI8 | tRNA (guanine-N(7)-)-methyltransferase | 3.02e-05 | 1.33e-02 | NA | NA |
5. P | B2IAI0 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.10e-07 | 2.10e-02 | NA | NA |
5. P | A0L3L9 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.04e-04 | 1.92e-05 | NA | NA |
5. P | B5YR15 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | A1AXP6 | tRNA (guanine-N(7)-)-methyltransferase | 2.79e-07 | 5.21e-03 | NA | NA |
5. P | C5A009 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.30e-05 | 5.09e-04 | NA | NA |
5. P | Q9VZD2 | Probable RNA methyltransferase CG11342 | 6.06e-07 | 1.93e-02 | NA | NA |
5. P | P9WLY6 | Uncharacterized protein MT1449 | 1.94e-07 | 6.62e-03 | NA | NA |
5. P | Q6F1P8 | tRNA (guanine-N(7)-)-methyltransferase | 1.35e-06 | 1.13e-06 | NA | NA |
5. P | Q71Y84 | Demethylmenaquinone methyltransferase | 2.18e-05 | 1.07e-04 | NA | NA |
5. P | P95748 | dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase | 3.53e-04 | 2.49e-03 | NA | NA |
5. P | P76290 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 1.10e-03 | NA | NA |
5. P | B9JSD2 | Ribosomal RNA large subunit methyltransferase E | 2.51e-03 | 3.30e-03 | NA | NA |
5. P | B6HJU2 | Glandicoline B O-methyltransferase roqN | 2.99e-06 | 1.04e-03 | NA | NA |
5. P | A6U2L4 | tRNA (guanine-N(7)-)-methyltransferase | 1.25e-06 | 9.84e-07 | NA | NA |
5. P | Q87DI1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.60e-05 | 1.95e-03 | NA | NA |
5. P | Q5HMV4 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 1.22e-02 | NA | NA |
5. P | Q68W57 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.36e-05 | 6.89e-06 | NA | NA |
5. P | Q9Z439 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.03e-05 | 1.02e-03 | NA | NA |
5. P | A8Z4H5 | tRNA (guanine-N(7)-)-methyltransferase | 1.13e-06 | 9.73e-07 | NA | NA |
5. P | B1LM21 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.59e-05 | 5.09e-04 | NA | NA |
5. P | Q13EN8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 9.95e-06 | 1.02e-02 | NA | NA |
5. P | Q49YH9 | tRNA (guanine-N(7)-)-methyltransferase | 8.24e-07 | 3.74e-06 | NA | NA |
5. P | A8EZP4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.15e-05 | 1.17e-05 | NA | NA |
5. P | A0A0J9UBD6 | Secondary metabolism regulator laeA | 3.93e-04 | 1.47e-04 | NA | NA |
5. P | Q14749 | Glycine N-methyltransferase | 1.76e-03 | 8.15e-04 | NA | NA |
5. P | Q7MVR7 | Demethylmenaquinone methyltransferase | 1.38e-05 | 3.37e-05 | NA | NA |
5. P | A4WBM7 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.35e-03 | NA | NA |
5. P | Q3A6I7 | tRNA (guanine-N(7)-)-methyltransferase | 1.17e-06 | 3.13e-04 | NA | NA |
5. P | B7GIU6 | Uncharacterized methyltransferase Aflv_0758 | 2.07e-07 | 4.38e-02 | NA | NA |
5. P | Q2L2T5 | Ubiquinone biosynthesis O-methyltransferase | 1.10e-10 | 2.93e-02 | NA | NA |
5. P | Q9X3X2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.93e-05 | 2.36e-05 | NA | NA |
5. P | Q8Z5M9 | Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 1.21e-11 | 3.65e-05 | NA | NA |
5. P | O86169 | Demethylmenaquinone methyltransferase | 2.36e-05 | 1.65e-05 | NA | NA |
5. P | B5E261 | tRNA (guanine-N(7)-)-methyltransferase | 1.61e-06 | 3.94e-06 | NA | NA |
5. P | Q2NSL7 | Ubiquinone biosynthesis O-methyltransferase | 1.60e-10 | 4.88e-02 | NA | NA |
5. P | A9MY97 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.93e-05 | 1.68e-04 | NA | NA |
5. P | A2SSW7 | Ribosomal RNA large subunit methyltransferase E | 3.67e-07 | 9.64e-04 | NA | NA |
5. P | A0A411KUP5 | Methyltransferase ucsB | 3.27e-08 | 9.12e-07 | NA | NA |
5. P | Q3B172 | Malonyl-[acyl-carrier protein] O-methyltransferase | 6.76e-07 | 5.74e-05 | NA | NA |
5. P | Q7V350 | tRNA (guanine-N(7)-)-methyltransferase | 1.12e-07 | 2.19e-04 | NA | NA |
5. P | A0RJT7 | tRNA (guanine-N(7)-)-methyltransferase | 9.46e-07 | 5.15e-07 | NA | NA |
5. P | P73161 | tRNA (guanine-N(7)-)-methyltransferase | 6.19e-08 | 2.55e-06 | NA | NA |
5. P | Q1D096 | tRNA (guanine-N(7)-)-methyltransferase | 5.29e-09 | 6.98e-03 | NA | NA |
5. P | Q58523 | Uncharacterized protein MJ1123 | 1.27e-08 | 2.60e-02 | NA | NA |
5. P | O25150 | Carboxy-S-adenosyl-L-methionine synthase | 4.03e-04 | 2.49e-03 | NA | NA |
5. P | B9E7G7 | tRNA (guanine-N(7)-)-methyltransferase | 9.75e-07 | 1.17e-05 | NA | NA |
5. P | Q72Z28 | tRNA (guanine-N(7)-)-methyltransferase | 1.69e-06 | 8.26e-07 | NA | NA |
5. P | P0C8L4 | Uncharacterized protein At4g26485 | 4.02e-07 | 1.57e-04 | NA | NA |
5. P | A8MIM4 | tRNA (guanine-N(7)-)-methyltransferase | 1.06e-06 | 8.26e-08 | NA | NA |
5. P | B9L9I3 | Carboxy-S-adenosyl-L-methionine synthase | 1.54e-05 | 1.68e-05 | NA | NA |
5. P | E4QJB8 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.59e-07 | 1.38e-02 | NA | NA |
5. P | Q81ZZ8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.65e-05 | 1.02e-05 | NA | NA |
5. P | B5ENR5 | Ribosomal RNA large subunit methyltransferase E | 1.52e-04 | 1.68e-03 | NA | NA |
5. P | Q7MUB2 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.05e-04 | 1.48e-04 | NA | NA |
5. P | B7NFD6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 5.09e-04 | NA | NA |
5. P | Q9PJW4 | Demethylmenaquinone methyltransferase | 7.20e-09 | 1.73e-03 | NA | NA |
5. P | B1XHD8 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 1.10e-03 | NA | NA |
5. P | A5UVB2 | Demethylmenaquinone methyltransferase | 1.28e-04 | 4.89e-05 | NA | NA |
5. P | B2IA21 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 1.95e-03 | NA | NA |
5. P | I1RAW4 | Secondary metabolism regulator laeA | 4.94e-04 | 7.49e-04 | NA | NA |
5. P | C4ZQF4 | Carboxy-S-adenosyl-L-methionine synthase | 1.54e-04 | 1.10e-03 | NA | NA |
5. P | Q87F66 | Ribosomal RNA large subunit methyltransferase E | 2.78e-06 | 3.77e-02 | NA | NA |
5. P | B2SFA2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.19e-05 | 1.47e-02 | NA | NA |
5. P | Q609U9 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.12e-05 | 3.13e-04 | NA | NA |
5. P | O27801 | Ribosomal RNA large subunit methyltransferase E | 1.40e-04 | 2.98e-05 | NA | NA |
5. P | O94480 | 25S rRNA (uridine-N(3))-methyltransferase | 4.04e-04 | 7.51e-05 | NA | NA |
5. P | A3PFL1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 9.73e-04 | NA | NA |
5. P | Q8UIH5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.12e-05 | 8.03e-03 | NA | NA |
5. P | Q57836 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 3.76e-10 | 3.26e-02 | NA | NA |
5. P | O74386 | Uncharacterized methyltransferase C3H7.11 | 1.95e-06 | 3.75e-04 | NA | NA |
5. P | A4T3V1 | Uncharacterized methyltransferase Mflv_0427 | 3.65e-04 | 2.00e-02 | NA | NA |
5. P | B1KR07 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.76e-05 | 8.17e-03 | NA | NA |
5. P | B1J0L8 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | Q253I8 | Demethylmenaquinone methyltransferase | 6.51e-09 | 9.41e-03 | NA | NA |
5. P | P67062 | Demethylmenaquinone methyltransferase | 5.45e-05 | 6.27e-06 | NA | NA |
5. P | B4S0J8 | Carboxy-S-adenosyl-L-methionine synthase | 4.25e-05 | 2.55e-04 | NA | NA |
5. P | A6UCF6 | Ubiquinone biosynthesis O-methyltransferase | 2.01e-07 | 1.60e-02 | NA | NA |
5. P | A4TR39 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 1.27e-04 | NA | NA |
5. P | A9MUB4 | Carboxy-S-adenosyl-L-methionine synthase | 1.71e-04 | 4.45e-04 | NA | NA |
5. P | P67501 | tRNA (guanine-N(7)-)-methyltransferase | 1.03e-06 | 1.75e-06 | NA | NA |
5. P | Q6ANL3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 4.81e-05 | 2.21e-02 | NA | NA |
5. P | Q30T90 | Carboxy-S-adenosyl-L-methionine synthase | 2.52e-05 | 7.73e-06 | NA | NA |
5. P | A7Z627 | Demethylmenaquinone methyltransferase | 1.93e-05 | 1.31e-04 | NA | NA |
5. P | P9WLY7 | Uncharacterized protein Rv1405c | 1.91e-07 | 6.62e-03 | NA | NA |
5. P | Q6GFV3 | tRNA (guanine-N(7)-)-methyltransferase | 1.02e-06 | 1.60e-06 | NA | NA |
5. P | Q9HPN4 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 8.58e-10 | 2.90e-02 | NA | NA |
5. P | Q09522 | Probable dimethyladenosine transferase | 1.42e-04 | 1.96e-02 | NA | NA |
5. P | B0TZP1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.77e-05 | 2.17e-02 | NA | NA |
5. P | B6J676 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.28e-05 | 1.66e-05 | NA | NA |
5. P | A7XRZ1 | Probable methyltransferase tdiE | 1.95e-04 | 3.58e-03 | NA | NA |
5. P | Q55214 | Aklanonic acid methyltransferase DauC | 8.20e-08 | 2.21e-04 | NA | NA |
5. P | Q1RJY5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.70e-05 | 6.89e-06 | NA | NA |
5. P | C3K8U4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.62e-05 | 2.93e-03 | NA | NA |
5. P | Q7W0H1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 2.27e-02 | NA | NA |
5. P | P67063 | Demethylmenaquinone methyltransferase | 4.63e-05 | 6.27e-06 | NA | NA |
5. P | Q48PJ4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.99e-05 | 5.75e-04 | NA | NA |
5. P | Q491V7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.77e-05 | 2.21e-04 | NA | NA |
5. P | A3PSZ4 | Uncharacterized methyltransferase Mjls_0208 | 3.06e-04 | 1.83e-02 | NA | NA |
5. P | C3LA04 | tRNA (guanine-N(7)-)-methyltransferase | 1.82e-06 | 8.26e-07 | NA | NA |
5. P | C5C0T0 | Demethylmenaquinone methyltransferase | 3.15e-04 | 2.99e-06 | NA | NA |
5. P | Q983F8 | Ribosomal RNA large subunit methyltransferase E | 1.40e-03 | 7.29e-03 | NA | NA |
5. P | B3PQL4 | Ribosomal RNA large subunit methyltransferase E | 3.71e-04 | 1.18e-02 | NA | NA |
5. P | B5RLD9 | Ribosomal RNA large subunit methyltransferase E | 8.75e-07 | 2.66e-06 | NA | NA |
5. P | P75256 | tRNA (guanine-N(7)-)-methyltransferase | 3.10e-06 | 2.62e-07 | NA | NA |
5. P | Q3SM81 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.13e-05 | 2.65e-04 | NA | NA |
5. P | Q9JXI7 | Ubiquinone biosynthesis O-methyltransferase | 5.26e-09 | 2.08e-02 | NA | NA |
5. P | A0Q2J7 | tRNA (guanine-N(7)-)-methyltransferase | 1.21e-06 | 1.26e-05 | NA | NA |
5. P | Q6MBP0 | tRNA (guanine-N(7)-)-methyltransferase | 1.06e-08 | 4.64e-02 | NA | NA |
5. P | Q87QV4 | Carboxy-S-adenosyl-L-methionine synthase | 1.97e-04 | 3.98e-03 | NA | NA |
5. P | Q92GT5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.61e-05 | 3.61e-05 | NA | NA |
5. P | Q8P558 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.87e-05 | 7.04e-03 | NA | NA |
5. P | Q1QS47 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.01e-05 | 1.71e-03 | NA | NA |
5. P | C3L5Y1 | Uncharacterized methyltransferase BAMEG_4640 | 2.26e-07 | 1.36e-02 | NA | NA |
5. P | Q4K6X7 | Carboxy-S-adenosyl-L-methionine synthase | 5.12e-04 | 1.38e-02 | NA | NA |
5. P | Q897E6 | tRNA (guanine-N(7)-)-methyltransferase | 8.57e-07 | 6.40e-05 | NA | NA |
5. P | Q9K623 | Malonyl-[acyl-carrier protein] O-methyltransferase | 3.81e-05 | 2.12e-02 | NA | NA |
5. P | Q9UT94 | eRF1 methyltransferase catalytic subunit mtq2 | 1.80e-11 | 7.72e-17 | NA | NA |
5. P | A2BP39 | tRNA (guanine-N(7)-)-methyltransferase | 7.57e-08 | 2.71e-04 | NA | NA |
5. P | Q6KHE8 | tRNA (guanine-N(7)-)-methyltransferase | 1.12e-06 | 1.07e-06 | NA | NA |
5. P | Q82HD9 | Trans-aconitate 2-methyltransferase | 2.79e-07 | 3.12e-03 | NA | NA |
5. P | Q632Z1 | tRNA (guanine-N(7)-)-methyltransferase | 1.73e-06 | 8.26e-07 | NA | NA |
5. P | Q8CWG0 | Demethylmenaquinone methyltransferase | 2.10e-05 | 5.02e-06 | NA | NA |
5. P | Q7MVS9 | tRNA (guanine-N(7)-)-methyltransferase | 6.28e-05 | 1.57e-04 | NA | NA |
5. P | Q0IDB0 | tRNA (guanine-N(7)-)-methyltransferase | 7.95e-06 | 5.95e-03 | NA | NA |
5. P | Q8XCH6 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | Q6HDF0 | Uncharacterized methyltransferase BT9727_4108 | 2.10e-07 | 1.50e-02 | NA | NA |
5. P | A4WFY5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.17e-05 | 2.68e-04 | NA | NA |
5. P | B4EWC9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.42e-05 | 5.44e-04 | NA | NA |
5. P | A4XPM7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.63e-05 | 2.51e-03 | NA | NA |
5. P | Q1CNB4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.67e-05 | 1.27e-04 | NA | NA |
5. P | Q729T9 | Ribosomal RNA large subunit methyltransferase E | 7.66e-04 | 7.24e-07 | NA | NA |
5. P | A7GAQ4 | tRNA (guanine-N(7)-)-methyltransferase | 1.81e-06 | 3.70e-06 | NA | NA |
5. P | Q8FGQ6 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | B1YKZ4 | Uncharacterized methyltransferase Exig_2346 | 2.23e-07 | 3.43e-02 | NA | NA |
5. P | B9KG20 | Carboxy-S-adenosyl-L-methionine synthase | 1.60e-04 | 1.15e-06 | NA | NA |
5. P | Q38XZ3 | tRNA (guanine-N(7)-)-methyltransferase | 1.06e-06 | 1.16e-04 | NA | NA |
5. P | B5ZB79 | tRNA (guanine-N(7)-)-methyltransferase | 5.33e-06 | 4.38e-06 | NA | NA |
5. P | A4SGV9 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.90e-05 | 4.09e-03 | NA | NA |
5. P | Q3SK91 | Ubiquinone biosynthesis O-methyltransferase | 8.06e-11 | 4.84e-02 | NA | NA |
5. P | B8DBZ5 | Demethylmenaquinone methyltransferase | 2.25e-05 | 1.24e-04 | NA | NA |
5. P | Q05632 | Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 7.93e-12 | 2.04e-03 | NA | NA |
5. P | Q03920 | eRF1 methyltransferase catalytic subunit MTQ2 | 1.57e-11 | 1.07e-16 | NA | NA |
5. P | D2T333 | Malonyl-[acyl-carrier protein] O-methyltransferase | 5.47e-04 | 1.91e-02 | NA | NA |
5. P | Q8CSH9 | Demethylmenaquinone methyltransferase | 3.09e-05 | 5.14e-05 | NA | NA |
5. P | Q1IDA6 | Ubiquinone biosynthesis O-methyltransferase | 5.81e-11 | 1.38e-02 | NA | NA |
5. P | P0DG19 | tRNA (guanine-N(7)-)-methyltransferase | 8.54e-07 | 1.31e-05 | NA | NA |
5. P | A7H3U1 | Carboxy-S-adenosyl-L-methionine synthase | 2.80e-04 | 1.47e-04 | NA | NA |
5. P | Q117P8 | tRNA (guanine-N(7)-)-methyltransferase | 4.94e-06 | 7.49e-04 | NA | NA |
5. P | A5CX75 | Ribosomal RNA large subunit methyltransferase E | 1.82e-04 | 7.36e-03 | NA | NA |
5. P | Q7Q2P7 | tRNA (guanine-N(7)-)-methyltransferase | 3.31e-07 | 2.10e-04 | NA | NA |
5. P | P0A887 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 5.09e-04 | NA | NA |
5. P | Q5N2X5 | tRNA (guanine-N(7)-)-methyltransferase | 6.93e-06 | 7.75e-03 | NA | NA |
5. P | Q29555 | Glycine N-methyltransferase (Fragment) | 5.79e-04 | 4.76e-02 | NA | NA |
5. P | A0AK43 | Demethylmenaquinone methyltransferase | 1.84e-05 | 6.86e-05 | NA | NA |
5. P | Q4A7Q7 | tRNA (guanine-N(7)-)-methyltransferase | 1.30e-06 | 9.84e-07 | NA | NA |
5. P | Q8GXB7 | tRNA (guanine-N(7)-)-methyltransferase | 2.56e-07 | 2.64e-02 | NA | NA |
5. P | Q3JVZ6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 3.45e-03 | NA | NA |
5. P | Q037Y3 | tRNA (guanine-N(7)-)-methyltransferase | 7.98e-07 | 5.82e-07 | NA | NA |
5. P | Q65I24 | Demethylmenaquinone methyltransferase | 3.92e-05 | 5.04e-05 | NA | NA |
5. P | A3NRJ4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.72e-05 | 3.45e-03 | NA | NA |
5. P | B0KM36 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.58e-05 | 6.57e-04 | NA | NA |
5. P | Q088H8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.60e-05 | 1.01e-02 | NA | NA |
5. P | A5II90 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.79e-05 | 8.49e-06 | NA | NA |
5. P | B6JMQ6 | Carboxy-S-adenosyl-L-methionine synthase | 3.65e-04 | 1.48e-03 | NA | NA |
5. P | B0R506 | Probable ribosomal RNA small subunit methyltransferase A | 3.57e-04 | 1.95e-02 | NA | NA |
5. P | A5HZ44 | tRNA (guanine-N(7)-)-methyltransferase | 2.33e-06 | 3.70e-06 | NA | NA |
5. P | P67065 | Demethylmenaquinone methyltransferase | 4.08e-05 | 4.94e-05 | NA | NA |
5. P | B9DVC2 | tRNA (guanine-N(7)-)-methyltransferase | 8.05e-07 | 1.88e-05 | NA | NA |
5. P | A6V2Q4 | Ubiquinone biosynthesis O-methyltransferase | 6.08e-11 | 1.85e-02 | NA | NA |
5. P | Q5RFI3 | RNA 5'-monophosphate methyltransferase | 3.13e-04 | 3.13e-02 | NA | NA |
5. P | Q8EDK8 | Malonyl-[acyl-carrier protein] O-methyltransferase | 9.98e-06 | 1.29e-03 | NA | NA |
5. P | Q0IEN3 | tRNA (guanine-N(7)-)-methyltransferase | 4.95e-07 | 1.08e-02 | NA | NA |
5. P | A6QH20 | Demethylmenaquinone methyltransferase | 3.29e-05 | 6.27e-06 | NA | NA |
5. P | B1HXA1 | tRNA (guanine-N(7)-)-methyltransferase | 1.18e-06 | 5.04e-07 | NA | NA |
5. P | Q89AK7 | Malonyl-[acyl-carrier protein] O-methyltransferase | 4.46e-04 | 2.88e-02 | NA | NA |
5. P | A7MEB1 | Carboxy-S-adenosyl-L-methionine synthase | 1.53e-04 | 1.19e-04 | NA | NA |
5. P | A7I232 | Carboxy-S-adenosyl-L-methionine synthase | 1.44e-04 | 1.83e-03 | NA | NA |
5. P | A2CCG0 | tRNA (guanine-N(7)-)-methyltransferase | 1.62e-05 | 1.26e-02 | NA | NA |
5. P | Q2NE42 | Probable ribosomal RNA small subunit methyltransferase A | 6.69e-05 | 3.27e-03 | NA | NA |
5. P | Q63XA0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.75e-05 | 3.45e-03 | NA | NA |
5. P | Q5M332 | tRNA (guanine-N(7)-)-methyltransferase | 9.42e-07 | 6.71e-07 | NA | NA |
5. P | A4T183 | Demethylmenaquinone methyltransferase | 1.14e-04 | 1.70e-02 | NA | NA |
5. P | Q39R75 | tRNA (guanine-N(7)-)-methyltransferase | 2.62e-06 | 1.03e-05 | NA | NA |
5. P | A8AFH1 | Carboxy-S-adenosyl-L-methionine synthase | 1.79e-04 | 5.97e-04 | NA | NA |
5. P | Q7MJ72 | Carboxy-S-adenosyl-L-methionine synthase | 2.11e-04 | 1.36e-02 | NA | NA |
5. P | Q5WE98 | tRNA (guanine-N(7)-)-methyltransferase | 8.97e-07 | 3.86e-06 | NA | NA |
5. P | C1ESS0 | Uncharacterized methyltransferase BCA_4487 | 2.25e-07 | 1.36e-02 | NA | NA |
5. P | B1IEK9 | tRNA (guanine-N(7)-)-methyltransferase | 2.59e-06 | 6.01e-06 | NA | NA |
5. P | A4VXH8 | tRNA (guanine-N(7)-)-methyltransferase | 1.14e-06 | 9.04e-06 | NA | NA |
5. P | A1SAJ8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.92e-05 | 3.81e-03 | NA | NA |
5. P | Q5HVI0 | Carboxy-S-adenosyl-L-methionine synthase | 1.82e-04 | 8.29e-05 | NA | NA |
5. P | Q6G8H9 | tRNA (guanine-N(7)-)-methyltransferase | 1.06e-06 | 8.35e-07 | NA | NA |
5. P | A8FKB3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.76e-08 | 6.95e-04 | NA | NA |
5. P | E3G327 | Malonyl-[acyl-carrier protein] O-methyltransferase | 4.05e-04 | 1.01e-02 | NA | NA |
5. P | Q8XNB4 | tRNA (guanine-N(7)-)-methyltransferase | 1.55e-06 | 7.57e-07 | NA | NA |
5. P | A4QBE5 | Demethylmenaquinone methyltransferase | 2.32e-04 | 7.08e-04 | NA | NA |
5. P | B1YWF9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.73e-05 | 3.64e-04 | NA | NA |
5. P | Q9HQH1 | Probable ribosomal RNA small subunit methyltransferase A | 6.65e-06 | 1.95e-02 | NA | NA |
5. P | C0M8F7 | tRNA (guanine-N(7)-)-methyltransferase | 8.98e-07 | 1.57e-06 | NA | NA |
5. P | Q8Y6R8 | tRNA (guanine-N(7)-)-methyltransferase | 1.07e-06 | 6.78e-07 | NA | NA |
5. P | Q5QYG2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.75e-05 | 9.43e-05 | NA | NA |
5. P | Q551M3 | tRNA (guanine-N(7)-)-methyltransferase | 2.00e-05 | 1.29e-02 | NA | NA |
5. P | Q11E01 | Ubiquinone biosynthesis O-methyltransferase | 3.18e-07 | 2.93e-02 | NA | NA |
5. P | Q0TU06 | tRNA (guanine-N(7)-)-methyltransferase | 1.51e-06 | 2.41e-06 | NA | NA |
5. P | Q3M3Q5 | tRNA (guanine-N(7)-)-methyltransferase | 2.47e-08 | 5.97e-04 | NA | NA |
5. P | A4IXH9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.11e-05 | 2.25e-02 | NA | NA |
5. P | Q145P0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.74e-05 | 6.82e-04 | NA | NA |
5. P | A2BUM1 | tRNA (guanine-N(7)-)-methyltransferase | 4.25e-08 | 3.05e-06 | NA | NA |
5. P | Q7VRJ1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.28e-05 | 7.70e-04 | NA | NA |
5. P | B1AIQ8 | tRNA (guanine-N(7)-)-methyltransferase | 3.52e-06 | 3.57e-07 | NA | NA |
5. P | Q62MP4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.86e-05 | 3.45e-03 | NA | NA |
5. P | A1AXI6 | Carboxy-S-adenosyl-L-methionine synthase | 2.48e-04 | 1.68e-02 | NA | NA |
5. P | Q8DGE4 | 2-phytyl-1,4-naphtoquinone methyltransferase | 4.83e-05 | 6.14e-06 | NA | NA |
5. P | B2UFG8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.86e-05 | 7.82e-03 | NA | NA |
5. P | A1WVM4 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.59e-07 | 1.02e-02 | NA | NA |
5. P | Q17YM3 | Carboxy-S-adenosyl-L-methionine synthase | 3.97e-04 | 2.51e-04 | NA | NA |
5. P | C1CCT3 | tRNA (guanine-N(7)-)-methyltransferase | 1.25e-06 | 1.88e-06 | NA | NA |
5. P | A4IR67 | Uncharacterized methyltransferase GTNG_2476 | 1.24e-07 | 4.16e-02 | NA | NA |
5. P | Q04W54 | tRNA (guanine-N(7)-)-methyltransferase | 2.07e-06 | 1.11e-08 | NA | NA |
5. P | B5FCP8 | Carboxy-S-adenosyl-L-methionine synthase | 3.87e-05 | 1.39e-02 | NA | NA |
5. P | Q9I5G3 | Carboxy-S-adenosyl-L-methionine synthase | 5.52e-04 | 4.92e-02 | NA | NA |
5. P | P0A2K5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.08e-05 | 1.68e-04 | NA | NA |
5. P | Q6MU75 | tRNA (guanine-N(7)-)-methyltransferase | 1.82e-06 | 1.63e-08 | NA | NA |
5. P | A5GIJ2 | tRNA (guanine-N(7)-)-methyltransferase | 1.61e-05 | 1.37e-02 | NA | NA |
5. P | A1JIF2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.55e-05 | 1.45e-04 | NA | NA |
5. P | Q9Z120 | tRNA (guanine-N(7)-)-methyltransferase | 2.70e-07 | 2.88e-03 | NA | NA |
5. P | Q6HL42 | Demethylmenaquinone methyltransferase | 1.69e-05 | 1.50e-04 | NA | NA |
5. P | Q1JFF9 | tRNA (guanine-N(7)-)-methyltransferase | 8.35e-07 | 1.31e-05 | NA | NA |
5. P | A8LNK7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.65e-05 | 1.21e-03 | NA | NA |
5. P | B7JGZ8 | Demethylmenaquinone methyltransferase | 1.72e-05 | 1.50e-04 | NA | NA |
5. P | Q4WQY5 | Methyltransferase tpcM | 2.17e-04 | 9.57e-03 | NA | NA |
5. P | Q8EP25 | tRNA (guanine-N(7)-)-methyltransferase | 1.47e-06 | 1.43e-05 | NA | NA |
5. P | B8G1D7 | tRNA (guanine-N(7)-)-methyltransferase | 4.77e-07 | 5.94e-07 | NA | NA |
5. P | Q81SW0 | Demethylmenaquinone methyltransferase | 1.72e-05 | 1.50e-04 | NA | NA |
5. P | Q8PPP2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.08e-05 | 7.75e-03 | NA | NA |
5. P | B7USP7 | Carboxy-S-adenosyl-L-methionine synthase | 1.52e-04 | 1.36e-03 | NA | NA |
5. P | A7ZMZ5 | Carboxy-S-adenosyl-L-methionine synthase | 1.75e-04 | 1.27e-03 | NA | NA |
5. P | Q5PAN0 | Ribosomal RNA large subunit methyltransferase E | 1.13e-04 | 3.45e-03 | NA | NA |
5. P | Q8E9R7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 5.02e-03 | NA | NA |
5. P | Q3A209 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.85e-06 | 4.02e-06 | NA | NA |
5. P | Q2NHD6 | Ribosomal RNA large subunit methyltransferase E | 8.67e-07 | 4.43e-03 | NA | NA |
5. P | Q049E6 | tRNA (guanine-N(7)-)-methyltransferase | 6.14e-07 | 6.21e-08 | NA | NA |
5. P | Q9QXF8 | Glycine N-methyltransferase | 1.51e-03 | 3.45e-03 | NA | NA |
5. P | Q212R3 | Ribosomal RNA large subunit methyltransferase E | 6.49e-06 | 3.93e-02 | NA | NA |
5. P | Q73HZ4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.25e-05 | 4.87e-06 | NA | NA |
5. P | Q9HUC0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.26e-05 | 3.16e-04 | NA | NA |
5. P | Q88MX7 | Carboxy-S-adenosyl-L-methionine synthase | 4.87e-04 | 1.13e-03 | NA | NA |
5. P | Q2IYG1 | Ribosomal RNA small subunit methyltransferase J | 1.15e-05 | 5.49e-09 | NA | NA |
5. P | A4G5P1 | Malonyl-[acyl-carrier protein] O-methyltransferase | 5.38e-08 | 1.17e-04 | NA | NA |
5. P | A2RCZ6 | tRNA (guanine-N(7)-)-methyltransferase | 8.33e-07 | 1.31e-05 | NA | NA |
5. P | Q1LRG9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.81e-05 | 9.12e-04 | NA | NA |
5. P | Q39D13 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 2.13e-04 | NA | NA |
5. P | A1BAN1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.94e-05 | 7.96e-03 | NA | NA |
5. P | Q98R44 | tRNA (guanine-N(7)-)-methyltransferase | 1.19e-06 | 1.07e-07 | NA | NA |
5. P | Q2SBD7 | Malonyl-[acyl-carrier protein] O-methyltransferase | 4.97e-08 | 3.61e-03 | NA | NA |
5. P | P40493 | 25S rRNA (uridine(2634)-N(3))-methyltransferase | 1.18e-02 | 7.35e-04 | NA | NA |
5. P | Q71Z52 | tRNA (guanine-N(7)-)-methyltransferase | 9.18e-07 | 1.88e-06 | NA | NA |
5. P | A8GPI0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 5.29e-05 | 2.72e-05 | NA | NA |
5. P | A6TMJ6 | tRNA (guanine-N(7)-)-methyltransferase | 1.46e-06 | 7.56e-04 | NA | NA |
5. P | Q2KHT8 | Probable dimethyladenosine transferase | 1.30e-04 | 4.38e-02 | NA | NA |
5. P | B2SX35 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.77e-05 | 7.49e-04 | NA | NA |
5. P | P75967 | Uncharacterized protein YmfD | 1.26e-07 | 1.83e-02 | NA | NA |
5. P | P9WK03 | Uncharacterized methyltransferase Rv0089 | 7.02e-05 | 2.06e-03 | NA | NA |
5. P | Q6AIL1 | Carboxy-S-adenosyl-L-methionine synthase | 7.97e-05 | 9.64e-04 | NA | NA |
5. P | Q8NW26 | tRNA (guanine-N(7)-)-methyltransferase | 1.09e-06 | 8.35e-07 | NA | NA |
5. P | A3DBL4 | tRNA (guanine-N(7)-)-methyltransferase | 1.91e-06 | 2.41e-06 | NA | NA |
5. P | B5EZU8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.03e-05 | 1.68e-04 | NA | NA |
5. P | Q4A6T7 | tRNA (guanine-N(7)-)-methyltransferase | 1.78e-06 | 2.46e-06 | NA | NA |
5. P | O51293 | Ribosomal RNA large subunit methyltransferase E | 8.30e-07 | 2.17e-04 | NA | NA |
5. P | A0L1M4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.59e-05 | 4.32e-03 | NA | NA |
5. P | B9IVN5 | Demethylmenaquinone methyltransferase | 1.71e-05 | 1.50e-04 | NA | NA |
5. P | Q2J2H9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.40e-05 | 4.34e-02 | NA | NA |
5. P | P72818 | 2-phytyl-1,4-naphtoquinone methyltransferase | 5.88e-05 | 7.49e-03 | NA | NA |
5. P | A8NFF0 | tRNA (guanine-N(7)-)-methyltransferase | 3.13e-07 | 3.29e-02 | NA | NA |
5. P | Q6N453 | Ribosomal RNA small subunit methyltransferase J | 7.51e-06 | 9.71e-05 | NA | NA |
5. P | C1C5S3 | tRNA (guanine-N(7)-)-methyltransferase | 1.57e-06 | 3.94e-06 | NA | NA |
5. P | Q32A11 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.23e-05 | 5.09e-04 | NA | NA |
5. P | Q0TAM1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.25e-05 | 4.76e-04 | NA | NA |
5. P | P59717 | tRNA (guanine-N(7)-)-methyltransferase | 1.07e-06 | 8.08e-07 | NA | NA |
5. P | B7MBS9 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | B1JP75 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.77e-05 | 1.27e-04 | NA | NA |
5. P | Q9WZL2 | Demethylmenaquinone methyltransferase | 6.95e-05 | 3.45e-03 | NA | NA |
5. P | B0BUT9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.16e-05 | 5.62e-05 | NA | NA |
5. P | Q5HWE7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.75e-08 | 8.78e-04 | NA | NA |
5. P | Q1I3T0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.39e-05 | 9.73e-04 | NA | NA |
5. P | Q5E6A3 | Carboxy-S-adenosyl-L-methionine synthase | 3.92e-05 | 1.52e-02 | NA | NA |
5. P | Q7U4Z8 | Glycine/sarcosine N-methyltransferase | 2.71e-03 | 8.07e-04 | NA | NA |
5. P | B3WF63 | tRNA (guanine-N(7)-)-methyltransferase | 7.88e-07 | 5.82e-07 | NA | NA |
5. P | Q2NYW4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.38e-05 | 7.23e-03 | NA | NA |
5. P | Q0KEH6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.72e-05 | 5.54e-03 | NA | NA |
5. P | Q6MCB5 | Demethylmenaquinone methyltransferase | 7.82e-05 | 4.90e-04 | NA | NA |
5. P | Q04XB2 | tRNA (guanine-N(7)-)-methyltransferase | 2.21e-06 | 1.11e-08 | NA | NA |
5. P | Q81LL3 | Uncharacterized methyltransferase BA_4603/GBAA_4603/BAS4271 | 2.45e-07 | 1.36e-02 | NA | NA |
5. P | B1KIW4 | tRNA (guanine-N(7)-)-methyltransferase | 5.03e-06 | 2.47e-02 | NA | NA |
5. P | Q1BTN4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.88e-05 | 3.16e-04 | NA | NA |
5. P | A0QMC8 | Uncharacterized methyltransferase MAV_4945 | 3.23e-04 | 9.74e-03 | NA | NA |
5. P | Q21H69 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.50e-05 | 3.58e-04 | NA | NA |
5. P | Q1ML15 | Ribosomal RNA large subunit methyltransferase E | 3.96e-04 | 4.27e-02 | NA | NA |
5. P | A1S6P4 | Carboxy-S-adenosyl-L-methionine synthase | 2.59e-04 | 4.85e-03 | NA | NA |
5. P | B9DNV5 | Demethylmenaquinone methyltransferase | 5.80e-05 | 3.29e-06 | NA | NA |
5. P | Q030M2 | tRNA (guanine-N(7)-)-methyltransferase | 1.17e-06 | 3.99e-07 | NA | NA |
5. P | B4TYS8 | Carboxy-S-adenosyl-L-methionine synthase | 1.70e-04 | 6.44e-04 | NA | NA |
5. P | Q1D841 | Ribosomal RNA large subunit methyltransferase E | 1.58e-04 | 6.88e-04 | NA | NA |
5. P | A0Q549 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.09e-05 | 1.91e-02 | NA | NA |
5. P | A8G0S7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.40e-05 | 4.09e-03 | NA | NA |
5. P | O28490 | Putative protein N5-glutamine methyltransferase AF_1784 | 7.75e-14 | 2.65e-15 | NA | NA |
5. P | P78860 | rRNA methyltransferase 2, mitochondrial | 1.33e-04 | 1.98e-02 | NA | NA |
5. P | P9WFR3 | Demethylmenaquinone methyltransferase | 1.64e-04 | 1.11e-02 | NA | NA |
5. P | A4XSD1 | Carboxy-S-adenosyl-L-methionine synthase | 4.54e-05 | 1.64e-02 | NA | NA |
5. P | Q87XG6 | Carboxy-S-adenosyl-L-methionine synthase | 4.82e-05 | 5.00e-02 | NA | NA |
5. P | A6L3D5 | Demethylmenaquinone methyltransferase | 1.90e-05 | 1.42e-03 | NA | NA |
5. P | A9KLV5 | tRNA (guanine-N(7)-)-methyltransferase | 1.34e-06 | 9.73e-07 | NA | NA |
5. P | A3N5U8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.03e-05 | 3.45e-03 | NA | NA |
5. P | B7UNG3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.35e-05 | 5.09e-04 | NA | NA |
5. P | B7HL23 | Demethylmenaquinone methyltransferase | 1.73e-05 | 1.50e-04 | NA | NA |
5. P | Q3K307 | tRNA (guanine-N(7)-)-methyltransferase | 1.02e-06 | 1.46e-05 | NA | NA |
5. P | Q32H79 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | A9M0C4 | Ubiquinone biosynthesis O-methyltransferase | 3.92e-09 | 5.00e-02 | NA | NA |
5. P | B1YKF9 | tRNA (guanine-N(7)-)-methyltransferase | 9.93e-07 | 6.35e-08 | NA | NA |
5. P | Q4ZZG3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.66e-05 | 5.75e-04 | NA | NA |
5. P | Q21UL3 | Ubiquinone biosynthesis O-methyltransferase | 1.22e-10 | 7.04e-03 | NA | NA |
5. P | Q8DDP9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.53e-05 | 9.82e-04 | NA | NA |
5. P | Q31IM5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.74e-05 | 1.45e-03 | NA | NA |
5. P | B7H758 | tRNA (guanine-N(7)-)-methyltransferase | 1.68e-06 | 8.08e-07 | NA | NA |
5. P | Q5HP74 | Demethylmenaquinone methyltransferase | 4.13e-05 | 5.14e-05 | NA | NA |
5. P | Q5QZ53 | Ubiquinone biosynthesis O-methyltransferase | 1.36e-10 | 2.47e-02 | NA | NA |
5. P | A8A6U0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.86e-05 | 5.09e-04 | NA | NA |
5. P | Q6LT55 | Carboxy-S-adenosyl-L-methionine synthase | 1.93e-04 | 2.62e-02 | NA | NA |
5. P | Q97C13 | Ribosomal RNA large subunit methyltransferase E | 1.37e-03 | 1.76e-03 | NA | NA |
5. P | Q02HS7 | Carboxy-S-adenosyl-L-methionine synthase | 5.53e-04 | 4.92e-02 | NA | NA |
5. P | Q5KW28 | tRNA (guanine-N(7)-)-methyltransferase | 9.71e-07 | 1.71e-08 | NA | NA |
5. P | C1DCV3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 6.09e-05 | NA | NA |
5. P | C0R2Q3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.28e-05 | 3.32e-06 | NA | NA |
5. P | A9N8M5 | Ribosomal RNA large subunit methyltransferase E | 1.70e-03 | 1.98e-02 | NA | NA |
5. P | P0DG18 | tRNA (guanine-N(7)-)-methyltransferase | 7.86e-07 | 1.31e-05 | NA | NA |
5. P | A0KAF5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.78e-05 | 3.16e-04 | NA | NA |
5. P | A4YJH0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.11e-05 | 2.88e-03 | NA | NA |
5. P | Q8D382 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 4.50e-05 | 1.08e-05 | NA | NA |
5. P | B2GDC8 | tRNA (guanine-N(7)-)-methyltransferase | 6.09e-07 | 2.17e-06 | NA | NA |
5. P | Q634G9 | Uncharacterized methyltransferase BCE33L4119 | 2.25e-07 | 1.50e-02 | NA | NA |
5. P | Q6MHQ3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 6.36e-05 | 1.68e-05 | NA | NA |
5. P | A0PLV5 | Demethylmenaquinone methyltransferase | 3.08e-04 | 1.46e-03 | NA | NA |
5. P | A1T3S1 | Demethylmenaquinone methyltransferase | 2.38e-04 | 8.54e-03 | NA | NA |
5. P | Q5WGT4 | Demethylmenaquinone methyltransferase | 2.12e-05 | 1.92e-05 | NA | NA |
5. P | O94628 | Uncharacterized methyltransferase C1347.09 | 5.17e-08 | 2.67e-02 | NA | NA |
5. P | E3HCT1 | Malonyl-[acyl-carrier protein] O-methyltransferase 2 | 6.09e-04 | 5.12e-03 | NA | NA |
5. P | B8DHC7 | tRNA (guanine-N(7)-)-methyltransferase | 8.10e-07 | 1.04e-06 | NA | NA |
5. P | Q88D17 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.80e-05 | 5.54e-04 | NA | NA |
5. P | A1RP78 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.61e-05 | 4.39e-03 | NA | NA |
5. P | B3QEZ3 | Ribosomal RNA small subunit methyltransferase J | 1.11e-05 | 9.62e-05 | NA | NA |
5. P | D8MPW4 | Malonyl-[acyl-carrier protein] O-methyltransferase | 3.16e-07 | 1.35e-03 | NA | NA |
5. P | Q03WU9 | tRNA (guanine-N(7)-)-methyltransferase | 1.86e-06 | 3.07e-05 | NA | NA |
5. P | Q9PQM2 | tRNA (guanine-N(7)-)-methyltransferase | 3.75e-06 | 3.57e-07 | NA | NA |
5. P | B7V3F6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.86e-05 | 3.16e-04 | NA | NA |
5. P | Q98G87 | Ubiquinone biosynthesis O-methyltransferase | 2.13e-07 | 1.58e-02 | NA | NA |
5. P | Q23126 | tRNA (guanine-N(7)-)-methyltransferase | 2.27e-07 | 2.05e-02 | NA | NA |
5. P | A0PMY7 | Uncharacterized methyltransferase MUL_1123 | 3.25e-04 | 3.64e-03 | NA | NA |
5. P | Q0HZP7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.74e-05 | 4.32e-03 | NA | NA |
5. P | Q6SKR2 | Methyltransferase N6AMT1 | 4.33e-13 | 2.89e-13 | NA | NA |
5. P | Q255M7 | tRNA (guanine-N(7)-)-methyltransferase | 2.22e-06 | 1.83e-03 | NA | NA |
5. P | Q4UMW4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 4.52e-05 | 4.62e-06 | NA | NA |
5. P | Q2FXI2 | tRNA (guanine-N(7)-)-methyltransferase | 9.48e-07 | 9.73e-07 | NA | NA |
5. P | A1AC31 | Carboxy-S-adenosyl-L-methionine synthase | 1.60e-04 | 1.27e-03 | NA | NA |
5. P | Q74I98 | tRNA (guanine-N(7)-)-methyltransferase | 6.04e-07 | 1.38e-07 | NA | NA |
5. P | Q7N555 | Carboxy-S-adenosyl-L-methionine synthase | 1.57e-04 | 6.57e-04 | NA | NA |
5. P | A8EVV4 | Carboxy-S-adenosyl-L-methionine synthase | 1.48e-04 | 3.17e-05 | NA | NA |
5. P | C5BCA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.88e-05 | 1.31e-03 | NA | NA |
5. P | Q5N4X9 | 2-phytyl-1,4-naphtoquinone methyltransferase | 4.49e-08 | 1.67e-03 | NA | NA |
5. P | S0DQI7 | Secondary metabolism regulator LAE1 | 8.49e-06 | 6.28e-05 | NA | NA |
5. P | A3PUJ1 | Demethylmenaquinone methyltransferase | 1.11e-04 | 1.27e-03 | NA | NA |
5. P | B4RC42 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.44e-04 | 6.95e-04 | NA | NA |
5. P | D9SJ16 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.14e-04 | 3.30e-05 | NA | NA |
5. P | Q5HNG2 | tRNA (guanine-N(7)-)-methyltransferase | 1.04e-06 | 2.02e-07 | NA | NA |
5. P | B0TSA1 | Carboxy-S-adenosyl-L-methionine synthase | 3.45e-04 | 3.86e-02 | NA | NA |
5. P | Q12KQ0 | tRNA (guanine-N(7)-)-methyltransferase | 6.13e-06 | 5.59e-03 | NA | NA |
5. P | A1AI22 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.64e-05 | 4.76e-04 | NA | NA |
5. P | P59911 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.38e-05 | 5.65e-04 | NA | NA |
5. P | B2S3S1 | Ribosomal RNA large subunit methyltransferase E | 3.73e-05 | 9.74e-03 | NA | NA |
5. P | Q95KJ0 | Probable dimethyladenosine transferase | 1.17e-04 | 4.38e-02 | NA | NA |
5. P | B5Z863 | Carboxy-S-adenosyl-L-methionine synthase | 3.08e-04 | 5.81e-04 | NA | NA |
5. P | Q3A8E8 | Carboxy-S-adenosyl-L-methionine synthase | 2.70e-04 | 1.68e-04 | NA | NA |
5. P | Q9NRN9 | rRNA N6-adenosine-methyltransferase METTL5 | 9.99e-11 | 2.39e-09 | NA | NA |
5. P | A8ACY2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.70e-05 | 9.52e-05 | NA | NA |
5. P | C3MGQ4 | Ribosomal RNA large subunit methyltransferase E | 1.59e-03 | 2.76e-02 | NA | NA |
5. P | A8FSK8 | tRNA (guanine-N(7)-)-methyltransferase | 5.07e-06 | 2.56e-02 | NA | NA |
5. P | Q96ZL5 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 2.58e-11 | 2.73e-03 | NA | NA |
5. P | Q73AY2 | Demethylmenaquinone methyltransferase | 1.61e-05 | 3.90e-04 | NA | NA |
5. P | B8EA69 | Carboxy-S-adenosyl-L-methionine synthase | 3.71e-04 | 7.49e-03 | NA | NA |
5. P | Q0SMR8 | Ribosomal RNA small subunit methyltransferase A | 6.15e-05 | 1.85e-02 | NA | NA |
5. P | Q1MRQ0 | Ribosomal RNA large subunit methyltransferase E | 7.24e-04 | 3.09e-03 | NA | NA |
5. P | Q6MQU0 | tRNA (guanine-N(7)-)-methyltransferase | 2.70e-06 | 2.39e-06 | NA | NA |
5. P | Q83BY4 | Ribosomal RNA large subunit methyltransferase E | 2.27e-04 | 1.31e-02 | NA | NA |
5. P | A8Z450 | Demethylmenaquinone methyltransferase | 5.62e-05 | 6.27e-06 | NA | NA |
5. P | Q9D0D4 | Probable dimethyladenosine transferase | 1.85e-04 | 2.67e-02 | NA | NA |
5. P | P47589 | tRNA (guanine-N(7)-)-methyltransferase | 2.67e-06 | 7.80e-08 | NA | NA |
5. P | Q1CBG0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.73e-05 | 8.21e-05 | NA | NA |
5. P | A5TZT8 | Demethylmenaquinone methyltransferase | 1.70e-04 | 1.11e-02 | NA | NA |
5. P | W7LAD1 | Secondary metabolism regulator LAE1 | 3.72e-04 | 3.50e-05 | NA | NA |
5. P | C3LPS5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.66e-05 | 1.13e-04 | NA | NA |
5. P | Q4UMV1 | Ribosomal RNA small subunit methyltransferase A | 5.54e-05 | 5.70e-04 | NA | NA |
5. P | P31113 | Demethylmenaquinone methyltransferase | 1.94e-05 | 1.95e-04 | NA | NA |
5. P | B7NS48 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 7.35e-04 | NA | NA |
5. P | A7N1I9 | Carboxy-S-adenosyl-L-methionine synthase | 2.04e-04 | 1.28e-02 | NA | NA |
5. P | A1S8I6 | tRNA (guanine-N(7)-)-methyltransferase | 6.13e-06 | 2.64e-02 | NA | NA |
5. P | Q187Q1 | tRNA (guanine-N(7)-)-methyltransferase | 1.08e-06 | 2.29e-07 | NA | NA |
5. P | Q7NZD3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.25e-05 | 3.09e-03 | NA | NA |
5. P | Q73TQ5 | Uncharacterized methyltransferase MAP_3663c | 3.27e-04 | 7.55e-03 | NA | NA |
5. P | B2K0Y4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.64e-05 | 1.27e-04 | NA | NA |
5. P | A7GN50 | Demethylmenaquinone methyltransferase | 1.64e-05 | 4.25e-04 | NA | NA |
5. P | Q1QUG4 | Carboxy-S-adenosyl-L-methionine synthase | 2.36e-04 | 2.37e-02 | NA | NA |
5. P | Q9JPD1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.63e-04 | 2.78e-05 | NA | NA |
5. P | Q83CU8 | Malonyl-[acyl-carrier protein] O-methyltransferase 2 | 2.58e-06 | 6.01e-07 | NA | NA |
5. P | Q8NT39 | Demethylmenaquinone methyltransferase | 3.36e-04 | 7.78e-04 | NA | NA |
5. P | Q88WZ9 | tRNA (guanine-N(7)-)-methyltransferase | 7.36e-07 | 7.49e-07 | NA | NA |
5. P | Q83A90 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.40e-05 | 3.04e-05 | NA | NA |
5. P | C3P965 | Uncharacterized methyltransferase BAA_4623 | 2.23e-07 | 1.36e-02 | NA | NA |
5. P | A6LRN7 | tRNA (guanine-N(7)-)-methyltransferase | 1.57e-06 | 1.84e-06 | NA | NA |
5. P | A7MTX1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.73e-05 | 7.14e-05 | NA | NA |
5. P | C4K2K3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.09e-05 | 3.13e-05 | NA | NA |
5. P | A0KIF6 | Carboxy-S-adenosyl-L-methionine synthase | 1.74e-04 | 1.84e-06 | NA | NA |
5. P | A0RPY4 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 1.31e-03 | NA | NA |
5. P | Q72W15 | tRNA (guanine-N(7)-)-methyltransferase | 1.94e-06 | 2.07e-07 | NA | NA |
5. P | C6E4U6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 7.34e-06 | 9.49e-03 | NA | NA |
5. P | A4WVR7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.17e-05 | 1.74e-03 | NA | NA |
5. P | Q0HEA1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.69e-05 | 4.32e-03 | NA | NA |
5. P | B9JZF4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.20e-05 | 3.49e-02 | NA | NA |
5. P | B5RFM8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.03e-05 | 1.68e-04 | NA | NA |
5. P | P65347 | Uncharacterized methyltransferase Mb0092 | 5.59e-05 | 2.06e-03 | NA | NA |
5. P | B7HHR7 | Demethylmenaquinone methyltransferase | 1.59e-05 | 3.01e-04 | NA | NA |
5. P | P9WK02 | Uncharacterized methyltransferase MT0098 | 2.95e-05 | 2.06e-03 | NA | NA |
5. P | C3PKL1 | Demethylmenaquinone methyltransferase | 1.00e-04 | 1.15e-03 | NA | NA |
5. P | A8HVC4 | Ubiquinone biosynthesis O-methyltransferase | 7.15e-10 | 3.80e-02 | NA | NA |
5. P | Q66FT0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.64e-05 | 1.27e-04 | NA | NA |
5. P | Q119M3 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 6.73e-03 | NA | NA |
5. P | A9L3I3 | Carboxy-S-adenosyl-L-methionine synthase | 3.75e-04 | 2.03e-02 | NA | NA |
5. P | C3P5A0 | Demethylmenaquinone methyltransferase | 1.69e-05 | 1.50e-04 | NA | NA |
5. P | Q7VLX6 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 8.69e-03 | NA | NA |
5. P | Q9Z6S3 | tRNA (guanine-N(7)-)-methyltransferase | 2.98e-06 | 2.61e-03 | NA | NA |
5. P | A8GXR2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.59e-05 | 8.58e-06 | NA | NA |
5. P | Q5L5A2 | tRNA (guanine-N(7)-)-methyltransferase | 3.75e-05 | 9.16e-03 | NA | NA |
5. P | Q0HIZ7 | Carboxy-S-adenosyl-L-methionine synthase | 4.27e-04 | 8.47e-03 | NA | NA |
5. P | Q2T139 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.77e-05 | 3.45e-03 | NA | NA |
5. P | B1IW72 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.90e-05 | 5.09e-04 | NA | NA |
5. P | A9AFC0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.54e-05 | 1.16e-03 | NA | NA |
5. P | A6U6F0 | Ribosomal RNA large subunit methyltransferase E | 1.93e-03 | 7.82e-03 | NA | NA |
5. P | A9KGE6 | Ribosomal RNA large subunit methyltransferase E | 1.52e-03 | 1.31e-02 | NA | NA |
5. P | A6Q429 | Carboxy-S-adenosyl-L-methionine synthase | 8.10e-05 | 1.05e-05 | NA | NA |
5. P | O06898 | Malonyl-[acyl-carrier protein] O-methyltransferase | 6.15e-05 | 1.67e-02 | NA | NA |
5. P | Q6N7Q9 | Ribosomal RNA large subunit methyltransferase E | 4.16e-04 | 4.09e-02 | NA | NA |
5. P | B5XYI1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.63e-05 | 1.41e-04 | NA | NA |
5. P | P67055 | Demethylmenaquinone methyltransferase | 2.14e-05 | 1.07e-04 | NA | NA |
5. P | B5BH50 | Carboxy-S-adenosyl-L-methionine synthase | 1.70e-04 | 5.97e-04 | NA | NA |
5. P | Q5F9R9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.70e-05 | 7.58e-05 | NA | NA |
5. P | B4U1E2 | tRNA (guanine-N(7)-)-methyltransferase | 9.75e-07 | 2.44e-06 | NA | NA |
5. P | Q1G997 | tRNA (guanine-N(7)-)-methyltransferase | 6.68e-07 | 5.53e-08 | NA | NA |
5. P | A8YWH0 | tRNA (guanine-N(7)-)-methyltransferase | 5.53e-07 | 6.57e-09 | NA | NA |
5. P | Q8DHH6 | tRNA (guanine-N(7)-)-methyltransferase | 6.68e-06 | 1.80e-04 | NA | NA |
5. P | A1SRS4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.39e-05 | 1.17e-04 | NA | NA |
5. P | Q322I9 | Carboxy-S-adenosyl-L-methionine synthase | 1.57e-04 | 1.23e-03 | NA | NA |
5. P | B6I4H5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.39e-05 | 5.09e-04 | NA | NA |
5. P | B9DN65 | tRNA (guanine-N(7)-)-methyltransferase | 8.00e-07 | 4.50e-08 | NA | NA |
5. P | A7FRB3 | tRNA (guanine-N(7)-)-methyltransferase | 2.34e-06 | 3.70e-06 | NA | NA |
5. P | Q9HIH4 | Ribosomal RNA large subunit methyltransferase E | 1.82e-04 | 4.05e-03 | NA | NA |
5. P | Q2YTI8 | tRNA (guanine-N(7)-)-methyltransferase | 1.16e-06 | 9.73e-07 | NA | NA |
5. P | Q8F9Q1 | tRNA (guanine-N(7)-)-methyltransferase | 1.96e-06 | 2.68e-07 | NA | NA |
5. P | P67504 | tRNA (guanine-N(7)-)-methyltransferase | 9.04e-07 | 1.31e-05 | NA | NA |
5. P | B9J7S8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.17e-05 | 2.19e-02 | NA | NA |
5. P | Q3IY65 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.41e-05 | 9.73e-04 | NA | NA |
5. P | B1VEN4 | Demethylmenaquinone methyltransferase | 1.16e-04 | 3.54e-04 | NA | NA |
5. P | Q9ZKE5 | Carboxy-S-adenosyl-L-methionine synthase | 4.62e-04 | 3.01e-03 | NA | NA |
5. P | A8AVP7 | tRNA (guanine-N(7)-)-methyltransferase | 1.37e-06 | 4.82e-07 | NA | NA |
5. P | B4SVF5 | Carboxy-S-adenosyl-L-methionine synthase | 1.71e-04 | 6.44e-04 | NA | NA |
5. P | A8FEK9 | Demethylmenaquinone methyltransferase | 1.95e-05 | 1.00e-05 | NA | NA |
5. P | Q83WC4 | Glycine/sarcosine N-methyltransferase | 9.13e-05 | 1.52e-03 | NA | NA |
5. P | Q7SYS9 | Histamine N-methyltransferase B | 8.33e-05 | 7.85e-04 | NA | NA |
5. P | Q6L1E2 | Ribosomal RNA large subunit methyltransferase E | 1.17e-06 | 9.64e-04 | NA | NA |
5. P | Q041S2 | tRNA (guanine-N(7)-)-methyltransferase | 6.73e-07 | 1.56e-07 | NA | NA |
5. P | A1V753 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.75e-05 | 3.45e-03 | NA | NA |
5. P | A4SPN7 | Carboxy-S-adenosyl-L-methionine synthase | 1.40e-04 | 4.97e-06 | NA | NA |
5. P | C6DI77 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.84e-05 | 5.85e-05 | NA | NA |
5. P | Q3IIQ4 | Carboxy-S-adenosyl-L-methionine synthase | 2.98e-04 | 6.09e-05 | NA | NA |
5. P | Q606J9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.75e-05 | 1.40e-05 | NA | NA |
5. P | B5EFL1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 7.49e-07 | 1.39e-02 | NA | NA |
5. P | B4TBR3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.82e-05 | 1.68e-04 | NA | NA |
5. P | Q8TJK1 | Arsenite methyltransferase | 2.26e-09 | 3.08e-02 | NA | NA |
5. P | A3QIE1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.18e-05 | 9.92e-04 | NA | NA |
5. P | Q3KJC5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.72e-05 | 7.04e-03 | NA | NA |
5. P | A0A482NB13 | S-adenosyl-L-methionine-dependent Diels-Alderase iccD | 1.65e-07 | 4.25e-04 | NA | NA |
5. P | B4EB49 | Ubiquinone biosynthesis O-methyltransferase | 5.63e-11 | 3.18e-02 | NA | NA |
5. P | P72546 | tRNA (guanine-N(7)-)-methyltransferase | 7.60e-06 | 7.75e-03 | NA | NA |
5. P | B8E6B6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.62e-05 | 4.76e-03 | NA | NA |
5. P | A4Y6S3 | Carboxy-S-adenosyl-L-methionine synthase | 3.71e-04 | 5.49e-03 | NA | NA |
5. P | Q8XFX8 | Carboxy-S-adenosyl-L-methionine synthase | 1.72e-04 | 5.97e-04 | NA | NA |
5. P | A1UUE1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 9.60e-06 | 5.49e-03 | NA | NA |
5. P | Q134B7 | Ribosomal RNA small subunit methyltransferase J | 1.21e-05 | 6.28e-07 | NA | NA |
5. P | Q92B94 | tRNA (guanine-N(7)-)-methyltransferase | 8.73e-07 | 1.91e-06 | NA | NA |
5. P | A3MNT8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.85e-05 | 3.45e-03 | NA | NA |
5. P | Q7VF27 | Carboxy-S-adenosyl-L-methionine synthase | 4.85e-05 | 1.83e-02 | NA | NA |
5. P | Q9JWE6 | Ubiquinone biosynthesis O-methyltransferase | 4.53e-11 | 1.34e-02 | NA | NA |
5. P | C4K5L7 | Malonyl-[acyl-carrier protein] O-methyltransferase | 7.22e-05 | 3.67e-03 | NA | NA |
5. P | Q5LYG9 | tRNA (guanine-N(7)-)-methyltransferase | 9.25e-07 | 6.71e-07 | NA | NA |
5. P | P55905 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial | 3.95e-04 | 8.13e-05 | NA | NA |
5. P | B2VJC2 | Carboxy-S-adenosyl-L-methionine synthase | 1.72e-04 | 5.23e-04 | NA | NA |
5. P | A1DZZ3 | Uncharacterized methyltransferase YrrT | 1.06e-07 | 9.08e-03 | NA | NA |
5. P | C0ZHY5 | tRNA (guanine-N(7)-)-methyltransferase | 2.70e-06 | 4.40e-10 | NA | NA |
5. P | A7GXS7 | Carboxy-S-adenosyl-L-methionine synthase | 2.12e-05 | 3.37e-05 | NA | NA |
5. P | B9KIP4 | Ribosomal RNA large subunit methyltransferase E | 1.07e-04 | 3.45e-03 | NA | NA |
5. P | Q87TH4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.33e-05 | 8.63e-05 | NA | NA |
5. P | C6V598 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.71e-06 | 2.67e-02 | NA | NA |
5. P | Q9XAP8 | Demethylmenaquinone methyltransferase | 1.64e-04 | 9.41e-03 | NA | NA |
5. P | B8CI06 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.67e-05 | 2.58e-02 | NA | NA |
5. P | P0A639 | Demethylmenaquinone methyltransferase | 2.94e-04 | 1.11e-02 | NA | NA |
5. P | Q9RRT0 | Demethylmenaquinone methyltransferase | 2.81e-05 | 2.40e-03 | NA | NA |
5. P | A7NF26 | Demethylmenaquinone methyltransferase | 1.12e-04 | 2.30e-04 | NA | NA |
5. P | A0A0D3MJQ5 | Arsenite methyltransferase | 1.84e-08 | 4.94e-03 | NA | NA |
5. P | Q97A64 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 4.39e-10 | 5.40e-03 | NA | NA |
5. P | Q87UZ2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.79e-05 | 9.03e-04 | NA | NA |
5. P | B2IUM7 | 2-phytyl-1,4-naphtoquinone methyltransferase | 5.33e-05 | 2.84e-04 | NA | NA |
5. P | A0LGZ0 | Ribosomal RNA large subunit methyltransferase E | 4.35e-05 | 2.13e-03 | NA | NA |
5. P | B3QY13 | tRNA (guanine-N(7)-)-methyltransferase | 2.11e-05 | 1.77e-05 | NA | NA |
5. P | Q3YVD2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.48e-05 | 5.09e-04 | NA | NA |
5. P | Q28H76 | tRNA (guanine-N(7)-)-methyltransferase A | 4.49e-05 | 1.06e-02 | NA | NA |
5. P | Q7MQ33 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.57e-05 | 9.82e-04 | NA | NA |
5. P | Q5U4V2 | Histamine N-methyltransferase A | 8.55e-05 | 6.26e-04 | NA | NA |
5. P | Q03JA3 | tRNA (guanine-N(7)-)-methyltransferase | 1.09e-06 | 6.71e-07 | NA | NA |
5. P | A2S8L1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 3.45e-03 | NA | NA |
5. P | Q97FU9 | tRNA (guanine-N(7)-)-methyltransferase | 7.22e-07 | 5.29e-05 | NA | NA |
5. P | A0KWL3 | Carboxy-S-adenosyl-L-methionine synthase | 5.18e-05 | 8.47e-03 | NA | NA |
5. P | B4ETP1 | Carboxy-S-adenosyl-L-methionine synthase | 1.45e-04 | 1.42e-02 | NA | NA |
5. P | P36571 | Malonyl-[acyl-carrier protein] O-methyltransferase | 3.11e-07 | 3.77e-03 | NA | NA |
5. P | Q1CSK1 | Carboxy-S-adenosyl-L-methionine synthase | 3.69e-04 | 3.22e-04 | NA | NA |
5. P | A5F4E5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.68e-05 | 1.13e-04 | NA | NA |
5. P | C3K6J1 | Ubiquinone biosynthesis O-methyltransferase | 9.65e-11 | 1.01e-02 | NA | NA |
5. P | B9E4X8 | tRNA (guanine-N(7)-)-methyltransferase | 6.04e-07 | 1.51e-04 | NA | NA |
5. P | M1W268 | Methyltransferase CPUR_05424 | 1.55e-03 | 3.40e-02 | NA | NA |
5. P | A0A067XMV2 | Methyltransferase ptaH | 6.37e-04 | 2.60e-02 | NA | NA |
5. P | A9VMC2 | Demethylmenaquinone methyltransferase | 1.59e-05 | 9.06e-05 | NA | NA |
5. P | A4SM99 | Ubiquinone biosynthesis O-methyltransferase | 1.06e-10 | 3.73e-02 | NA | NA |
5. P | Q6MN40 | Ribosomal RNA large subunit methyltransferase E | 9.88e-07 | 1.43e-02 | NA | NA |
5. P | P0A2K6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.16e-05 | 1.68e-04 | NA | NA |
5. P | Q9ZCT9 | Ubiquinone biosynthesis O-methyltransferase | 3.11e-06 | 2.64e-02 | NA | NA |
5. P | Q5HFV2 | Demethylmenaquinone methyltransferase | 5.75e-05 | 6.27e-06 | NA | NA |
5. P | B7MW64 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | Q9HZ63 | Ubiquinone biosynthesis O-methyltransferase | 6.27e-11 | 3.29e-02 | NA | NA |
5. P | Q47LE2 | Demethylmenaquinone methyltransferase | 1.33e-04 | 6.15e-04 | NA | NA |
5. P | B2HMZ9 | Uncharacterized methyltransferase MMAR_0473 | 3.40e-04 | 6.44e-03 | NA | NA |
5. P | B2UUH2 | Carboxy-S-adenosyl-L-methionine synthase | 2.86e-04 | 3.34e-04 | NA | NA |
5. P | A8GFJ7 | Carboxy-S-adenosyl-L-methionine synthase | 1.59e-04 | 4.04e-05 | NA | NA |
5. P | Q9KWZ4 | tRNA (guanine-N(7)-)-methyltransferase | 1.17e-06 | 1.29e-06 | NA | NA |
5. P | E5KIC0 | Cypemycin N-terminal methyltransferase | 4.79e-04 | 1.77e-02 | NA | NA |
5. P | B7IP91 | Demethylmenaquinone methyltransferase | 1.60e-05 | 3.01e-04 | NA | NA |
5. P | Q6FDV0 | Malonyl-[acyl-carrier protein] O-methyltransferase | 7.60e-05 | 2.15e-04 | NA | NA |
5. P | Q2IG43 | tRNA (guanine-N(7)-)-methyltransferase | 3.37e-07 | 9.32e-03 | NA | NA |
5. P | B5FSM6 | Carboxy-S-adenosyl-L-methionine synthase | 1.72e-04 | 5.97e-04 | NA | NA |
5. P | B2U4X1 | Carboxy-S-adenosyl-L-methionine synthase | 1.55e-04 | 1.23e-03 | NA | NA |
5. P | Q609G2 | Ubiquinone biosynthesis O-methyltransferase | 8.15e-11 | 2.71e-02 | NA | NA |
5. P | C1EVW6 | tRNA (guanine-N(7)-)-methyltransferase | 1.67e-06 | 5.15e-07 | NA | NA |
5. P | Q475X0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.71e-05 | 9.82e-04 | NA | NA |
5. P | A9KD75 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.22e-05 | 3.04e-05 | NA | NA |
5. P | P59718 | tRNA (guanine-N(7)-)-methyltransferase | 2.24e-05 | 5.18e-04 | NA | NA |
5. P | B8IJ00 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.09e-05 | 6.44e-04 | NA | NA |
5. P | Q58847 | Uncharacterized protein MJ1452 | 1.58e-04 | 4.39e-03 | NA | NA |
5. P | Q9PIH5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.73e-08 | 1.74e-03 | NA | NA |
5. P | C3MCY6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 9.92e-06 | 5.69e-03 | NA | NA |
5. P | Q3K7D5 | Carboxy-S-adenosyl-L-methionine synthase | 4.45e-05 | 4.28e-03 | NA | NA |
5. P | B9J9U0 | Ribosomal RNA large subunit methyltransferase E | 4.05e-04 | 1.54e-02 | NA | NA |
5. P | A7X2H6 | Demethylmenaquinone methyltransferase | 3.92e-05 | 6.27e-06 | NA | NA |
5. P | A7MQL7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.03e-05 | 1.14e-04 | NA | NA |
5. P | B3PH48 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.58e-05 | 4.54e-04 | NA | NA |
5. P | Q14GU4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.93e-05 | 1.91e-02 | NA | NA |
5. P | Q88SI6 | Demethylmenaquinone methyltransferase | 5.66e-06 | 2.78e-05 | NA | NA |
5. P | B0WSB8 | tRNA (guanine-N(7)-)-methyltransferase | 3.09e-07 | 1.09e-03 | NA | NA |
5. P | C4LL93 | Demethylmenaquinone methyltransferase | 1.11e-04 | 8.62e-03 | NA | NA |
5. P | Q5PMY8 | Carboxy-S-adenosyl-L-methionine synthase | 1.70e-04 | 5.97e-04 | NA | NA |
5. P | A5EVQ4 | Carboxy-S-adenosyl-L-methionine synthase | 6.10e-09 | 6.50e-04 | NA | NA |
5. P | A5ISZ9 | Demethylmenaquinone methyltransferase | 4.85e-05 | 6.27e-06 | NA | NA |
5. P | Q1BE01 | Demethylmenaquinone methyltransferase | 1.13e-04 | 2.42e-03 | NA | NA |
5. P | A7ZU40 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.41e-05 | 5.09e-04 | NA | NA |
5. P | A1UAY5 | Demethylmenaquinone methyltransferase | 1.11e-04 | 2.42e-03 | NA | NA |
5. P | A9WRT1 | Demethylmenaquinone methyltransferase | 1.06e-04 | 4.12e-05 | NA | NA |
5. P | P67506 | tRNA (guanine-N(7)-)-methyltransferase | 1.98e-06 | 1.88e-06 | NA | NA |
5. P | Q2Y9Y6 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.37e-07 | 9.15e-05 | NA | NA |
5. P | Q63DL9 | Demethylmenaquinone methyltransferase | 1.68e-05 | 1.50e-04 | NA | NA |
5. P | B5F3I5 | Carboxy-S-adenosyl-L-methionine synthase | 1.58e-04 | 5.97e-04 | NA | NA |
5. P | Q1J5A9 | tRNA (guanine-N(7)-)-methyltransferase | 8.34e-07 | 1.31e-05 | NA | NA |
5. P | Q8YLP4 | 2-phytyl-1,4-naphtoquinone methyltransferase | 5.61e-08 | 4.37e-05 | NA | NA |
5. P | P0A888 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.61e-05 | 5.09e-04 | NA | NA |
5. P | Q3IJV7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.96e-05 | 3.44e-04 | NA | NA |
5. P | B1KV69 | tRNA (guanine-N(7)-)-methyltransferase | 2.27e-06 | 5.58e-06 | NA | NA |
5. P | A5ITS0 | tRNA (guanine-N(7)-)-methyltransferase | 9.26e-07 | 9.84e-07 | NA | NA |
5. P | B7LU01 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.74e-05 | 7.63e-04 | NA | NA |
5. P | Q9ZCP3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 4.24e-05 | 2.48e-05 | NA | NA |
5. P | C0MDZ0 | tRNA (guanine-N(7)-)-methyltransferase | 9.11e-07 | 4.11e-06 | NA | NA |
5. P | Q74LY0 | Demethylmenaquinone methyltransferase | 7.31e-06 | 7.01e-07 | NA | NA |
5. P | P13255 | Glycine N-methyltransferase | 4.84e-04 | 1.39e-03 | NA | NA |
5. P | B2VG41 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.30e-05 | 5.97e-05 | NA | NA |
5. P | Q4ZPE6 | Carboxy-S-adenosyl-L-methionine synthase | 4.54e-05 | 1.30e-02 | NA | NA |
5. P | Q9Y5N5 | Methyltransferase N6AMT1 | 4.27e-13 | 3.73e-14 | NA | NA |
5. P | Q1RAR4 | Carboxy-S-adenosyl-L-methionine synthase | 1.60e-04 | 1.27e-03 | NA | NA |
5. P | Q6FFY1 | Ubiquinone biosynthesis O-methyltransferase | 6.01e-08 | 3.64e-02 | NA | NA |
5. P | Q29513 | Glycine N-methyltransferase (Fragment) | 5.69e-04 | 6.73e-03 | NA | NA |
5. P | Q4A9M3 | tRNA (guanine-N(7)-)-methyltransferase | 1.11e-06 | 2.39e-07 | NA | NA |
5. P | C1AKN8 | Demethylmenaquinone methyltransferase | 3.04e-04 | 1.11e-02 | NA | NA |
5. P | B8DNJ4 | Ribosomal RNA large subunit methyltransferase E | 8.17e-04 | 2.26e-06 | NA | NA |
5. P | A2RM55 | tRNA (guanine-N(7)-)-methyltransferase | 9.68e-07 | 4.22e-07 | NA | NA |
5. P | B4EBC4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.71e-05 | 3.19e-04 | NA | NA |
5. P | P59719 | tRNA (guanine-N(7)-)-methyltransferase | 1.69e-06 | 4.38e-06 | NA | NA |
5. P | Q0T3Q8 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | Q2KUG1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.50e-05 | 1.76e-02 | NA | NA |
5. P | Q5X0X6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.81e-05 | 1.55e-05 | NA | NA |
5. P | Q6G1I2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.01e-05 | 3.30e-03 | NA | NA |
5. P | Q9HKE4 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 2.39e-10 | 7.29e-03 | NA | NA |
5. P | B7HSN5 | tRNA (guanine-N(7)-)-methyltransferase | 1.73e-06 | 8.26e-07 | NA | NA |
5. P | Q8EEE7 | Carboxy-S-adenosyl-L-methionine synthase | 2.75e-04 | 2.32e-03 | NA | NA |
5. P | Q5YPB0 | Demethylmenaquinone methyltransferase | 1.51e-04 | 2.33e-02 | NA | NA |
5. P | B7JS74 | tRNA (guanine-N(7)-)-methyltransferase | 1.24e-06 | 8.26e-07 | NA | NA |
5. P | Q24W00 | tRNA (guanine-N(7)-)-methyltransferase | 6.02e-07 | 2.42e-07 | NA | NA |
5. P | Q30YX3 | Ribosomal RNA large subunit methyltransferase E | 9.27e-05 | 9.42e-07 | NA | NA |
5. P | Q39IG8 | Ubiquinone biosynthesis O-methyltransferase | 5.53e-11 | 3.18e-02 | NA | NA |
5. P | Q92RT9 | Ribosomal RNA large subunit methyltransferase E | 5.26e-04 | 6.11e-03 | NA | NA |
5. P | Q07Z53 | tRNA (guanine-N(7)-)-methyltransferase | 6.70e-06 | 9.24e-03 | NA | NA |
5. P | A4VIY2 | Carboxy-S-adenosyl-L-methionine synthase | 4.94e-05 | 8.77e-03 | NA | NA |
5. P | Q8U8Q0 | Ribosomal RNA small subunit methyltransferase J | 6.12e-06 | 1.22e-06 | NA | NA |
5. P | B6J3P6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 3.04e-05 | NA | NA |
5. P | Q2FNX6 | Ribosomal RNA large subunit methyltransferase E | 4.58e-05 | 1.22e-02 | NA | NA |
5. P | Q6AJ42 | Ribosomal RNA large subunit methyltransferase E | 7.52e-05 | 1.12e-06 | NA | NA |
5. P | A9MIY3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.95e-05 | 1.14e-04 | NA | NA |
5. P | Q6D483 | Carboxy-S-adenosyl-L-methionine synthase | 1.65e-04 | 3.61e-05 | NA | NA |
5. P | A3QEP9 | Carboxy-S-adenosyl-L-methionine synthase | 3.17e-04 | 2.17e-02 | NA | NA |
5. P | C5D6C2 | tRNA (guanine-N(7)-)-methyltransferase | 1.59e-06 | 3.23e-07 | NA | NA |
5. P | B1W525 | Demethylmenaquinone methyltransferase | 2.00e-04 | 7.42e-03 | NA | NA |
5. P | Q0TGW2 | Carboxy-S-adenosyl-L-methionine synthase | 1.60e-04 | 1.27e-03 | NA | NA |
5. P | B1XAJ7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.81e-05 | 5.09e-04 | NA | NA |
5. P | Q4WB00 | Methyltransferase psoC | 4.78e-04 | 5.95e-03 | NA | NA |
5. P | A6U1T9 | Demethylmenaquinone methyltransferase | 4.70e-05 | 6.27e-06 | NA | NA |
5. P | B8ZM88 | tRNA (guanine-N(7)-)-methyltransferase | 1.32e-06 | 1.88e-06 | NA | NA |
5. P | P9WFR2 | Demethylmenaquinone methyltransferase | 1.68e-04 | 1.11e-02 | NA | NA |
5. P | A8G8B8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.69e-05 | 1.47e-04 | NA | NA |
5. P | Q7NBG2 | tRNA (guanine-N(7)-)-methyltransferase | 9.15e-06 | 1.06e-07 | NA | NA |
5. P | P64842 | Uncharacterized protein Mb1440c | 2.19e-07 | 6.62e-03 | NA | NA |
5. P | Q8DVQ4 | tRNA (guanine-N(7)-)-methyltransferase | 1.55e-06 | 3.01e-04 | NA | NA |
5. P | B7LPH4 | Carboxy-S-adenosyl-L-methionine synthase | 1.56e-04 | 8.38e-04 | NA | NA |
5. P | Q49XS5 | Demethylmenaquinone methyltransferase | 6.19e-05 | 1.90e-05 | NA | NA |
5. P | Q6GGU0 | Demethylmenaquinone methyltransferase | 3.30e-05 | 7.57e-06 | NA | NA |
5. P | A1KT06 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.76e-05 | 5.85e-05 | NA | NA |
5. P | A7FDE0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.72e-05 | 1.27e-04 | NA | NA |
5. P | B8CS82 | tRNA (guanine-N(7)-)-methyltransferase | 7.18e-05 | 4.20e-02 | NA | NA |
5. P | Q4JBL7 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 6.42e-11 | 3.21e-03 | NA | NA |
5. P | Q8A005 | Demethylmenaquinone methyltransferase | 2.23e-05 | 4.13e-04 | NA | NA |
5. P | B5XHV8 | tRNA (guanine-N(7)-)-methyltransferase | 8.93e-07 | 1.31e-05 | NA | NA |
5. P | B7L7S3 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | E6SRF9 | Malonyl-[acyl-carrier protein] O-methyltransferase | 7.93e-05 | 1.00e-03 | NA | NA |
5. P | A7NAA1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.11e-05 | 1.80e-02 | NA | NA |
5. P | C5BRL2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.52e-05 | 1.37e-04 | NA | NA |
5. P | A1RJQ8 | Carboxy-S-adenosyl-L-methionine synthase | 2.30e-04 | 4.24e-03 | NA | NA |
5. P | B4SZ73 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.07e-05 | 1.68e-04 | NA | NA |
5. P | Q6D3C1 | Malonyl-[acyl-carrier protein] O-methyltransferase | 4.06e-07 | 1.47e-02 | NA | NA |
5. P | C4L4Q4 | tRNA (guanine-N(7)-)-methyltransferase | 8.85e-07 | 1.41e-07 | NA | NA |
5. P | Q6G992 | Demethylmenaquinone methyltransferase | 3.38e-05 | 6.27e-06 | NA | NA |
5. P | B8I005 | tRNA (guanine-N(7)-)-methyltransferase | 5.04e-05 | 8.21e-05 | NA | NA |
5. P | B5R146 | Carboxy-S-adenosyl-L-methionine synthase | 1.70e-04 | 6.44e-04 | NA | NA |
5. P | B2IMD9 | tRNA (guanine-N(7)-)-methyltransferase | 1.60e-06 | 1.36e-06 | NA | NA |
5. P | Q6DAQ7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.73e-05 | 4.33e-05 | NA | NA |
5. P | A2QK64 | Methyltransferase ktnA | 2.29e-05 | 2.85e-02 | NA | NA |
5. P | Q9KVQ6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.66e-05 | 1.13e-04 | NA | NA |
5. P | A8ZT18 | Ribosomal RNA large subunit methyltransferase E | 2.33e-03 | 1.29e-03 | NA | NA |
5. P | Q8MSW4 | rRNA N6-adenosine-methyltransferase Mettl5 | 8.01e-11 | 2.77e-10 | NA | NA |
5. P | Q31P90 | 2-phytyl-1,4-naphtoquinone methyltransferase | 4.24e-08 | 1.67e-03 | NA | NA |
5. P | C0QJG8 | Carboxy-S-adenosyl-L-methionine synthase | 7.23e-05 | 5.76e-06 | NA | NA |
5. P | Q8D1I3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.52e-05 | 1.27e-04 | NA | NA |
5. P | B7J1P0 | Ribosomal RNA large subunit methyltransferase E | 1.15e-06 | 2.19e-04 | NA | NA |
5. P | Q9PRA5 | Ribosomal RNA small subunit methyltransferase G | 2.50e-10 | 1.93e-02 | NA | NA |
5. P | A8GT99 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.52e-05 | 5.62e-05 | NA | NA |
5. P | C0Q2E4 | Carboxy-S-adenosyl-L-methionine synthase | 1.55e-04 | 4.33e-04 | NA | NA |
5. P | A4W3S2 | tRNA (guanine-N(7)-)-methyltransferase | 1.23e-06 | 9.04e-06 | NA | NA |
5. P | Q02EV4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.75e-05 | 3.16e-04 | NA | NA |
5. P | A5WA45 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.94e-05 | 5.54e-04 | NA | NA |
5. P | A1BGS9 | tRNA (guanine-N(7)-)-methyltransferase | 1.67e-06 | 3.41e-04 | NA | NA |
5. P | A3D475 | Carboxy-S-adenosyl-L-methionine synthase | 3.76e-04 | 2.03e-02 | NA | NA |
5. P | Q11UV2 | tRNA (guanine-N(7)-)-methyltransferase | 1.39e-07 | 6.47e-05 | NA | NA |
5. P | A9VHZ6 | Uncharacterized methyltransferase BcerKBAB4_4222 | 2.25e-07 | 9.16e-03 | NA | NA |
5. P | Q5FIS5 | tRNA (guanine-N(7)-)-methyltransferase | 6.32e-07 | 4.72e-07 | NA | NA |
5. P | A1VY43 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.84e-08 | 8.78e-04 | NA | NA |
5. P | Q3K8T6 | Ubiquinone biosynthesis O-methyltransferase | 9.47e-11 | 2.16e-02 | NA | NA |
5. P | C1DHS2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.85e-05 | 2.70e-03 | NA | NA |
5. P | Q7VL11 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.75e-05 | 7.82e-03 | NA | NA |
5. P | Q6G577 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.02e-05 | 1.61e-02 | NA | NA |
5. P | Q74FT5 | tRNA (guanine-N(7)-)-methyltransferase | 2.42e-05 | 2.03e-06 | NA | NA |
5. P | A5W8E4 | Carboxy-S-adenosyl-L-methionine synthase | 4.84e-04 | 1.09e-03 | NA | NA |
5. P | Q73SL8 | Demethylmenaquinone methyltransferase | 2.29e-04 | 1.53e-03 | NA | NA |
5. P | P55489 | Uncharacterized protein y4iF | 9.91e-03 | 1.14e-02 | NA | NA |
5. P | Q2FFZ0 | tRNA (guanine-N(7)-)-methyltransferase | 9.00e-07 | 9.73e-07 | NA | NA |
5. P | A6VTA1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.90e-05 | 1.25e-03 | NA | NA |
5. P | Q55EX9 | Putative methyltransferase DDB_G0268948 | 7.35e-05 | 3.77e-03 | NA | NA |
5. P | B4TNX9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.00e-05 | 1.68e-04 | NA | NA |
5. P | Q8CS43 | tRNA (guanine-N(7)-)-methyltransferase | 1.06e-06 | 2.02e-07 | NA | NA |
5. P | P67503 | tRNA (guanine-N(7)-)-methyltransferase | 1.60e-06 | 1.46e-05 | NA | NA |
5. P | B2V2I8 | tRNA (guanine-N(7)-)-methyltransferase | 9.55e-07 | 1.16e-06 | NA | NA |
5. P | B3Q619 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.07e-05 | 1.03e-02 | NA | NA |
5. P | Q64XV8 | Demethylmenaquinone methyltransferase | 2.22e-05 | 1.56e-04 | NA | NA |
5. P | Q91FT7 | Putative methyltransferase 235L | NA | 1.61e-02 | NA | NA |
5. P | Q81ZV1 | Demethylmenaquinone methyltransferase | 4.64e-09 | 4.58e-04 | NA | NA |
5. P | B1MK43 | Uncharacterized methyltransferase MAB_4481 | 2.97e-04 | 2.49e-02 | NA | NA |
5. P | P9WEZ3 | Methyltransferase pytC | 1.24e-05 | 3.05e-02 | NA | NA |
5. P | A8II77 | Ribosomal RNA large subunit methyltransferase E | 3.84e-04 | 3.67e-02 | NA | NA |
5. P | P67061 | Demethylmenaquinone methyltransferase | 4.86e-05 | 6.27e-06 | NA | NA |
5. P | Q3MD91 | 2-phytyl-1,4-naphtoquinone methyltransferase | 4.75e-08 | 2.20e-05 | NA | NA |
5. P | B5ZR94 | Ribosomal RNA large subunit methyltransferase E | 2.68e-04 | 9.83e-03 | NA | NA |
5. P | B1MHC3 | Demethylmenaquinone methyltransferase | 1.46e-04 | 2.10e-02 | NA | NA |
5. P | Q29S19 | RNA 5'-monophosphate methyltransferase | 3.77e-04 | 3.40e-02 | NA | NA |
5. P | A0AJ67 | tRNA (guanine-N(7)-)-methyltransferase | 9.76e-07 | 1.11e-06 | NA | NA |
5. P | Q7CH67 | Malonyl-[acyl-carrier protein] O-methyltransferase | 5.36e-07 | 2.45e-02 | NA | NA |
5. P | P44074 | Uncharacterized protein HI_0912 | 2.64e-08 | 9.52e-06 | NA | NA |
5. P | Q5LH04 | Demethylmenaquinone methyltransferase | 2.23e-05 | 1.56e-04 | NA | NA |
5. P | Q9A258 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.26e-04 | 8.32e-03 | NA | NA |
5. P | C1KWN1 | Demethylmenaquinone methyltransferase | 5.71e-05 | 1.07e-04 | NA | NA |
5. P | Q57HN8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.06e-05 | 1.68e-04 | NA | NA |
5. P | B0T7D0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.42e-04 | 2.07e-02 | NA | NA |
5. P | A8F2G9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.40e-05 | 2.51e-05 | NA | NA |
5. P | Q6NDM2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.43e-05 | 1.03e-02 | NA | NA |
5. P | B8GVY5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.28e-04 | 8.32e-03 | NA | NA |
5. P | B9DN09 | Uncharacterized methyltransferase Sca_1399 | 2.19e-07 | 1.04e-02 | NA | NA |
5. P | Q5WSQ8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.79e-05 | 1.43e-05 | NA | NA |
5. P | Q5KWV8 | Uncharacterized methyltransferase GK2543 | 9.35e-08 | 6.22e-03 | NA | NA |
5. P | Q661V2 | Ribosomal RNA large subunit methyltransferase E | 1.19e-06 | 2.86e-05 | NA | NA |
5. P | A9MNC8 | Carboxy-S-adenosyl-L-methionine synthase | 1.71e-04 | 3.90e-04 | NA | NA |
5. P | A6Q7G6 | Carboxy-S-adenosyl-L-methionine synthase | 1.74e-04 | 2.46e-05 | NA | NA |
5. P | B1J2S8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.07e-05 | 1.03e-03 | NA | NA |
5. P | Q81ZX2 | Demethylmenaquinone methyltransferase | 1.81e-04 | 1.78e-03 | NA | NA |
5. P | C0QX75 | Ribosomal RNA large subunit methyltransferase E | 4.13e-05 | 3.04e-04 | NA | NA |
5. P | C3PBG1 | tRNA (guanine-N(7)-)-methyltransferase | 1.68e-06 | 8.26e-07 | NA | NA |
5. P | A0RIY8 | Uncharacterized methyltransferase BALH_3960 | 2.24e-07 | 2.25e-02 | NA | NA |
5. P | A1T1P0 | Uncharacterized methyltransferase Mvan_0241 | 3.23e-04 | 4.53e-02 | NA | NA |
5. P | Q47C02 | Malonyl-[acyl-carrier protein] O-methyltransferase | 6.63e-08 | 2.23e-04 | NA | NA |
5. P | Q7MSC3 | Carboxy-S-adenosyl-L-methionine synthase | 6.18e-05 | 2.00e-05 | NA | NA |
5. P | A8G2P9 | tRNA (guanine-N(7)-)-methyltransferase | 6.45e-08 | 2.01e-04 | NA | NA |
5. P | Q55467 | Magnesium-protoporphyrin O-methyltransferase | 7.54e-09 | 2.98e-02 | NA | NA |
5. P | B5R8D2 | Carboxy-S-adenosyl-L-methionine synthase | 1.71e-04 | 6.44e-04 | NA | NA |
5. P | C3L8S6 | Demethylmenaquinone methyltransferase | 1.69e-05 | 1.50e-04 | NA | NA |
5. P | M2SNN6 | Secondary metabolism regulator LAE1 | 4.39e-04 | 1.19e-04 | NA | NA |
5. P | C0Q3E1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.79e-05 | 1.68e-04 | NA | NA |
5. P | C6E228 | Carboxy-S-adenosyl-L-methionine synthase | 6.96e-05 | 8.54e-03 | NA | NA |
5. P | A8H966 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.64e-05 | 1.52e-03 | NA | NA |
5. P | Q4L6H3 | Demethylmenaquinone methyltransferase | 5.38e-05 | 1.43e-05 | NA | NA |
5. P | B7M2G1 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | A9R431 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.65e-05 | 1.27e-04 | NA | NA |
5. P | Q9K2B6 | Demethylmenaquinone methyltransferase | 1.10e-09 | 4.55e-03 | NA | NA |
5. P | Q57732 | Uncharacterized protein MJ0284 | 4.34e-10 | 2.96e-12 | NA | NA |
5. P | Q9ALP0 | dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase | 2.53e-04 | 1.96e-03 | NA | NA |
5. P | B7IKW6 | tRNA (guanine-N(7)-)-methyltransferase | 1.52e-06 | 4.72e-07 | NA | NA |
5. P | Q03QE7 | tRNA (guanine-N(7)-)-methyltransferase | 6.68e-07 | 5.82e-06 | NA | NA |
5. P | Q8FSB3 | Demethylmenaquinone methyltransferase | 1.44e-04 | 1.67e-03 | NA | NA |
5. P | Q1JAB6 | tRNA (guanine-N(7)-)-methyltransferase | 8.46e-07 | 1.31e-05 | NA | NA |
5. P | C6C068 | Ribosomal RNA large subunit methyltransferase E | 1.39e-04 | 1.24e-02 | NA | NA |
5. P | Q0SNJ8 | Ribosomal RNA large subunit methyltransferase E | 8.64e-07 | 2.42e-03 | NA | NA |
5. P | Q04EH7 | tRNA (guanine-N(7)-)-methyltransferase | 2.32e-06 | 1.12e-04 | NA | NA |
5. P | Q9CHI2 | tRNA (guanine-N(7)-)-methyltransferase | 1.18e-06 | 4.22e-07 | NA | NA |
5. P | Q8YVX4 | tRNA (guanine-N(7)-)-methyltransferase | 3.32e-08 | 2.58e-03 | NA | NA |
5. P | B2G8C8 | tRNA (guanine-N(7)-)-methyltransferase | 9.32e-07 | 2.10e-06 | NA | NA |
5. P | B5RRD2 | Ribosomal RNA large subunit methyltransferase E | 1.43e-06 | 2.66e-06 | NA | NA |
5. P | B8GG79 | Ribosomal RNA large subunit methyltransferase E | 3.81e-07 | 2.21e-03 | NA | NA |
5. P | B7VMH8 | Carboxy-S-adenosyl-L-methionine synthase | 1.93e-04 | 1.98e-02 | NA | NA |
5. P | Q1I5M8 | Carboxy-S-adenosyl-L-methionine synthase | 5.22e-04 | 8.15e-04 | NA | NA |
5. P | P49016 | Demethylmenaquinone methyltransferase | 2.76e-05 | 3.16e-07 | NA | NA |
5. P | B2TM00 | tRNA (guanine-N(7)-)-methyltransferase | 9.31e-07 | 4.66e-07 | NA | NA |
5. P | C3L0Q0 | tRNA (guanine-N(7)-)-methyltransferase | 1.99e-06 | 2.00e-05 | NA | NA |
5. P | B5QW73 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.89e-05 | 1.68e-04 | NA | NA |
5. P | A5IZB9 | tRNA (guanine-N(7)-)-methyltransferase | 2.96e-06 | 3.74e-06 | NA | NA |
5. P | Q67LE6 | Demethylmenaquinone methyltransferase | 1.18e-05 | 6.33e-03 | NA | NA |
5. P | Q8TI93 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 2.48e-10 | 2.41e-02 | NA | NA |
5. P | Q5PKP4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 1.68e-04 | NA | NA |
5. P | P59716 | tRNA (guanine-N(7)-)-methyltransferase | 1.82e-06 | 8.26e-07 | NA | NA |
5. P | Q818A1 | Uncharacterized methyltransferase BC_4369 | 2.24e-07 | 1.25e-02 | NA | NA |
5. P | B2JCU8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.90e-05 | 3.58e-04 | NA | NA |
5. P | C1DQT0 | Carboxy-S-adenosyl-L-methionine synthase | 3.25e-04 | 1.26e-03 | NA | NA |
5. P | Q72HI4 | Demethylmenaquinone methyltransferase | 3.37e-05 | 4.30e-02 | NA | NA |
5. P | Q1BFJ5 | Uncharacterized methyltransferase Mmcs_0218 | 2.71e-04 | 3.29e-02 | NA | NA |
5. P | Q9CBA8 | Demethylmenaquinone methyltransferase | 8.74e-05 | 9.32e-03 | NA | NA |
5. P | A9M3A0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.38e-05 | 8.13e-05 | NA | NA |
5. P | Q600J2 | tRNA (guanine-N(7)-)-methyltransferase | 1.03e-06 | 7.82e-07 | NA | NA |
5. P | C1CJ34 | tRNA (guanine-N(7)-)-methyltransferase | 1.29e-06 | 1.88e-06 | NA | NA |
5. P | Q4L792 | tRNA (guanine-N(7)-)-methyltransferase | 1.22e-06 | 1.87e-07 | NA | NA |
5. P | P67502 | tRNA (guanine-N(7)-)-methyltransferase | 9.61e-07 | 1.46e-05 | NA | NA |
5. P | Q9K075 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.71e-05 | 6.21e-05 | NA | NA |
5. P | C1D5S5 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.51e-04 | 4.72e-03 | NA | NA |
5. P | A9N9F4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.36e-05 | 7.81e-06 | NA | NA |
5. P | B4L529 | tRNA (guanine-N(7)-)-methyltransferase | 2.46e-07 | 3.05e-02 | NA | NA |
5. P | P45249 | Malonyl-[acyl-carrier protein] O-methyltransferase | 2.11e-06 | 1.25e-03 | NA | NA |
5. P | Q9UBP6 | tRNA (guanine-N(7)-)-methyltransferase | 4.50e-07 | 1.12e-02 | NA | NA |
5. P | Q9KJ22 | Glycine/sarcosine N-methyltransferase | 1.57e-04 | 4.41e-04 | NA | NA |
5. P | Q9PD92 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.63e-05 | 2.13e-03 | NA | NA |
5. P | A7Z7T3 | tRNA (guanine-N(7)-)-methyltransferase | 1.51e-06 | 4.01e-08 | NA | NA |
5. P | A3CVJ3 | Ribosomal RNA large subunit methyltransferase E | 5.11e-07 | 4.90e-04 | NA | NA |
5. P | Q081N3 | Carboxy-S-adenosyl-L-methionine synthase | 3.19e-04 | 4.20e-02 | NA | NA |
5. P | A7ZED5 | Carboxy-S-adenosyl-L-methionine synthase | 1.30e-04 | 1.66e-05 | NA | NA |
5. P | B8FL12 | Ribosomal RNA large subunit methyltransferase E | 8.88e-07 | 9.74e-03 | NA | NA |
5. P | Q81FQ6 | Demethylmenaquinone methyltransferase | 1.61e-05 | 3.01e-04 | NA | NA |
5. P | A1SST5 | Carboxy-S-adenosyl-L-methionine synthase | 4.01e-04 | 1.24e-02 | NA | NA |
5. P | Q8NZU4 | tRNA (guanine-N(7)-)-methyltransferase | 8.97e-07 | 9.42e-06 | NA | NA |
5. P | A5N127 | tRNA (guanine-N(7)-)-methyltransferase | 6.14e-07 | 1.51e-04 | NA | NA |
5. P | C5D3E5 | Demethylmenaquinone methyltransferase | 2.20e-05 | 1.11e-05 | NA | NA |
5. P | A0A1U9YI04 | N-methyltransferase verN | 2.21e-05 | 2.23e-03 | NA | NA |
5. P | Q7W3N6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.06e-05 | 2.27e-02 | NA | NA |
5. P | Q57N92 | Carboxy-S-adenosyl-L-methionine synthase | 1.69e-04 | 4.33e-04 | NA | NA |
5. P | Q89WD0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.06e-05 | 9.66e-03 | NA | NA |
5. P | Q1HPU2 | tRNA (guanine-N(7)-)-methyltransferase | 1.02e-07 | 6.88e-08 | NA | NA |
5. P | Q92SK7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.09e-05 | 9.73e-04 | NA | NA |
5. P | A6W0X8 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.49e-08 | 1.53e-02 | NA | NA |
5. P | A9FQE4 | Ribosomal RNA large subunit methyltransferase E | 1.04e-04 | 1.56e-04 | NA | NA |
5. P | Q6NU94 | tRNA (guanine-N(7)-)-methyltransferase | 3.20e-07 | 3.99e-02 | NA | NA |
5. P | A2C073 | tRNA (guanine-N(7)-)-methyltransferase | 6.92e-06 | 5.44e-04 | NA | NA |
5. P | Q9Y7L2 | Probable RNA methyltransferase C2A9.10 | 2.02e-07 | 4.13e-02 | NA | NA |
5. P | Q3AW35 | tRNA (guanine-N(7)-)-methyltransferase | 1.79e-04 | 7.78e-04 | NA | NA |
5. P | A6WXR2 | Ribosomal RNA small subunit methyltransferase J | 6.94e-06 | 1.44e-05 | NA | NA |
5. P | Q24W96 | Demethylmenaquinone methyltransferase | 3.57e-05 | 2.49e-03 | NA | NA |
5. P | B5XPZ6 | Carboxy-S-adenosyl-L-methionine synthase | 1.65e-04 | 6.44e-04 | NA | NA |
5. P | A8A171 | Carboxy-S-adenosyl-L-methionine synthase | 1.61e-04 | 1.27e-03 | NA | NA |
5. P | A5GA37 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 7.90e-06 | 1.58e-02 | NA | NA |
5. P | B8CNX5 | Carboxy-S-adenosyl-L-methionine synthase | 3.16e-04 | 2.25e-03 | NA | NA |
5. P | Q73IS9 | Ribosomal RNA large subunit methyltransferase E | 9.51e-07 | 4.36e-03 | NA | NA |
5. P | B0TJ16 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.45e-05 | 1.21e-03 | NA | NA |
5. P | A8FL14 | Carboxy-S-adenosyl-L-methionine synthase | 2.58e-04 | 2.58e-04 | NA | NA |
5. P | O83687 | Ribosomal RNA large subunit methyltransferase E | 4.12e-05 | 9.74e-03 | NA | NA |
5. P | Q07LH9 | Ribosomal RNA large subunit methyltransferase E | 6.77e-06 | 2.71e-02 | NA | NA |
5. P | Q5NFE1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.08e-05 | 1.91e-02 | NA | NA |
5. P | Q7V4W7 | tRNA (guanine-N(7)-)-methyltransferase | 1.16e-07 | 2.07e-02 | NA | NA |
5. P | A3D9F2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 4.76e-03 | NA | NA |
5. P | P36566 | tRNA 5-carboxymethoxyuridine methyltransferase | 6.22e-10 | 3.98e-03 | NA | NA |
5. P | Q0BBY4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.79e-05 | 3.64e-04 | NA | NA |
5. P | B7NBM1 | Carboxy-S-adenosyl-L-methionine synthase | 1.57e-04 | 9.73e-04 | NA | NA |
5. P | Q31CU2 | tRNA (guanine-N(7)-)-methyltransferase | 1.72e-07 | 1.80e-04 | NA | NA |
5. P | P67056 | Demethylmenaquinone methyltransferase | 2.27e-05 | 1.07e-04 | NA | NA |
5. P | Q8UHR0 | Ribosomal RNA large subunit methyltransferase E | 2.12e-03 | 3.26e-02 | NA | NA |
5. P | P12999 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.26e-03 | 4.21e-04 | NA | NA |
5. P | Q9PL91 | tRNA (guanine-N(7)-)-methyltransferase | 3.28e-05 | 1.60e-05 | NA | NA |
5. P | C1EN10 | Demethylmenaquinone methyltransferase | 1.72e-05 | 1.50e-04 | NA | NA |
5. P | A8GPB1 | Ubiquinone biosynthesis O-methyltransferase | 1.26e-08 | 8.32e-03 | NA | NA |
5. P | B2I696 | Ribosomal RNA large subunit methyltransferase E | 2.61e-06 | 3.77e-02 | NA | NA |
5. P | B0RCZ0 | Demethylmenaquinone methyltransferase | 4.36e-05 | 3.47e-04 | NA | NA |
5. P | A6WIE9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.49e-05 | 4.76e-03 | NA | NA |
5. P | B7V9J5 | Ubiquinone biosynthesis O-methyltransferase | 5.85e-11 | 3.35e-02 | NA | NA |
5. P | A9VKK9 | tRNA (guanine-N(7)-)-methyltransferase | 1.47e-06 | 9.47e-08 | NA | NA |
5. P | B4M703 | tRNA (guanine-N(7)-)-methyltransferase | 2.72e-07 | 3.80e-02 | NA | NA |
5. P | Q8EWB6 | tRNA (guanine-N(7)-)-methyltransferase | 5.85e-08 | 1.63e-05 | NA | NA |
5. P | Q0BNE2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.19e-05 | 1.80e-02 | NA | NA |
5. P | Q1R477 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.52e-05 | 4.76e-04 | NA | NA |
5. P | B7L996 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.08e-05 | 5.09e-04 | NA | NA |
5. P | A9KYL8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.64e-05 | 4.76e-03 | NA | NA |
5. P | C1FSH8 | tRNA (guanine-N(7)-)-methyltransferase | 2.40e-06 | 3.70e-06 | NA | NA |
5. P | A9UMM1 | tRNA (guanine-N(7)-)-methyltransferase B | 1.03e-07 | 2.99e-03 | NA | NA |
5. P | B2HRQ2 | Demethylmenaquinone methyltransferase | 1.30e-04 | 1.25e-03 | NA | NA |
5. P | Q74EU2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.26e-05 | 1.49e-02 | NA | NA |
5. P | B4RK11 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.70e-05 | 7.58e-05 | NA | NA |
5. P | Q2Y6R0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.74e-05 | 1.88e-05 | NA | NA |
5. P | O84836 | tRNA (guanine-N(7)-)-methyltransferase | 3.16e-05 | 1.84e-05 | NA | NA |
5. P | Q0HUY5 | Carboxy-S-adenosyl-L-methionine synthase | 4.04e-04 | 1.00e-02 | NA | NA |
5. P | A7I848 | Ribosomal RNA large subunit methyltransferase E | 3.58e-07 | 9.41e-03 | NA | NA |
5. P | Q02N15 | Trans-aconitate 2-methyltransferase | 5.78e-07 | 3.96e-02 | NA | NA |
5. P | Q83KQ5 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | Q03GC9 | tRNA (guanine-N(7)-)-methyltransferase | 6.72e-07 | 7.37e-08 | NA | NA |
5. P | Q9K7U8 | tRNA (guanine-N(7)-)-methyltransferase | 1.00e-06 | 1.39e-07 | NA | NA |
5. P | Q58771 | Ribosomal RNA large subunit methyltransferase E | 1.15e-03 | 4.94e-04 | NA | NA |
5. P | A6QHT1 | tRNA (guanine-N(7)-)-methyltransferase | 1.08e-06 | 1.29e-06 | NA | NA |
5. P | A1VC40 | Ribosomal RNA large subunit methyltransferase E | 7.31e-04 | 7.24e-07 | NA | NA |
5. P | B4JLU7 | tRNA (guanine-N(7)-)-methyltransferase | 2.15e-07 | 9.24e-03 | NA | NA |
5. P | O34522 | tRNA (guanine-N(7)-)-methyltransferase | 1.47e-06 | 1.32e-07 | NA | NA |
5. P | Q0CCX8 | Methyltransferase gedG | 2.01e-04 | 1.24e-02 | NA | NA |
5. P | Q83E64 | Malonyl-[acyl-carrier protein] O-methyltransferase 1 | 6.87e-07 | 2.98e-04 | NA | NA |
5. P | Q9KCC4 | Demethylmenaquinone methyltransferase | 2.53e-05 | 1.48e-04 | NA | NA |
5. P | B6I1E8 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | A8H551 | Carboxy-S-adenosyl-L-methionine synthase | 3.53e-04 | 1.79e-02 | NA | NA |
5. P | Q3Z2P6 | Carboxy-S-adenosyl-L-methionine synthase | 1.57e-04 | 1.59e-03 | NA | NA |
5. P | Q46HD3 | tRNA (guanine-N(7)-)-methyltransferase | 1.38e-05 | 2.00e-03 | NA | NA |
5. P | A3CQ23 | tRNA (guanine-N(7)-)-methyltransferase | 1.56e-06 | 9.84e-07 | NA | NA |
5. P | Q1JKG6 | tRNA (guanine-N(7)-)-methyltransferase | 8.69e-07 | 1.31e-05 | NA | NA |
5. P | C4K5W2 | Carboxy-S-adenosyl-L-methionine synthase | 1.85e-04 | 4.03e-02 | NA | NA |
5. P | Q7CQC4 | Carboxy-S-adenosyl-L-methionine synthase | 1.72e-04 | 5.97e-04 | NA | NA |
5. P | A6UYW3 | Malonyl-[acyl-carrier protein] O-methyltransferase | 8.24e-08 | 9.08e-03 | NA | NA |
5. P | Q29I16 | tRNA (guanine-N(7)-)-methyltransferase | 4.73e-07 | 1.44e-02 | NA | NA |
5. P | A7X3I5 | tRNA (guanine-N(7)-)-methyltransferase | 1.17e-06 | 1.75e-06 | NA | NA |
5. P | P67064 | Demethylmenaquinone methyltransferase | 4.06e-05 | 4.94e-05 | NA | NA |
5. P | Q8DAN9 | Carboxy-S-adenosyl-L-methionine synthase | 2.11e-04 | 1.68e-02 | NA | NA |
5. P | B7N2E1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.04e-05 | 4.76e-04 | NA | NA |
5. P | Q2SN12 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.28e-05 | 8.30e-04 | NA | NA |
5. P | Q2YY85 | Demethylmenaquinone methyltransferase | 4.46e-05 | 1.50e-05 | NA | NA |
5. P | B2RJE9 | Demethylmenaquinone methyltransferase | 1.37e-05 | 3.65e-05 | NA | NA |
5. P | A0A0B5L7R4 | Secondary metabolism regulator LAE1 | 5.99e-03 | 3.13e-04 | NA | NA |
5. P | Q04LW5 | tRNA (guanine-N(7)-)-methyltransferase | 1.33e-06 | 1.88e-06 | NA | NA |
5. P | Q15NL2 | Carboxy-S-adenosyl-L-methionine synthase | 2.42e-04 | 1.17e-04 | NA | NA |
5. P | Q2YDF1 | tRNA (guanine-N(7)-)-methyltransferase | 4.39e-05 | 5.59e-03 | NA | NA |
5. P | Q5XJ57 | tRNA (guanine-N(7)-)-methyltransferase | 9.66e-08 | 5.92e-04 | NA | NA |
5. P | Q4K8M4 | Ubiquinone biosynthesis O-methyltransferase | 6.31e-11 | 2.41e-02 | NA | NA |
5. P | Q1WUP5 | tRNA (guanine-N(7)-)-methyltransferase | 1.64e-06 | 4.94e-05 | NA | NA |
5. P | Q5XAG6 | tRNA (guanine-N(7)-)-methyltransferase | 1.11e-06 | 7.49e-06 | NA | NA |
5. P | Q02PX7 | Ubiquinone biosynthesis O-methyltransferase | 6.41e-11 | 1.91e-02 | NA | NA |
5. P | Q0SZ25 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.97e-05 | 5.09e-04 | NA | NA |
5. P | O28228 | Ribosomal RNA large subunit methyltransferase E | 1.56e-04 | 4.50e-04 | NA | NA |
5. P | C1CQ43 | tRNA (guanine-N(7)-)-methyltransferase | 1.23e-06 | 3.94e-06 | NA | NA |
5. P | Q7VDU8 | tRNA (guanine-N(7)-)-methyltransferase | 8.26e-06 | 2.92e-05 | NA | NA |
5. P | B4H4I3 | tRNA (guanine-N(7)-)-methyltransferase | 2.08e-07 | 2.01e-02 | NA | NA |
5. P | B1JYJ6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.87e-05 | 3.19e-04 | NA | NA |
5. P | Q2NTJ7 | Carboxy-S-adenosyl-L-methionine synthase | 1.60e-04 | 3.78e-06 | NA | NA |
5. P | B7MHC0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.34e-05 | 4.76e-04 | NA | NA |
5. P | A8WTA7 | tRNA (guanine-N(7)-)-methyltransferase | 2.45e-07 | 1.50e-02 | NA | NA |
5. P | P0A889 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.39e-05 | 5.09e-04 | NA | NA |
5. P | P67507 | tRNA (guanine-N(7)-)-methyltransferase | 1.34e-06 | 1.88e-06 | NA | NA |
5. P | B1HTA6 | Demethylmenaquinone methyltransferase | 3.13e-05 | 9.73e-04 | NA | NA |
5. P | A6WNQ8 | Carboxy-S-adenosyl-L-methionine synthase | 3.80e-04 | 2.03e-02 | NA | NA |
5. P | O26833 | Uncharacterized protein MTH_738 | 4.13e-04 | 4.23e-02 | NA | NA |
5. P | A7GT53 | Uncharacterized methyltransferase Bcer98_3087 | 1.57e-07 | 1.64e-02 | NA | NA |
5. P | A7GTW9 | tRNA (guanine-N(7)-)-methyltransferase | 9.90e-07 | 6.28e-08 | NA | NA |
5. P | Q7MZ81 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.93e-05 | 9.73e-04 | NA | NA |
5. P | A1KG35 | Demethylmenaquinone methyltransferase | 1.73e-04 | 1.11e-02 | NA | NA |
5. P | C3K6Z4 | Carboxy-S-adenosyl-L-methionine synthase | 3.29e-04 | 1.83e-02 | NA | NA |
5. P | A0A0D4BSP3 | N-demethylindolmycin N-methyltransferase | 2.85e-04 | 1.10e-06 | NA | NA |
5. P | B7J8G6 | Ribosomal RNA large subunit methyltransferase E | 1.55e-04 | 1.68e-03 | NA | NA |
5. P | Q3KKL0 | tRNA (guanine-N(7)-)-methyltransferase | 3.44e-05 | 2.45e-07 | NA | NA |
5. P | A1SE26 | Demethylmenaquinone methyltransferase | 1.33e-04 | 1.28e-02 | NA | NA |
5. P | Q5ZT34 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.38e-07 | 1.88e-02 | NA | NA |
5. P | Q0SVU9 | tRNA (guanine-N(7)-)-methyltransferase | 1.60e-06 | 1.62e-06 | NA | NA |
5. P | B6IZD5 | Ribosomal RNA large subunit methyltransferase E | 2.24e-04 | 1.31e-02 | NA | NA |
5. P | B1MZE7 | tRNA (guanine-N(7)-)-methyltransferase | 1.87e-06 | 3.43e-06 | NA | NA |
5. P | B1J4E5 | Carboxy-S-adenosyl-L-methionine synthase | 5.25e-04 | 1.16e-03 | NA | NA |
5. P | A1U9D7 | Uncharacterized methyltransferase Mkms_0228 | 3.62e-04 | 3.29e-02 | NA | NA |
5. P | A5VKZ3 | tRNA (guanine-N(7)-)-methyltransferase | 7.75e-07 | 2.10e-06 | NA | NA |
5. P | Q7U9H3 | tRNA (guanine-N(7)-)-methyltransferase | 2.22e-05 | 2.27e-03 | NA | NA |
5. P | A5E888 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.07e-05 | 4.43e-03 | NA | NA |
5. P | B6EGJ0 | Carboxy-S-adenosyl-L-methionine synthase | 4.09e-05 | 4.41e-02 | NA | NA |
5. P | A6UFF7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.09e-05 | 4.16e-03 | NA | NA |
5. P | B1LD01 | Carboxy-S-adenosyl-L-methionine synthase | 1.62e-04 | 1.27e-03 | NA | NA |
5. P | B2TVI4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.45e-05 | 5.09e-04 | NA | NA |
5. P | B5YY82 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.11e-05 | 5.09e-04 | NA | NA |
5. P | A9ILA7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 9.43e-06 | 3.09e-03 | NA | NA |
5. P | Q6HCI1 | tRNA (guanine-N(7)-)-methyltransferase | 1.67e-06 | 8.26e-07 | NA | NA |
5. P | Q12S23 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.40e-05 | 1.59e-03 | NA | NA |
5. P | Q6DC37 | Histamine N-methyltransferase | 5.42e-05 | 5.74e-03 | NA | NA |
5. P | A1VYV0 | Carboxy-S-adenosyl-L-methionine synthase | 2.87e-04 | 1.36e-04 | NA | NA |
5. P | B2AH07 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 4.32e-03 | NA | NA |
5. P | B6J802 | Ribosomal RNA large subunit methyltransferase E | 2.42e-04 | 1.61e-02 | NA | NA |
5. P | Q31UF3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.83e-05 | 5.09e-04 | NA | NA |
5. P | Q5KXU0 | Demethylmenaquinone methyltransferase | 2.45e-05 | 2.71e-06 | NA | NA |
5. P | B0U6V1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.96e-05 | 1.76e-03 | NA | NA |
5. P | A6VDI6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.06e-05 | 2.92e-04 | NA | NA |
5. P | A6TGL3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.85e-05 | 8.21e-05 | NA | NA |
5. P | B7M638 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.55e-05 | 5.09e-04 | NA | NA |
5. P | B1IA75 | tRNA (guanine-N(7)-)-methyltransferase | 1.34e-06 | 1.88e-06 | NA | NA |
5. P | Q8Y278 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.71e-05 | 5.59e-03 | NA | NA |
5. P | A6VQB0 | Carboxy-S-adenosyl-L-methionine synthase | 2.19e-04 | 1.01e-02 | NA | NA |
5. P | Q749W5 | Malonyl-[acyl-carrier protein] O-methyltransferase | 7.41e-08 | 2.29e-02 | NA | NA |
5. P | B9LZA9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 5.64e-10 | 3.33e-03 | NA | NA |
5. P | A4VGE5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.79e-05 | 1.10e-03 | NA | NA |
5. P | A4IRW9 | tRNA (guanine-N(7)-)-methyltransferase | 8.92e-07 | 1.40e-08 | NA | NA |
5. P | Q48RU3 | tRNA (guanine-N(7)-)-methyltransferase | 8.64e-07 | 1.31e-05 | NA | NA |
5. P | Q3AMX6 | tRNA (guanine-N(7)-)-methyltransferase | 2.72e-05 | 1.04e-02 | NA | NA |
5. P | A4JHS6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.66e-05 | 6.95e-04 | NA | NA |
5. P | B5FNW6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.59e-05 | 1.68e-04 | NA | NA |
5. P | Q73L97 | Ribosomal RNA large subunit methyltransferase E | 5.03e-05 | 1.00e-03 | NA | NA |
5. P | Q65G12 | tRNA (guanine-N(7)-)-methyltransferase | 1.29e-06 | 3.31e-07 | NA | NA |
5. P | C0Z787 | Malonyl-[acyl-carrier protein] O-methyltransferase | 1.31e-08 | 4.34e-02 | NA | NA |
5. P | Q0V9P1 | Histamine N-methyltransferase | 7.09e-05 | 2.91e-03 | NA | NA |
5. P | P67500 | tRNA (guanine-N(7)-)-methyltransferase | 8.76e-07 | 1.75e-06 | NA | NA |
5. P | A4Y2Q5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.48e-05 | 4.39e-03 | NA | NA |
5. P | Q98GV1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 9.34e-06 | 1.38e-02 | NA | NA |
6. F | Q088J8 | Ribosomal protein L11 methyltransferase | 1.46e-08 | NA | NA | 0.6394 |
6. F | B3QLQ8 | Ribosomal protein L11 methyltransferase | 5.88e-09 | NA | NA | 0.5595 |
6. F | A5HY34 | Release factor glutamine methyltransferase | 5.78e-13 | NA | NA | 0.7202 |
6. F | Q033A6 | Ribosomal protein L11 methyltransferase | 1.40e-09 | NA | NA | 0.6821 |
6. F | A1SAM0 | Ribosomal protein L11 methyltransferase | 2.84e-08 | NA | NA | 0.6684 |
6. F | Q74G05 | Ribosomal protein L11 methyltransferase | 5.32e-09 | NA | NA | 0.6691 |
6. F | Q8PD33 | Ribosomal protein L11 methyltransferase | 4.42e-08 | NA | NA | 0.633 |
6. F | Q875K1 | Sterol 24-C-methyltransferase | 5.07e-08 | NA | NA | 0.615 |
6. F | B7JN37 | Ribosomal protein L11 methyltransferase | 1.34e-10 | NA | NA | 0.6634 |
6. F | Q1CMJ1 | Ribosomal RNA large subunit methyltransferase G | 1.24e-09 | NA | NA | 0.6833 |
6. F | B1XHD9 | tRNA U34 carboxymethyltransferase | 5.30e-08 | NA | NA | 0.5131 |
6. F | C4K4P6 | Ribosomal protein L11 methyltransferase | 2.02e-08 | NA | NA | 0.629 |
6. F | B3GYL9 | Ribosomal protein L11 methyltransferase | 1.67e-08 | NA | NA | 0.6603 |
6. F | Q71ZJ9 | Ribosomal protein L11 methyltransferase | 5.66e-10 | NA | NA | 0.6285 |
6. F | B2A578 | Protein-L-isoaspartate O-methyltransferase | 2.52e-07 | NA | NA | 0.6409 |
6. F | A5ITA6 | Ribosomal protein L11 methyltransferase | 5.51e-10 | NA | NA | 0.6301 |
6. F | A8A172 | tRNA U34 carboxymethyltransferase | 4.73e-08 | NA | NA | 0.5146 |
6. F | Q0K956 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 8.77e-07 | NA | NA | 0.6263 |
6. F | Q5FH30 | Ribosomal RNA small subunit methyltransferase A | 8.74e-07 | NA | NA | 0.4687 |
6. F | Q8DHV7 | Release factor glutamine methyltransferase | 1.67e-12 | NA | NA | 0.7155 |
6. F | P57136 | Ribosomal RNA small subunit methyltransferase D | 2.71e-10 | NA | NA | 0.6092 |
6. F | O32036 | tRNA 5-hydroxyuridine methyltransferase | 6.00e-09 | NA | NA | 0.4921 |
6. F | Q87AR1 | Ribosomal RNA small subunit methyltransferase B | 5.10e-04 | NA | NA | 0.5906 |
6. F | A7N1I8 | tRNA U34 carboxymethyltransferase | 3.83e-08 | NA | NA | 0.5257 |
6. F | A4YT90 | Ribosomal RNA small subunit methyltransferase A | 2.26e-06 | NA | NA | 0.5311 |
6. F | B4JWL5 | Protein arginine N-methyltransferase 7 | 3.87e-02 | NA | NA | 0.6142 |
6. F | B6EGI9 | tRNA U34 carboxymethyltransferase | 3.18e-08 | NA | NA | 0.5303 |
6. F | A1A2F7 | Ribosomal RNA small subunit methyltransferase H | 9.72e-08 | NA | NA | 0.5154 |
6. F | B5R1C6 | Ribosomal protein L11 methyltransferase | 2.77e-08 | NA | NA | 0.6489 |
6. F | B2USL4 | Ribosomal protein L11 methyltransferase | 2.19e-07 | NA | NA | 0.6166 |
6. F | Q88L39 | Ribosomal RNA large subunit methyltransferase K/L | 3.40e-05 | NA | NA | 0.567 |
6. F | Q8D9F3 | Ribosomal RNA small subunit methyltransferase F | 1.10e-03 | NA | NA | 0.546 |
6. F | P0DJB1 | Release factor glutamine methyltransferase | 1.83e-11 | NA | NA | 0.6517 |
6. F | Q6BRB7 | Sterol 24-C-methyltransferase | 5.55e-08 | NA | NA | 0.59 |
6. F | Q3JYX9 | Ribosomal protein L11 methyltransferase | 8.24e-10 | NA | NA | 0.6282 |
6. F | B5F7P3 | Ribosomal protein L11 methyltransferase | 2.95e-08 | NA | NA | 0.6038 |
6. F | Q32KX8 | Methyltransferase-like 26 | 1.90e-10 | NA | NA | 0.5953 |
6. F | Q0AB25 | Ribosomal protein L11 methyltransferase | 1.40e-09 | NA | NA | 0.6124 |
6. F | Q0RAP0 | Ribosomal RNA small subunit methyltransferase G | 1.11e-06 | NA | NA | 0.6153 |
6. F | A7FID4 | tRNA U34 carboxymethyltransferase | 4.00e-08 | NA | NA | 0.5313 |
6. F | B4F1L5 | Ribosomal RNA small subunit methyltransferase B | 4.17e-04 | NA | NA | 0.5909 |
6. F | Q2SCH1 | Ribosomal RNA large subunit methyltransferase K/L | 5.57e-05 | NA | NA | 0.5595 |
6. F | A5GV37 | Ribosomal protein L11 methyltransferase | 4.08e-09 | NA | NA | 0.666 |
6. F | B2GBW2 | Ribosomal protein L11 methyltransferase | 2.73e-09 | NA | NA | 0.6745 |
6. F | Q99028 | Catechol O-methyltransferase (Fragment) | 1.27e-08 | NA | NA | 0.5672 |
6. F | Q92NN5 | Ribosomal protein L11 methyltransferase | 1.38e-09 | NA | NA | 0.6756 |
6. F | A6U593 | Ribosomal RNA small subunit methyltransferase G | 6.98e-11 | NA | NA | 0.7005 |
6. F | B5FE19 | Ribosomal RNA large subunit methyltransferase K/L | 4.93e-05 | NA | NA | 0.5881 |
6. F | B4XY98 | 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase | 1.34e-07 | NA | NA | 0.5645 |
6. F | A6QHC1 | Ribosomal protein L11 methyltransferase | 8.03e-10 | NA | NA | 0.6289 |
6. F | P0DJO9 | Ribosomal protein L11 methyltransferase | 5.58e-10 | NA | NA | 0.6277 |
6. F | Q8NZ98 | Ribosomal protein L11 methyltransferase | 1.09e-09 | NA | NA | 0.5898 |
6. F | B5ZWH3 | Ribosomal protein L11 methyltransferase | 2.98e-10 | NA | NA | 0.6339 |
6. F | Q759S7 | Sterol 24-C-methyltransferase | 5.64e-08 | NA | NA | 0.5991 |
6. F | C1DCV9 | Ribosomal protein L11 methyltransferase | 2.42e-08 | NA | NA | 0.6111 |
6. F | Q46ZH7 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.45e-06 | NA | NA | 0.6397 |
6. F | Q665P6 | Ribosomal RNA large subunit methyltransferase G | 1.22e-09 | NA | NA | 0.6835 |
6. F | B5Z809 | tRNA U34 carboxymethyltransferase | 1.75e-09 | NA | NA | 0.5679 |
6. F | A4TJK9 | tRNA U34 carboxymethyltransferase | 3.98e-08 | NA | NA | 0.5332 |
6. F | A1U3K1 | Ubiquinone biosynthesis O-methyltransferase | 2.79e-10 | NA | NA | 0.6107 |
6. F | Q730M3 | Ribosomal protein L11 methyltransferase | 2.43e-10 | NA | NA | 0.6632 |
6. F | F0NBH8 | Protein-lysine N-methyltransferase | 2.57e-09 | NA | NA | 0.6407 |
6. F | Q1QKW0 | Ribosomal RNA small subunit methyltransferase A | 3.12e-06 | NA | NA | 0.5268 |
6. F | B5R8D1 | tRNA U34 carboxymethyltransferase | 3.40e-08 | NA | NA | 0.5166 |
6. F | Q1CUC6 | Ribosomal protein L11 methyltransferase | 1.55e-07 | NA | NA | 0.5329 |
6. F | Q57J85 | Ribosomal protein L11 methyltransferase | 2.54e-08 | NA | NA | 0.649 |
6. F | A9MNH4 | Ribosomal RNA small subunit methyltransferase F | 7.66e-04 | NA | NA | 0.5405 |
6. F | Q5HCI5 | Ribosomal RNA small subunit methyltransferase G | 9.07e-11 | NA | NA | 0.7017 |
6. F | B4SV89 | Ribosomal RNA small subunit methyltransferase F | 5.25e-04 | NA | NA | 0.5412 |
6. F | Q7MKX1 | Ribosomal RNA large subunit methyltransferase K/L | 4.02e-05 | NA | NA | 0.6195 |
6. F | Q5MZ45 | Ribosomal protein L11 methyltransferase | 2.89e-09 | NA | NA | 0.6603 |
6. F | Q5QX63 | Ribosomal RNA large subunit methyltransferase K/L | 2.97e-05 | NA | NA | 0.6221 |
6. F | B6I1X9 | Ribosomal protein L11 methyltransferase | 3.07e-08 | NA | NA | 0.6154 |
6. F | Q0HQK1 | Ribosomal protein L11 methyltransferase | 1.14e-08 | NA | NA | 0.6679 |
6. F | B9IY79 | Ribosomal protein L11 methyltransferase | 2.22e-10 | NA | NA | 0.6527 |
6. F | A1RJQ9 | tRNA U34 carboxymethyltransferase | 8.44e-08 | NA | NA | 0.5379 |
6. F | Q2P856 | Ribosomal protein L11 methyltransferase | 4.93e-08 | NA | NA | 0.5972 |
6. F | Q16VC0 | tRNA (guanine(37)-N1)-methyltransferase | 3.10e-05 | NA | NA | 0.5068 |
6. F | Q3KFC5 | Ribosomal RNA large subunit methyltransferase K/L | 5.20e-05 | NA | NA | 0.5661 |
6. F | A0KWL2 | tRNA U34 carboxymethyltransferase | 8.80e-08 | NA | NA | 0.5012 |
6. F | Q7U6V8 | Uncharacterized RNA methyltransferase SYNW1228 | 3.85e-07 | NA | NA | 0.6521 |
6. F | D3KYU3 | Geranyl diphosphate 2-C-methyltransferase | 8.85e-10 | NA | NA | 0.5584 |
6. F | Q83R57 | tRNA U34 carboxymethyltransferase | 4.72e-08 | NA | NA | 0.5173 |
6. F | B6YX51 | Protein-L-isoaspartate O-methyltransferase | 1.01e-05 | NA | NA | 0.5884 |
6. F | B7NDN7 | Ribosomal protein L11 methyltransferase | 3.20e-08 | NA | NA | 0.6487 |
6. F | A6TB40 | tRNA U34 carboxymethyltransferase | 5.09e-08 | NA | NA | 0.5208 |
6. F | Q65UK6 | Ribosomal RNA large subunit methyltransferase K/L | 3.97e-05 | NA | NA | 0.6052 |
6. F | B7KJ88 | Ribosomal protein L11 methyltransferase | 1.08e-09 | NA | NA | 0.6906 |
6. F | B0KG92 | Ribosomal RNA large subunit methyltransferase K/L | 4.08e-05 | NA | NA | 0.546 |
6. F | B4SUN8 | Ribosomal protein L11 methyltransferase | 2.50e-08 | NA | NA | 0.649 |
6. F | Q4ZUM1 | Ribosomal RNA large subunit methyltransferase K/L | 3.66e-05 | NA | NA | 0.5681 |
6. F | Q0TCJ7 | Ribosomal protein L11 methyltransferase | 2.79e-08 | NA | NA | 0.6038 |
6. F | B0CN31 | L-tyrosine C(3)-methyltransferase | 2.37e-08 | NA | NA | 0.5618 |
6. F | Q0HIZ8 | tRNA U34 carboxymethyltransferase | 9.26e-08 | NA | NA | 0.4977 |
6. F | A7X7A5 | Ribosomal RNA small subunit methyltransferase G | 7.11e-11 | NA | NA | 0.7023 |
6. F | B7M2G2 | tRNA U34 carboxymethyltransferase | 4.77e-08 | NA | NA | 0.5173 |
6. F | B8EA68 | tRNA U34 carboxymethyltransferase | 7.27e-08 | NA | NA | 0.5363 |
6. F | Q57C92 | Ribosomal protein L11 methyltransferase | 4.41e-08 | NA | NA | 0.693 |
6. F | B4QI55 | Protein arginine N-methyltransferase 7 | 5.88e-02 | NA | NA | 0.5406 |
6. F | A1TZG2 | Ribosomal RNA large subunit methyltransferase K/L | 9.37e-05 | NA | NA | 0.5349 |
6. F | B4TXB2 | Ribosomal RNA small subunit methyltransferase B | 8.47e-05 | NA | NA | 0.651 |
6. F | Q12S38 | Ribosomal protein L11 methyltransferase | 1.21e-08 | NA | NA | 0.6405 |
6. F | A1SST4 | tRNA U34 carboxymethyltransferase | 4.95e-06 | NA | NA | 0.5318 |
6. F | Q6CYB3 | Sterol 24-C-methyltransferase | 6.60e-08 | NA | NA | 0.5919 |
6. F | A4XWP8 | Ribosomal RNA large subunit methyltransferase K/L | 4.64e-05 | NA | NA | 0.6044 |
6. F | Q9F1Y5 | Geranyl diphosphate 2-C-methyltransferase | 6.00e-10 | NA | NA | 0.5645 |
6. F | Q2L016 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.55e-06 | NA | NA | 0.5705 |
6. F | Q6G8Y9 | Ribosomal protein L11 methyltransferase | 5.59e-10 | NA | NA | 0.6302 |
6. F | Q2YT49 | Ribosomal protein L11 methyltransferase | 5.43e-10 | NA | NA | 0.6301 |
6. F | C0Q2E3 | tRNA U34 carboxymethyltransferase | 3.41e-08 | NA | NA | 0.5169 |
6. F | A5UJR5 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 2.71e-11 | NA | NA | 0.6683 |
6. F | Q7NWP9 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 4.29e-06 | NA | NA | 0.5755 |
6. F | Q2FDF0 | Ribosomal RNA small subunit methyltransferase G | 8.59e-11 | NA | NA | 0.7005 |
6. F | Q3MHN8 | tRNA (guanine(37)-N1)-methyltransferase | 4.49e-04 | NA | NA | 0.4918 |
6. F | B5F3I4 | tRNA U34 carboxymethyltransferase | 3.76e-08 | NA | NA | 0.5168 |
6. F | A9L4E6 | Ribosomal RNA small subunit methyltransferase F | 5.82e-04 | NA | NA | 0.5199 |
6. F | B3NP10 | Protein arginine N-methyltransferase 7 | 4.97e-02 | NA | NA | 0.5409 |
6. F | B0B9D1 | Release factor glutamine methyltransferase | 2.73e-11 | NA | NA | 0.6759 |
6. F | Q1CA17 | Ribosomal RNA large subunit methyltransferase I | 2.37e-08 | NA | NA | 0.6009 |
6. F | B7HPL1 | Ribosomal protein L11 methyltransferase | 2.10e-10 | NA | NA | 0.6529 |
6. F | Q7U8J1 | Ribosomal RNA small subunit methyltransferase G | 2.98e-10 | NA | NA | 0.6941 |
6. F | Q9UXX0 | Protein-L-isoaspartate O-methyltransferase | 6.66e-06 | NA | NA | 0.5924 |
6. F | Q5X9S8 | Ribosomal protein L11 methyltransferase | 1.48e-09 | NA | NA | 0.6039 |
6. F | Q8U248 | tRNA (guanine(6)-N2)-methyltransferase | 1.36e-05 | NA | NA | 0.6399 |
6. F | Q9CH73 | Ribosomal RNA small subunit methyltransferase H | 1.47e-06 | NA | NA | 0.5156 |
6. F | A9T6G5 | tRNA (guanine(37)-N1)-methyltransferase | 1.15e-02 | NA | NA | 0.5502 |
6. F | Q39ZZ2 | Ribosomal protein L11 methyltransferase | 8.13e-09 | NA | NA | 0.6471 |
6. F | A4TKV4 | Ribosomal RNA large subunit methyltransferase I | 2.26e-08 | NA | NA | 0.5838 |
6. F | Q727D9 | Release factor glutamine methyltransferase | 1.27e-12 | NA | NA | 0.6908 |
6. F | Q8EJR7 | Ribosomal protein L11 methyltransferase | 1.22e-08 | NA | NA | 0.6679 |
6. F | A4QDG2 | Release factor glutamine methyltransferase | 1.45e-11 | NA | NA | 0.6369 |
6. F | Q65V70 | Ribosomal protein L11 methyltransferase | 1.79e-08 | NA | NA | 0.6149 |
6. F | B5FCP7 | tRNA U34 carboxymethyltransferase | 4.07e-08 | NA | NA | 0.5189 |
6. F | Q887M4 | Ribosomal RNA large subunit methyltransferase F | 4.09e-09 | NA | NA | 0.5093 |
6. F | B7NLI5 | Ribosomal protein L11 methyltransferase | 2.68e-08 | NA | NA | 0.6355 |
6. F | Q1LLI5 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.56e-06 | NA | NA | 0.6229 |
6. F | B8I303 | Ribosomal protein L11 methyltransferase | 5.78e-10 | NA | NA | 0.6714 |
6. F | Q1JJU1 | Ribosomal protein L11 methyltransferase | 1.16e-09 | NA | NA | 0.6302 |
6. F | B5YR16 | tRNA U34 carboxymethyltransferase | 4.78e-08 | NA | NA | 0.5071 |
6. F | B7IC17 | Ribosomal protein L11 methyltransferase | 9.60e-09 | NA | NA | 0.6333 |
6. F | B0TAD9 | Ribosomal protein L11 methyltransferase | 4.04e-10 | NA | NA | 0.68 |
6. F | B4TYS9 | tRNA U34 carboxymethyltransferase | 3.11e-08 | NA | NA | 0.5167 |
6. F | A2E5K9 | tRNA (guanine(37)-N1)-methyltransferase | 4.72e-07 | NA | NA | 0.5698 |
6. F | Q6F0I4 | Release factor glutamine methyltransferase | 4.85e-10 | NA | NA | 0.632 |
6. F | Q6LQU5 | Ribosomal RNA small subunit methyltransferase F | 7.32e-04 | NA | NA | 0.563 |
6. F | B7MBT0 | tRNA U34 carboxymethyltransferase | 3.38e-08 | NA | NA | 0.5131 |
6. F | B7USP8 | tRNA U34 carboxymethyltransferase | 3.44e-08 | NA | NA | 0.5255 |
6. F | B6IBR3 | Ribosomal RNA small subunit methyltransferase F | 4.96e-04 | NA | NA | 0.557 |
6. F | B0BRD1 | Ribosomal protein L11 methyltransferase | 1.73e-08 | NA | NA | 0.6602 |
6. F | Q2NWP9 | Ribosomal protein L11 methyltransferase | 3.62e-08 | NA | NA | 0.6477 |
6. F | Q8YVT3 | Ribosomal protein L11 methyltransferase | 2.00e-09 | NA | NA | 0.6491 |
6. F | Q96WX4 | Sterol 24-C-methyltransferase | 7.76e-08 | NA | NA | 0.6178 |
6. F | Q1J4K0 | Ribosomal protein L11 methyltransferase | 9.45e-10 | NA | NA | 0.6716 |
6. F | A1K4G2 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.03e-06 | NA | NA | 0.6593 |
6. F | A1RIZ0 | Ribosomal RNA small subunit methyltransferase F | 5.47e-04 | NA | NA | 0.5261 |
6. F | A1WYK5 | Ribosomal protein L11 methyltransferase | 5.79e-08 | NA | NA | 0.6615 |
6. F | Q0ATU7 | Ribosomal RNA small subunit methyltransferase G | 5.80e-10 | NA | NA | 0.6276 |
6. F | Q1LIT8 | Ribosomal protein L11 methyltransferase | 8.60e-08 | NA | NA | 0.6046 |
6. F | Q99MI9 | Protein arginine N-methyltransferase 7 | 8.06e-03 | NA | NA | 0.3881 |
6. F | Q12Y46 | tRNA (guanine(26)-N(2))-dimethyltransferase | 5.29e-06 | NA | NA | 0.5756 |
6. F | Q9JXW2 | Ribosomal protein L11 methyltransferase | 1.33e-06 | NA | NA | 0.6357 |
6. F | A7ZMZ6 | tRNA U34 carboxymethyltransferase | 5.20e-08 | NA | NA | 0.5172 |
6. F | B7LPH3 | tRNA U34 carboxymethyltransferase | 3.51e-08 | NA | NA | 0.5209 |
6. F | P44402 | Ribosomal protein L11 methyltransferase | 1.77e-08 | NA | NA | 0.6162 |
6. F | A4WBM8 | tRNA U34 carboxymethyltransferase | 3.63e-08 | NA | NA | 0.5283 |
6. F | Q81LS4 | Ribosomal protein L11 methyltransferase | 1.93e-10 | NA | NA | 0.663 |
6. F | B9JXT0 | Ribosomal protein L11 methyltransferase | 4.84e-10 | NA | NA | 0.6145 |
6. F | B4GA28 | Protein arginine N-methyltransferase 7 | 4.13e-02 | NA | NA | 0.5435 |
6. F | Q66CE0 | Ribosomal RNA large subunit methyltransferase I | 2.52e-08 | NA | NA | 0.5859 |
6. F | A8GDM6 | Ribosomal RNA small subunit methyltransferase F | 6.75e-04 | NA | NA | 0.5653 |
6. F | B1XKZ0 | Ribosomal protein L11 methyltransferase | 2.40e-09 | NA | NA | 0.6638 |
6. F | B5REY1 | Ribosomal protein L11 methyltransferase | 3.32e-08 | NA | NA | 0.649 |
6. F | B0CHK5 | Ribosomal protein L11 methyltransferase | 4.26e-08 | NA | NA | 0.6935 |
6. F | Q8EDY2 | Ribosomal RNA small subunit methyltransferase F | 2.33e-04 | NA | NA | 0.5114 |
6. F | Q8XCH5 | tRNA U34 carboxymethyltransferase | 3.60e-08 | NA | NA | 0.5173 |
6. F | Q38XN3 | Ribosomal RNA small subunit methyltransferase H | 1.27e-06 | NA | NA | 0.4931 |
6. F | B0V7H8 | Ribosomal protein L11 methyltransferase | 1.11e-08 | NA | NA | 0.6416 |
6. F | Q1H069 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.80e-06 | NA | NA | 0.6266 |
6. F | Q5PJW5 | Ribosomal protein L11 methyltransferase | 3.25e-08 | NA | NA | 0.6487 |
6. F | Q3J2B9 | Ribosomal RNA small subunit methyltransferase A | 1.34e-04 | NA | NA | 0.5637 |
6. F | Q8RI89 | Ribosomal RNA small subunit methyltransferase G | 7.22e-11 | NA | NA | 0.6943 |
6. F | Q6LLY5 | Ribosomal protein L11 methyltransferase | 1.50e-08 | NA | NA | 0.6329 |
6. F | A5VZ65 | Ribosomal RNA large subunit methyltransferase F | 1.57e-09 | NA | NA | 0.5044 |
6. F | B0KQK4 | Ribosomal RNA large subunit methyltransferase F | 1.55e-09 | NA | NA | 0.5184 |
6. F | K4RFM2 | 8-amino-8-demethylriboflavin N,N-dimethyltransferase | 1.05e-07 | NA | NA | 0.5055 |
6. F | Q8DNP4 | Ribosomal protein L11 methyltransferase | 1.45e-09 | NA | NA | 0.6571 |
6. F | Q03MQ4 | Ribosomal protein L11 methyltransferase | 1.14e-09 | NA | NA | 0.646 |
6. F | Q66AU8 | tRNA U34 carboxymethyltransferase | 4.00e-08 | NA | NA | 0.531 |
6. F | A1AC32 | tRNA U34 carboxymethyltransferase | 3.30e-08 | NA | NA | 0.51 |
6. F | Q54527 | Aclacinomycin 10-hydroxylase RdmB | 6.84e-09 | NA | NA | 0.5637 |
6. F | A1V0M1 | Ribosomal protein L11 methyltransferase | 9.71e-08 | NA | NA | 0.5952 |
6. F | Q2RWE0 | Release factor glutamine methyltransferase | 1.66e-09 | NA | NA | 0.6459 |
6. F | Q2GGH6 | Ribosomal RNA small subunit methyltransferase A | 8.02e-07 | NA | NA | 0.4727 |
6. F | B7NBM2 | tRNA U34 carboxymethyltransferase | 4.16e-08 | NA | NA | 0.5239 |
6. F | A5EX48 | Ribosomal RNA large subunit methyltransferase K/L | 3.53e-05 | NA | NA | 0.5506 |
6. F | B1JLA4 | Ribosomal RNA large subunit methyltransferase G | 7.07e-09 | NA | NA | 0.6217 |
6. F | A5EXR9 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 8.95e-07 | NA | NA | 0.6703 |
6. F | A8FUW3 | tRNA U34 carboxymethyltransferase | 7.51e-06 | NA | NA | 0.5257 |
6. F | Q5FUK3 | Ribosomal RNA small subunit methyltransferase H | 6.68e-05 | NA | NA | 0.4647 |
6. F | Q8YI53 | Ribosomal protein L11 methyltransferase | 3.71e-08 | NA | NA | 0.6931 |
6. F | H2E7U0 | Sterol methyltransferase-like 3 | 7.04e-08 | NA | NA | 0.5855 |
6. F | C3LMI5 | Ribosomal RNA small subunit methyltransferase F | 2.84e-04 | NA | NA | 0.5983 |
6. F | Q9KJ20 | Glycine/sarcosine/dimethylglycine N-methyltransferase | 2.20e-04 | NA | NA | 0.6036 |
6. F | Q62JV9 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.45e-06 | NA | NA | 0.5908 |
6. F | P73820 | Ribosomal protein L11 methyltransferase | 1.45e-09 | NA | NA | 0.688 |
6. F | A0KIF5 | tRNA U34 carboxymethyltransferase | 5.99e-06 | NA | NA | 0.5212 |
6. F | Q081N2 | tRNA U34 carboxymethyltransferase | 6.88e-06 | NA | NA | 0.5199 |
6. F | B0TIZ6 | Ribosomal RNA small subunit methyltransferase F | 1.13e-03 | NA | NA | 0.5716 |
6. F | A3KI18 | Geranyl diphosphate 2-C-methyltransferase | 6.04e-10 | NA | NA | 0.5367 |
6. F | Q7VDL7 | Release factor glutamine methyltransferase | 1.49e-12 | NA | NA | 0.6809 |
6. F | Q1CJH4 | tRNA U34 carboxymethyltransferase | 4.07e-08 | NA | NA | 0.5332 |
6. F | Q8G4R0 | Ribosomal RNA small subunit methyltransferase H | 1.37e-05 | NA | NA | 0.526 |
6. F | Q8TZR3 | Protein-L-isoaspartate O-methyltransferase | 8.99e-06 | NA | NA | 0.5874 |
6. F | Q7VPN5 | Ribosomal protein L11 methyltransferase | 2.32e-08 | NA | NA | 0.6551 |
6. F | A7MEB0 | tRNA U34 carboxymethyltransferase | 3.19e-08 | NA | NA | 0.5191 |
6. F | A1SX09 | Ribosomal RNA large subunit methyltransferase K/L | 2.95e-05 | NA | NA | 0.6278 |
6. F | Q7U1J9 | Cyclopropane mycolic acid synthase MmaA2 | 2.17e-08 | NA | NA | 0.6061 |
6. F | Q984S7 | Ribosomal RNA small subunit methyltransferase A | 9.96e-04 | NA | NA | 0.5099 |
6. F | A0CC46 | tRNA (guanine(37)-N1)-methyltransferase | 5.78e-07 | NA | NA | 0.5734 |
6. F | Q6MU88 | Release factor glutamine methyltransferase | 1.37e-10 | NA | NA | 0.6469 |
6. F | B7L7S4 | tRNA U34 carboxymethyltransferase | 3.83e-08 | NA | NA | 0.5172 |
6. F | C6DFE2 | tRNA U34 carboxymethyltransferase | 4.31e-08 | NA | NA | 0.5266 |
6. F | P54471 | tRNA (adenine(22)-N(1))-methyltransferase | 7.56e-09 | NA | NA | 0.6712 |
6. F | Q2NQQ2 | Ribosomal RNA small subunit methyltransferase B | 4.31e-04 | NA | NA | 0.5831 |
6. F | Q3BY72 | Ribosomal protein L11 methyltransferase | 5.90e-08 | NA | NA | 0.6071 |
6. F | Q4UZB8 | Ribosomal protein L11 methyltransferase | 9.81e-08 | NA | NA | 0.6342 |
6. F | Q2FSA9 | Probable ribosomal RNA small subunit methyltransferase A | 4.40e-06 | NA | NA | 0.5129 |
6. F | B5DZN7 | Protein arginine N-methyltransferase 7 | 4.04e-02 | NA | NA | 0.5437 |
6. F | Q2S0V8 | Release factor glutamine methyltransferase | 1.41e-10 | NA | NA | 0.6639 |
6. F | Q6PCI6 | Protein arginine N-methyltransferase 7 | 5.31e-03 | NA | NA | 0.4334 |
6. F | P0A8T2 | Ribosomal protein L11 methyltransferase | 2.87e-08 | NA | NA | 0.6041 |
6. F | A0KKI5 | Ribosomal RNA small subunit methyltransferase F | 5.80e-04 | NA | NA | 0.5284 |
6. F | A1RFA3 | Ribosomal protein L11 methyltransferase | 1.44e-08 | NA | NA | 0.6693 |
6. F | Q466T6 | tRNA (guanine(26)-N(2))-dimethyltransferase | 1.34e-06 | NA | NA | 0.5618 |
6. F | Q8E307 | Ribosomal protein L11 methyltransferase | 1.04e-09 | NA | NA | 0.5919 |
6. F | B8DE40 | Ribosomal protein L11 methyltransferase | 5.83e-10 | NA | NA | 0.6281 |
6. F | Q03SF4 | Ribosomal protein L11 methyltransferase | 1.36e-09 | NA | NA | 0.6912 |
6. F | Q1W3E0 | Ribosomal RNA large subunit methyltransferase K/L | 6.50e-05 | NA | NA | 0.5473 |
6. F | Q5GSM9 | Ribosomal RNA small subunit methyltransferase A | 2.18e-06 | NA | NA | 0.486 |
6. F | A8AQF7 | Ribosomal protein L11 methyltransferase | 3.20e-08 | NA | NA | 0.6486 |
6. F | A3D5D5 | Ribosomal RNA small subunit methyltransferase F | 2.12e-04 | NA | NA | 0.5127 |
6. F | B1IQ33 | Ribosomal protein L11 methyltransferase | 2.19e-08 | NA | NA | 0.6493 |
6. F | Q5PHN5 | Ribosomal RNA small subunit methyltransferase F | 2.79e-04 | NA | NA | 0.5187 |
6. F | Q0WJ78 | Ribosomal RNA large subunit methyltransferase G | 1.37e-09 | NA | NA | 0.6293 |
6. F | B5FIW1 | Ribosomal protein L11 methyltransferase | 2.74e-08 | NA | NA | 0.649 |
6. F | C6A3F2 | Protein-L-isoaspartate O-methyltransferase | 3.87e-08 | NA | NA | 0.6331 |
6. F | Q3IIC0 | Ribosomal protein L11 methyltransferase | 1.66e-08 | NA | NA | 0.5972 |
6. F | D5GN29 | tRNA (guanine(37)-N1)-methyltransferase | 4.77e-05 | NA | NA | 0.4006 |
6. F | Q6AQF1 | Ribosomal protein L11 methyltransferase | 1.72e-10 | NA | NA | 0.6554 |
6. F | A4Y6S2 | tRNA U34 carboxymethyltransferase | 7.44e-08 | NA | NA | 0.5351 |
6. F | P60092 | Ribosomal protein L11 methyltransferase | 2.17e-08 | NA | NA | 0.6505 |
6. F | A9R2N9 | Ribosomal RNA large subunit methyltransferase I | 2.25e-08 | NA | NA | 0.5914 |
6. F | Q5F5B4 | Release factor glutamine methyltransferase | 5.39e-12 | NA | NA | 0.7279 |
6. F | A6VW36 | Ribosomal RNA large subunit methyltransferase K/L | 3.12e-05 | NA | NA | 0.5503 |
6. F | A8A570 | Ribosomal protein L11 methyltransferase | 2.41e-08 | NA | NA | 0.6157 |
6. F | Q6HDK9 | Ribosomal protein L11 methyltransferase | 2.33e-10 | NA | NA | 0.6634 |
6. F | B7LHW6 | Ribosomal protein L11 methyltransferase | 2.97e-08 | NA | NA | 0.649 |
6. F | Q6D482 | tRNA U34 carboxymethyltransferase | 4.00e-08 | NA | NA | 0.5289 |
6. F | Q9PEV0 | Ribosomal RNA small subunit methyltransferase B | 3.59e-04 | NA | NA | 0.6104 |
6. F | B1J0L7 | tRNA U34 carboxymethyltransferase | 4.89e-08 | NA | NA | 0.5171 |
6. F | C6DY35 | Ribosomal protein L11 methyltransferase | 4.72e-09 | NA | NA | 0.6538 |
6. F | B2VL75 | Ribosomal protein L11 methyltransferase | 2.30e-08 | NA | NA | 0.6367 |
6. F | Q1ME53 | Ribosomal protein L11 methyltransferase | 1.51e-10 | NA | NA | 0.6908 |
6. F | B4U5A5 | Ribosomal protein L11 methyltransferase | 6.14e-10 | NA | NA | 0.6442 |
6. F | Q7NIP7 | Ribosomal protein L11 methyltransferase | 2.08e-09 | NA | NA | 0.6696 |
6. F | B7M0X1 | Ribosomal protein L11 methyltransferase | 2.52e-08 | NA | NA | 0.6489 |
6. F | Q6FRZ7 | Sterol 24-C-methyltransferase | 5.68e-08 | NA | NA | 0.5807 |
6. F | A7GT06 | Ribosomal protein L11 methyltransferase | 3.24e-10 | NA | NA | 0.6684 |
6. F | Q12N03 | tRNA U34 carboxymethyltransferase | 6.42e-08 | NA | NA | 0.5344 |
6. F | Q8TYL4 | Protein-L-isoaspartate O-methyltransferase | 3.21e-05 | NA | NA | 0.5794 |
6. F | Q6C2D9 | Sterol 24-C-methyltransferase | 1.29e-07 | NA | NA | 0.6066 |
6. F | Q31W09 | Ribosomal protein L11 methyltransferase | 2.91e-08 | NA | NA | 0.6043 |
6. F | Q8EPW5 | Ribosomal protein L11 methyltransferase | 9.91e-10 | NA | NA | 0.6773 |
6. F | A6WGM8 | Ribosomal RNA small subunit methyltransferase G | 7.11e-07 | NA | NA | 0.5888 |
6. F | Q818F1 | Ribosomal protein L11 methyltransferase | 2.62e-10 | NA | NA | 0.6632 |
6. F | Q95KJ2 | tRNA (guanine(37)-N1)-methyltransferase | 6.65e-04 | NA | NA | 0.5114 |
6. F | Q6GD94 | Ribosomal RNA small subunit methyltransferase G | 8.78e-11 | NA | NA | 0.7003 |
6. F | Q3IBW7 | Ribosomal RNA large subunit methyltransferase F | 1.96e-08 | NA | NA | 0.5736 |
6. F | Q6G5W6 | Ribosomal RNA small subunit methyltransferase G | 8.71e-11 | NA | NA | 0.7005 |
6. F | B9LFP4 | Ribosomal protein L11 methyltransferase | 2.12e-09 | NA | NA | 0.6026 |
6. F | B4RRY8 | Ribosomal RNA large subunit methyltransferase I | 1.72e-08 | NA | NA | 0.608 |
6. F | Q4L2Z4 | Ribosomal RNA small subunit methyltransferase G | 2.07e-10 | NA | NA | 0.6614 |
6. F | A7IJ80 | Ribosomal RNA small subunit methyltransferase A | 2.03e-04 | NA | NA | 0.5806 |
6. F | B4EX23 | Ribosomal protein L11 methyltransferase | 2.62e-08 | NA | NA | 0.6584 |
6. F | A9MNA2 | Ribosomal protein L11 methyltransferase | 2.63e-08 | NA | NA | 0.6379 |
6. F | B9E8Z2 | Ribosomal RNA small subunit methyltransferase G | 7.70e-11 | NA | NA | 0.6615 |
6. F | Q8NUF9 | Ribosomal RNA small subunit methyltransferase G | 8.61e-11 | NA | NA | 0.7005 |
6. F | P74003 | Release factor glutamine methyltransferase | 6.32e-12 | NA | NA | 0.7146 |
6. F | Q2Y6W3 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.23e-06 | NA | NA | 0.6134 |
6. F | P16559 | Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN | 7.30e-06 | NA | NA | 0.5356 |
6. F | A1U698 | Ribosomal protein L11 methyltransferase | 2.68e-08 | NA | NA | 0.5993 |
6. F | B7NS47 | tRNA U34 carboxymethyltransferase | 4.82e-08 | NA | NA | 0.5172 |
6. F | B4TX91 | Ribosomal protein L11 methyltransferase | 2.84e-08 | NA | NA | 0.6488 |
6. F | Q3M6M1 | Ribosomal protein L11 methyltransferase | 1.87e-09 | NA | NA | 0.6002 |
6. F | A5GNG2 | Ribosomal RNA small subunit methyltransferase G | 3.01e-10 | NA | NA | 0.6612 |
6. F | Q3IKJ0 | Ribosomal RNA large subunit methyltransferase I | 1.97e-08 | NA | NA | 0.6105 |
6. F | Q0HN86 | Ribosomal protein L11 methyltransferase | 1.22e-08 | NA | NA | 0.668 |
6. F | Q03QH0 | Ribosomal RNA small subunit methyltransferase H | 1.44e-06 | NA | NA | 0.5025 |
6. F | Q8XVP2 | Ribosomal protein L11 methyltransferase | 6.39e-08 | NA | NA | 0.5776 |
6. F | A5WFX2 | Ribosomal protein L11 methyltransferase | 6.25e-09 | NA | NA | 0.6397 |
6. F | Q2YPS7 | Ribosomal protein L11 methyltransferase | 4.51e-08 | NA | NA | 0.6935 |
6. F | Q15ZR4 | Ribosomal protein L11 methyltransferase | 1.91e-08 | NA | NA | 0.6547 |
6. F | A8AFH0 | tRNA U34 carboxymethyltransferase | 3.63e-08 | NA | NA | 0.5187 |
6. F | A9QYY2 | tRNA U34 carboxymethyltransferase | 4.05e-08 | NA | NA | 0.5313 |
6. F | Q2S9L7 | Ribosomal protein L11 methyltransferase | 9.80e-09 | NA | NA | 0.6282 |
6. F | D0NLC2 | tRNA (guanine(37)-N1)-methyltransferase | 2.35e-06 | NA | NA | 0.5481 |
6. F | C8VJ35 | tRNA (guanine(37)-N1)-methyltransferase | 1.40e-05 | NA | NA | 0.5533 |
6. F | B7MW65 | tRNA U34 carboxymethyltransferase | 4.69e-08 | NA | NA | 0.5194 |
6. F | Q8FGQ5 | tRNA U34 carboxymethyltransferase | 4.72e-08 | NA | NA | 0.5207 |
6. F | Q03F44 | Ribosomal protein L11 methyltransferase | 9.01e-10 | NA | NA | 0.6989 |
6. F | Q87KU2 | Ribosomal protein L11 methyltransferase | 2.46e-08 | NA | NA | 0.6264 |
6. F | B4T804 | tRNA U34 carboxymethyltransferase | 3.56e-08 | NA | NA | 0.5066 |
6. F | B7UJZ0 | Ribosomal protein L11 methyltransferase | 2.44e-08 | NA | NA | 0.6493 |
6. F | B2GB73 | Ribosomal RNA small subunit methyltransferase H | 9.88e-07 | NA | NA | 0.5067 |
6. F | C0Q2Y5 | Ribosomal RNA small subunit methyltransferase F | 4.58e-04 | NA | NA | 0.541 |
6. F | Q2YZC0 | Ribosomal RNA small subunit methyltransferase G | 8.77e-11 | NA | NA | 0.7007 |
6. F | Q1J9P3 | Ribosomal protein L11 methyltransferase | 1.09e-09 | NA | NA | 0.6451 |
6. F | P60593 | Polyamine aminopropyltransferase | 3.47e-06 | NA | NA | 0.5783 |
6. F | Q48JX8 | Ribosomal RNA large subunit methyltransferase K/L | 4.34e-05 | NA | NA | 0.5392 |
6. F | Q8ZZA9 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 4.62e-12 | NA | NA | 0.6391 |
6. F | Q4WX30 | tRNA (guanine(37)-N1)-methyltransferase | 8.59e-03 | NA | NA | 0.5182 |
6. F | A3PJZ3 | Ribosomal RNA small subunit methyltransferase A | 1.34e-04 | NA | NA | 0.5626 |
6. F | Q87PA5 | Ribosomal RNA small subunit methyltransferase F | 2.93e-04 | NA | NA | 0.5744 |
6. F | B7N0Q3 | Ribosomal protein L11 methyltransferase | 2.36e-08 | NA | NA | 0.6493 |
6. F | Q98KD0 | Ribosomal protein L11 methyltransferase | 4.29e-08 | NA | NA | 0.662 |
6. F | A5EVX5 | Ribosomal protein L11 methyltransferase | 6.11e-08 | NA | NA | 0.6165 |
6. F | A6TSL8 | Ribosomal protein L11 methyltransferase | 8.73e-10 | NA | NA | 0.5182 |
6. F | C3LLK9 | tRNA U34 carboxymethyltransferase | 4.50e-08 | NA | NA | 0.5301 |
6. F | Q10X25 | Ribosomal protein L11 methyltransferase | 8.71e-10 | NA | NA | 0.6725 |
6. F | B3MF31 | Protein arginine N-methyltransferase 7 | 2.84e-02 | NA | NA | 0.4502 |
6. F | B1XU70 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 2.40e-06 | NA | NA | 0.6015 |
6. F | Q0HJM6 | Ribosomal RNA small subunit methyltransferase F | 6.96e-04 | NA | NA | 0.5361 |
6. F | Q1CTC3 | tRNA (guanine-N(7)-)-methyltransferase | 7.05e-04 | NA | NA | 0.5152 |
6. F | B4TJV7 | Ribosomal protein L11 methyltransferase | 2.79e-08 | NA | NA | 0.6492 |
6. F | A8GKG7 | Ribosomal RNA small subunit methyltransferase B | 6.17e-05 | NA | NA | 0.5959 |
6. F | Q57168 | Putative type I restriction enzyme HindVIIP M protein | 9.87e-04 | NA | NA | 0.6284 |
6. F | Q8Y035 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.10e-06 | NA | NA | 0.6197 |
6. F | B7VMH7 | tRNA U34 carboxymethyltransferase | 4.19e-08 | NA | NA | 0.5196 |
6. F | H2E7T5 | Squalene methyltransferase 1 | 9.70e-08 | NA | NA | 0.5411 |
6. F | B9JUV4 | Ribosomal RNA small subunit methyltransferase A | 1.83e-04 | NA | NA | 0.5172 |
6. F | B9DNJ8 | Ribosomal protein L11 methyltransferase | 2.41e-10 | NA | NA | 0.5671 |
6. F | P67688 | Ribosomal protein L11 methyltransferase | 3.09e-08 | NA | NA | 0.6487 |
6. F | P57269 | Release factor glutamine methyltransferase | 3.13e-12 | NA | NA | 0.7128 |
6. F | Q8DX85 | Ribosomal protein L11 methyltransferase | 1.07e-09 | NA | NA | 0.6444 |
6. F | B1JLL9 | tRNA U34 carboxymethyltransferase | 3.98e-08 | NA | NA | 0.5311 |
6. F | Q9PBE3 | Ribosomal protein L11 methyltransferase | 7.77e-08 | NA | NA | 0.6168 |
6. F | P94464 | Probable ribosomal RNA small subunit methyltransferase B | 2.53e-05 | NA | NA | 0.5651 |
6. F | C3MEL0 | Ribosomal protein L11 methyltransferase | 4.60e-10 | NA | NA | 0.6483 |
6. F | B0TSA0 | tRNA U34 carboxymethyltransferase | 8.90e-06 | NA | NA | 0.5303 |
6. F | Q8TGX6 | tRNA (guanine(26)-N(2))-dimethyltransferase | 1.11e-06 | NA | NA | 0.5479 |
6. F | Q1CGL8 | Ribosomal RNA large subunit methyltransferase I | 2.06e-08 | NA | NA | 0.5936 |
6. F | B2ISD7 | Ribosomal protein L11 methyltransferase | 2.23e-09 | NA | NA | 0.6176 |
6. F | Q6LT56 | tRNA U34 carboxymethyltransferase | 4.07e-08 | NA | NA | 0.5299 |
6. F | A6H791 | tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A | 9.55e-07 | NA | NA | 0.574 |
6. F | A5IWD5 | Ribosomal RNA small subunit methyltransferase G | 7.11e-11 | NA | NA | 0.7025 |
6. F | A3D9J5 | Ribosomal protein L11 methyltransferase | 1.09e-08 | NA | NA | 0.6689 |
6. F | Q2SWE9 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.42e-06 | NA | NA | 0.6018 |
6. F | Q4QLT2 | Ribosomal protein L11 methyltransferase | 2.72e-08 | NA | NA | 0.6151 |
6. F | B8NI24 | O-methyltransferase imqG | 2.64e-09 | NA | NA | 0.5229 |
6. F | Q5PIT6 | Ribosomal RNA small subunit methyltransferase B | 7.91e-05 | NA | NA | 0.6075 |
6. F | B7HCT8 | Ribosomal protein L11 methyltransferase | 2.03e-10 | NA | NA | 0.6633 |
6. F | A1AGF9 | Ribosomal protein L11 methyltransferase | 2.51e-08 | NA | NA | 0.6492 |
6. F | Q2IX80 | Ribosomal RNA small subunit methyltransferase A | 7.49e-04 | NA | NA | 0.5217 |
6. F | B9E6W9 | Ribosomal protein L11 methyltransferase | 4.12e-10 | NA | NA | 0.6724 |
6. F | B1WNQ4 | Ribosomal protein L11 methyltransferase | 1.31e-09 | NA | NA | 0.6464 |
6. F | Q12MJ8 | Ribosomal RNA small subunit methyltransferase F | 2.87e-03 | NA | NA | 0.5265 |
6. F | Q9P3R1 | Sterol 24-C-methyltransferase erg-4 | 9.48e-08 | NA | NA | 0.5923 |
6. F | A8H3W2 | Ribosomal RNA small subunit methyltransferase F | 4.34e-03 | NA | NA | 0.5487 |
6. F | Q8PG22 | Ribosomal RNA small subunit methyltransferase B | 3.59e-04 | NA | NA | 0.6223 |
6. F | Q9JP88 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 2.22e-06 | NA | NA | 0.5568 |
6. F | B5BGT7 | Ribosomal protein L11 methyltransferase | 2.35e-08 | NA | NA | 0.6702 |
6. F | A8HVI9 | Ribosomal RNA small subunit methyltransferase A | 1.68e-03 | NA | NA | 0.5194 |
6. F | A2S5P8 | Ribosomal protein L11 methyltransferase | 9.19e-08 | NA | NA | 0.5953 |
6. F | Q7WF92 | Ribosomal protein L11 methyltransferase | 9.35e-08 | NA | NA | 0.6214 |
6. F | B8E968 | Ribosomal RNA small subunit methyltransferase F | 5.70e-04 | NA | NA | 0.5228 |
6. F | B3PFU1 | tRNA U34 carboxymethyltransferase | 5.93e-06 | NA | NA | 0.5295 |
6. F | A0JMU5 | Protein arginine N-methyltransferase 9 | 6.16e-02 | NA | NA | 0.5831 |
6. F | Q9KRY1 | Ribosomal RNA small subunit methyltransferase F | 2.90e-04 | NA | NA | 0.5768 |
6. F | Q3AZ92 | Ribosomal RNA small subunit methyltransferase G | 1.97e-10 | NA | NA | 0.6841 |
6. F | Q83RJ3 | Putative ribosomal RNA small subunit methyltransferase F | 5.09e-04 | NA | NA | 0.5559 |
6. F | A8GFJ8 | tRNA U34 carboxymethyltransferase | 3.75e-08 | NA | NA | 0.5242 |
6. F | A4THM8 | Ribosomal RNA large subunit methyltransferase G | 2.59e-09 | NA | NA | 0.6286 |
6. F | Q5E5C7 | Ribosomal RNA small subunit methyltransferase F | 6.46e-04 | NA | NA | 0.5715 |
6. F | B7MBP2 | Ribosomal RNA small subunit methyltransferase F | 4.55e-04 | NA | NA | 0.5356 |
6. F | Q2RKY6 | Ribosomal protein L11 methyltransferase | 2.92e-10 | NA | NA | 0.661 |
6. F | A9R925 | Ribosomal RNA small subunit methyltransferase B | 7.17e-05 | NA | NA | 0.5953 |
6. F | B6ELC0 | Ribosomal RNA small subunit methyltransferase F | 7.05e-04 | NA | NA | 0.5513 |
6. F | Q7CIB6 | tRNA U34 carboxymethyltransferase | 3.86e-08 | NA | NA | 0.531 |
6. F | A4WF74 | Ribosomal protein L11 methyltransferase | 2.16e-08 | NA | NA | 0.6341 |
6. F | Q8ZLM5 | Ribosomal RNA small subunit methyltransferase B | 7.87e-05 | NA | NA | 0.6076 |
6. F | B7GKD0 | Ribosomal protein L11 methyltransferase | 4.55e-10 | NA | NA | 0.6932 |
6. F | Q4UT85 | Ribosomal RNA large subunit methyltransferase K/L | 3.86e-05 | NA | NA | 0.6086 |
6. F | Q7CIA2 | Release factor glutamine methyltransferase | 4.26e-12 | NA | NA | 0.7275 |
6. F | Q4R3U8 | tRNA wybutosine-synthesizing protein 2 homolog | 2.19e-06 | NA | NA | 0.5767 |
6. F | C0ZB50 | Ribosomal protein L11 methyltransferase | 3.31e-10 | NA | NA | 0.6823 |
6. F | C0M9U4 | Ribosomal protein L11 methyltransferase | 1.47e-09 | NA | NA | 0.6052 |
6. F | Q92BP0 | Ribosomal protein L11 methyltransferase | 5.41e-10 | NA | NA | 0.6282 |
6. F | A9MUB3 | tRNA U34 carboxymethyltransferase | 3.60e-08 | NA | NA | 0.5068 |
6. F | Q0TCH3 | Ribosomal RNA small subunit methyltransferase B | 8.35e-05 | NA | NA | 0.5812 |
6. F | P0A0P4 | Ribosomal protein L11 methyltransferase | 4.43e-10 | NA | NA | 0.6299 |
6. F | B4I8G2 | Protein arginine N-methyltransferase 7 | 3.34e-02 | NA | NA | 0.5816 |
6. F | P0A8T3 | Ribosomal protein L11 methyltransferase | 3.08e-08 | NA | NA | 0.6352 |
6. F | Q9KQ26 | Release factor glutamine methyltransferase | 2.06e-12 | NA | NA | 0.6626 |
6. F | F7GSQ4 | tRNA (guanine(37)-N1)-methyltransferase | 6.23e-04 | NA | NA | 0.5336 |
6. F | Q62GX2 | Ribosomal protein L11 methyltransferase | 9.36e-08 | NA | NA | 0.5952 |
6. F | Q8F987 | Release factor glutamine methyltransferase | 1.30e-11 | NA | NA | 0.6129 |
6. F | A1JRM4 | tRNA U34 carboxymethyltransferase | 4.01e-08 | NA | NA | 0.5285 |
6. F | B1I7P5 | Ribosomal protein L11 methyltransferase | 2.90e-09 | NA | NA | 0.6176 |
6. F | Q1C824 | tRNA U34 carboxymethyltransferase | 4.01e-08 | NA | NA | 0.5331 |
6. F | Q7MKY6 | Ribosomal RNA small subunit methyltransferase F | 3.64e-04 | NA | NA | 0.5451 |
6. F | A8FFD0 | Ribosomal protein L11 methyltransferase | 4.95e-10 | NA | NA | 0.6768 |
6. F | B1KHH0 | tRNA U34 carboxymethyltransferase | 7.22e-06 | NA | NA | 0.5174 |
6. F | Q489G6 | Ribosomal protein L11 methyltransferase | 1.65e-08 | NA | NA | 0.6436 |
6. F | Q5E5B4 | Ribosomal RNA large subunit methyltransferase K/L | 4.67e-05 | NA | NA | 0.5977 |
6. F | Q9JW08 | Ribosomal protein L11 methyltransferase | 2.73e-08 | NA | NA | 0.6281 |
6. F | B2FJP0 | Ribosomal protein L11 methyltransferase | 2.77e-08 | NA | NA | 0.612 |
6. F | Q4W9V1 | Sterol 24-C-methyltransferase | 1.18e-07 | NA | NA | 0.6134 |
6. F | B5BGV5 | Ribosomal RNA small subunit methyltransferase B | 8.20e-05 | NA | NA | 0.5942 |
6. F | Q3SRZ8 | Ribosomal RNA small subunit methyltransferase A | 2.07e-04 | NA | NA | 0.5332 |
6. F | Q2NTJ8 | tRNA U34 carboxymethyltransferase | 3.82e-08 | NA | NA | 0.5221 |
6. F | P0DUL6 | O-methyltransferase hkm8 | 6.79e-04 | NA | NA | 0.4135 |
6. F | A9B5V4 | Ribosomal protein L11 methyltransferase | 1.37e-09 | NA | NA | 0.5943 |
6. F | Q8FZQ6 | Ribosomal protein L11 methyltransferase | 3.65e-08 | NA | NA | 0.6731 |
6. F | B1J5B7 | Ribosomal RNA large subunit methyltransferase K/L | 3.69e-05 | NA | NA | 0.5195 |
6. F | F6H2F8 | tRNA (guanine(37)-N1)-methyltransferase 1 | 3.82e-05 | NA | NA | 0.6036 |
6. F | A8YYR9 | Ribosomal RNA small subunit methyltransferase G | 8.69e-11 | NA | NA | 0.7003 |
6. F | O84027 | Release factor glutamine methyltransferase | 2.55e-11 | NA | NA | 0.6762 |
6. F | A6TES6 | Ribosomal protein L11 methyltransferase | 2.30e-08 | NA | NA | 0.6488 |
6. F | B7LRN4 | Ribosomal protein L11 methyltransferase | 3.11e-08 | NA | NA | 0.6148 |
6. F | B1JBB3 | Ribosomal RNA large subunit methyltransferase F | 1.79e-09 | NA | NA | 0.5523 |
6. F | Q9KSU3 | tRNA U34 carboxymethyltransferase | 4.56e-08 | NA | NA | 0.5262 |
6. F | A5IN97 | Ribosomal protein L11 methyltransferase | 4.10e-10 | NA | NA | 0.622 |
6. F | A4YB19 | Ribosomal protein L11 methyltransferase | 1.06e-08 | NA | NA | 0.6679 |
6. F | C4YH95 | tRNA (guanine(37)-N1)-methyltransferase | 1.76e-03 | NA | NA | 0.4754 |
6. F | Q31II5 | Ribosomal protein L11 methyltransferase | 1.03e-08 | NA | NA | 0.6673 |
6. F | Q7VI24 | tRNA (guanine-N(7)-)-methyltransferase | 3.47e-04 | NA | NA | 0.5788 |
6. F | B8CNX4 | tRNA U34 carboxymethyltransferase | 8.66e-06 | NA | NA | 0.533 |
6. F | A5F277 | tRNA U34 carboxymethyltransferase | 4.47e-08 | NA | NA | 0.5285 |
6. F | P31049 | Probable fatty acid methyltransferase | 1.06e-07 | NA | NA | 0.5862 |
6. F | B2J397 | Ribosomal protein L11 methyltransferase | 9.23e-10 | NA | NA | 0.7042 |
6. F | A7N0K6 | Ribosomal RNA small subunit methyltransferase F | 2.88e-04 | NA | NA | 0.5748 |
6. F | Q1QEI9 | Ubiquinone biosynthesis O-methyltransferase | 8.85e-11 | NA | NA | 0.5809 |
6. F | P64240 | Ribosomal RNA small subunit methyltransferase G | 8.05e-11 | NA | NA | 0.6799 |
6. F | Q88P77 | Ribosomal RNA large subunit methyltransferase F | 1.65e-09 | NA | NA | 0.5046 |
6. F | A5UIB7 | Ribosomal protein L11 methyltransferase | 2.57e-08 | NA | NA | 0.6152 |
6. F | A1JR10 | Ribosomal RNA large subunit methyltransferase G | 4.82e-09 | NA | NA | 0.6735 |
6. F | B7LPL0 | Ribosomal RNA small subunit methyltransferase F | 5.10e-04 | NA | NA | 0.5541 |
6. F | B2JH19 | Ribosomal protein L11 methyltransferase | 1.09e-07 | NA | NA | 0.5941 |
6. F | Q32H78 | tRNA U34 carboxymethyltransferase | 4.93e-08 | NA | NA | 0.5275 |
6. F | Q9KD70 | Ribosomal protein L11 methyltransferase | 7.15e-10 | NA | NA | 0.5677 |
6. F | B5E9X4 | Ribosomal protein L11 methyltransferase | 1.01e-08 | NA | NA | 0.6468 |
6. F | A3Q9Q5 | Ribosomal protein L11 methyltransferase | 1.74e-08 | NA | NA | 0.6399 |
6. F | Q49404 | Uncharacterized protein MG259 | 6.04e-06 | NA | NA | 0.6447 |
6. F | A3M6R7 | Ribosomal protein L11 methyltransferase | 9.10e-09 | NA | NA | 0.6625 |
6. F | Q9ZL96 | tRNA (guanine-N(7)-)-methyltransferase | 3.40e-04 | NA | NA | 0.5467 |
6. F | B0VLL0 | Ribosomal protein L11 methyltransferase | 7.57e-09 | NA | NA | 0.6623 |
6. F | A6VM22 | Ribosomal protein L11 methyltransferase | 1.56e-08 | NA | NA | 0.6141 |
6. F | A5U028 | Methoxy mycolic acid synthase MmaA3 | 3.51e-08 | NA | NA | 0.502 |
6. F | Q52892 | Nodulation protein NoeA | 6.95e-04 | NA | NA | 0.479 |
6. F | A5UD93 | Ribosomal protein L11 methyltransferase | 2.33e-08 | NA | NA | 0.6151 |
6. F | A9M676 | Ribosomal protein L11 methyltransferase | 4.24e-08 | NA | NA | 0.6934 |
6. F | Q5M6B7 | Ribosomal protein L11 methyltransferase | 1.44e-09 | NA | NA | 0.6705 |
6. F | B5FSM5 | tRNA U34 carboxymethyltransferase | 3.55e-08 | NA | NA | 0.5166 |
6. F | Q99XW8 | Ribosomal protein L11 methyltransferase | 2.80e-09 | NA | NA | 0.6258 |
6. F | Q48MF3 | Ribosomal RNA large subunit methyltransferase F | 3.06e-09 | NA | NA | 0.5374 |
6. F | Q1QA78 | Ribosomal protein L11 methyltransferase | 2.26e-08 | NA | NA | 0.6411 |
6. F | Q5KWZ9 | Ribosomal protein L11 methyltransferase | 4.87e-10 | NA | NA | 0.6748 |
6. F | P0A0P5 | Ribosomal protein L11 methyltransferase | 4.38e-10 | NA | NA | 0.6296 |
6. F | Q2T4P1 | Polyketide synthase ThaQ | 1.48e-01 | NA | NA | 0.5752 |
6. F | Q7QIL2 | Protein arginine N-methyltransferase 7 | 8.77e-02 | NA | NA | 0.5432 |
6. F | A1KS36 | Ribosomal protein L11 methyltransferase | 1.33e-06 | NA | NA | 0.6035 |
6. F | Q322J0 | tRNA U34 carboxymethyltransferase | 4.78e-08 | NA | NA | 0.5173 |
6. F | Q0T3Q7 | tRNA U34 carboxymethyltransferase | 5.02e-08 | NA | NA | 0.5173 |
6. F | Q65H56 | Ribosomal protein L11 methyltransferase | 4.76e-10 | NA | NA | 0.6629 |
6. F | C1CT24 | Ribosomal protein L11 methyltransferase | 1.20e-09 | NA | NA | 0.6596 |
6. F | B7MCQ4 | Ribosomal RNA small subunit methyltransferase B | 9.05e-05 | NA | NA | 0.5819 |
6. F | Q7Q5Z3 | tRNA (guanine(37)-N1)-methyltransferase | 2.40e-05 | NA | NA | 0.541 |
6. F | B5DPF1 | tRNA (guanine(37)-N1)-methyltransferase | 6.31e-06 | NA | NA | 0.5071 |
6. F | Q8NWB0 | Ribosomal protein L11 methyltransferase | 4.16e-10 | NA | NA | 0.6298 |
6. F | E3KWE1 | tRNA (guanine(37)-N1)-methyltransferase | 1.88e-05 | NA | NA | 0.5335 |
6. F | Q9CLW2 | Ribosomal protein L11 methyltransferase | 1.25e-08 | NA | NA | 0.6177 |
6. F | B1X6E1 | Ribosomal RNA small subunit methyltransferase B | 7.07e-05 | NA | NA | 0.5379 |
6. F | Q5FAH7 | Ribosomal protein L11 methyltransferase | 2.78e-08 | NA | NA | 0.6172 |
6. F | B8E680 | Ribosomal protein L11 methyltransferase | 1.39e-08 | NA | NA | 0.668 |
6. F | Q4FVG3 | Ubiquinone biosynthesis O-methyltransferase | 9.95e-11 | NA | NA | 0.5544 |
6. F | B2UCS1 | Ribosomal protein L11 methyltransferase | 7.72e-08 | NA | NA | 0.5839 |
6. F | A9MN78 | Ribosomal RNA small subunit methyltransferase B | 8.09e-05 | NA | NA | 0.6072 |
6. F | A5G9G5 | Ribosomal protein L11 methyltransferase | 2.17e-09 | NA | NA | 0.6241 |
6. F | B1ZUS4 | Ribosomal protein L11 methyltransferase | 7.60e-09 | NA | NA | 0.6119 |
6. F | B2G6X4 | Ribosomal protein L11 methyltransferase | 1.38e-09 | NA | NA | 0.6495 |
6. F | Q49Y20 | Ribosomal protein L11 methyltransferase | 4.26e-10 | NA | NA | 0.6781 |
6. F | B6I1E9 | tRNA U34 carboxymethyltransferase | 4.66e-08 | NA | NA | 0.5176 |
6. F | O07678 | Ribosomal protein L11 methyltransferase | 2.09e-07 | NA | NA | 0.5247 |
6. F | Q17Y01 | tRNA (guanine-N(7)-)-methyltransferase | 3.34e-04 | NA | NA | 0.5022 |
6. F | C0RE56 | Ribosomal protein L11 methyltransferase | 3.83e-08 | NA | NA | 0.6938 |
6. F | Q3Z2P7 | tRNA U34 carboxymethyltransferase | 4.76e-08 | NA | NA | 0.5173 |
6. F | P9WPB2 | Cyclopropane mycolic acid synthase 3 | 2.98e-08 | NA | NA | 0.5745 |
6. F | Q83AD8 | Release factor glutamine methyltransferase | 1.06e-12 | NA | NA | 0.7673 |
6. F | P62469 | Ribosomal RNA small subunit methyltransferase H | 8.65e-07 | NA | NA | 0.5312 |
6. F | B7IYG5 | Ribosomal protein L11 methyltransferase | 2.24e-10 | NA | NA | 0.6632 |
6. F | Q74NE4 | tRNA (guanine(37)-N1)/4-demethylwyosine(37)-methyltransferase Taw22 | 5.80e-05 | NA | NA | 0.545 |
6. F | A6WTE5 | Ribosomal protein L11 methyltransferase | 1.30e-08 | NA | NA | 0.6728 |
6. F | Q3J2B7 | Release factor glutamine methyltransferase | 2.42e-12 | NA | NA | 0.7046 |
6. F | H2E7T7 | Botryococcene C-methyltransferase | 1.23e-07 | NA | NA | 0.5779 |
6. F | Q7VXM6 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.16e-06 | NA | NA | 0.6339 |
6. F | Q32F19 | Ribosomal RNA small subunit methyltransferase F | 6.95e-04 | NA | NA | 0.5495 |
6. F | A0RRT6 | Ribosomal RNA small subunit methyltransferase A | 9.74e-07 | NA | NA | 0.5246 |
6. F | Q02ZY9 | Ribosomal RNA small subunit methyltransferase H | 1.47e-06 | NA | NA | 0.5111 |
6. F | Q0TGW1 | tRNA U34 carboxymethyltransferase | 4.78e-08 | NA | NA | 0.5069 |
6. F | Q1CCX4 | Ribosomal RNA small subunit methyltransferase B | 5.84e-05 | NA | NA | 0.5952 |
6. F | Q63UT8 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.50e-06 | NA | NA | 0.6163 |
6. F | Q87C45 | Ribosomal protein L11 methyltransferase | 8.38e-08 | NA | NA | 0.6179 |
6. F | A7FE15 | Ribosomal RNA large subunit methyltransferase G | 1.31e-09 | NA | NA | 0.6295 |
6. F | Q5QVT9 | Ribosomal protein L11 methyltransferase | 6.18e-09 | NA | NA | 0.6352 |
6. F | A6WNQ9 | tRNA U34 carboxymethyltransferase | 7.80e-08 | NA | NA | 0.5363 |
6. F | Q3JC88 | Ribosomal protein L11 methyltransferase | 3.64e-09 | NA | NA | 0.6316 |
6. F | Q30SG7 | tRNA (guanine-N(7)-)-methyltransferase | 6.86e-04 | NA | NA | 0.5486 |
6. F | Q7U1K0 | Methoxy mycolic acid synthase MmaA3 | 3.77e-08 | NA | NA | 0.5449 |
6. F | Q49UI6 | Ribosomal RNA small subunit methyltransferase G | 1.16e-10 | NA | NA | 0.661 |
6. F | B5F7R5 | Ribosomal RNA small subunit methyltransferase B | 8.42e-05 | NA | NA | 0.6392 |
6. F | Q6CA67 | tRNA (guanine(37)-N1)-methyltransferase | 2.67e-05 | NA | NA | 0.5201 |
6. F | Q7VAM5 | Ribosomal protein L11 methyltransferase | 6.72e-10 | NA | NA | 0.6926 |
6. F | Q2GE45 | Ribosomal RNA small subunit methyltransferase A | 1.48e-04 | NA | NA | 0.5226 |
6. F | Q634M9 | Ribosomal protein L11 methyltransferase | 2.68e-10 | NA | NA | 0.6626 |
6. F | P0A8T4 | Ribosomal protein L11 methyltransferase | 2.44e-08 | NA | NA | 0.6495 |
6. F | Q63QN9 | Ribosomal protein L11 methyltransferase | 9.51e-08 | NA | NA | 0.595 |
6. F | Q8ZJ81 | Ribosomal RNA small subunit methyltransferase B | 5.73e-05 | NA | NA | 0.5934 |
6. F | B3CPY6 | Ribosomal RNA small subunit methyltransferase A | 1.86e-06 | NA | NA | 0.4881 |
6. F | A5W6K7 | Ribosomal RNA large subunit methyltransferase K/L | 3.66e-05 | NA | NA | 0.5669 |
6. F | Q5HFI2 | Ribosomal protein L11 methyltransferase | 8.92e-10 | NA | NA | 0.6291 |
6. F | A9MNC7 | tRNA U34 carboxymethyltransferase | 3.76e-08 | NA | NA | 0.5169 |
6. F | Q16NS8 | Protein arginine N-methyltransferase 7 | 5.79e-02 | NA | NA | 0.5251 |
6. F | Q06528 | Carminomycin 4-O-methyltransferase DnrK | 4.96e-09 | NA | NA | 0.5924 |
6. F | Q4ZXI1 | Ribosomal RNA large subunit methyltransferase F | 2.68e-09 | NA | NA | 0.5084 |
6. F | B7USL2 | Ribosomal RNA small subunit methyltransferase F | 4.90e-04 | NA | NA | 0.5588 |
6. F | Q04J12 | Ribosomal protein L11 methyltransferase | 2.30e-09 | NA | NA | 0.6571 |
6. F | Q5HUG5 | Ribosomal RNA small subunit methyltransferase G | 2.80e-09 | NA | NA | 0.6034 |
6. F | Q883N9 | Ribosomal RNA large subunit methyltransferase K/L | 3.65e-05 | NA | NA | 0.6256 |
6. F | Q5LQN0 | Ribosomal RNA small subunit methyltransferase A | 1.57e-04 | NA | NA | 0.5349 |
6. F | Q8CMN7 | Ribosomal RNA small subunit methyltransferase G | 1.32e-10 | NA | NA | 0.695 |
6. F | C3K6G1 | Ribosomal RNA large subunit methyltransferase F | 5.56e-09 | NA | NA | 0.5336 |
6. F | A5D3Y3 | Ribosomal protein L11 methyltransferase | 3.79e-10 | NA | NA | 0.6476 |
6. F | O34331 | Putative rRNA methyltransferase YlbH | 6.60e-11 | NA | NA | 0.6797 |
6. F | Q0HVX2 | Ribosomal RNA small subunit methyltransferase F | 2.28e-04 | NA | NA | 0.5466 |
6. F | Q13Z67 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 2.49e-06 | NA | NA | 0.5892 |
6. F | Q9ZD05 | Uncharacterized methylase RP545 | 9.63e-05 | NA | NA | 0.4961 |
6. F | C1C922 | Ribosomal protein L11 methyltransferase | 1.41e-09 | NA | NA | 0.6268 |
6. F | Q6D000 | Ribosomal RNA small subunit methyltransferase B | 6.56e-05 | NA | NA | 0.6258 |
6. F | Q6D4C8 | Ribosomal RNA small subunit methyltransferase F | 1.84e-04 | NA | NA | 0.5338 |
6. F | Q4FRP0 | Ribosomal protein L11 methyltransferase | 2.24e-08 | NA | NA | 0.6415 |
6. F | C5B836 | tRNA U34 carboxymethyltransferase | 5.70e-06 | NA | NA | 0.5236 |
6. F | A9L3I4 | tRNA U34 carboxymethyltransferase | 6.68e-08 | NA | NA | 0.5332 |
6. F | Q8DAP0 | tRNA U34 carboxymethyltransferase | 4.50e-08 | NA | NA | 0.5193 |
6. F | Q4KFI6 | Ribosomal RNA large subunit methyltransferase K/L | 4.24e-05 | NA | NA | 0.5415 |
6. F | B2K315 | tRNA U34 carboxymethyltransferase | 4.03e-08 | NA | NA | 0.5312 |
6. F | A3QEQ0 | tRNA U34 carboxymethyltransferase | 8.79e-06 | NA | NA | 0.531 |
6. F | A9ER52 | Ribosomal protein L11 methyltransferase | 1.18e-09 | NA | NA | 0.6518 |
6. F | Q39FQ4 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.47e-06 | NA | NA | 0.6017 |
6. F | O58523 | tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase | 2.13e-10 | NA | NA | 0.6426 |
6. F | Q7MJ71 | tRNA U34 carboxymethyltransferase | 4.43e-08 | NA | NA | 0.5193 |
6. F | Q5M1S5 | Ribosomal protein L11 methyltransferase | 1.17e-09 | NA | NA | 0.6767 |
6. F | A2RHI1 | Ribosomal protein L11 methyltransferase | 9.79e-10 | NA | NA | 0.6617 |
6. F | A8H552 | tRNA U34 carboxymethyltransferase | 8.85e-06 | NA | NA | 0.5205 |
6. F | B3DQM3 | Ribosomal RNA small subunit methyltransferase H | 1.86e-05 | NA | NA | 0.5147 |
6. F | B2K3B8 | Ribosomal RNA large subunit methyltransferase G | 1.32e-09 | NA | NA | 0.6275 |
6. F | Q0TGZ7 | Ribosomal RNA small subunit methyltransferase F | 4.99e-04 | NA | NA | 0.5546 |
6. F | A7MPE7 | Ribosomal RNA small subunit methyltransferase B | 8.53e-05 | NA | NA | 0.6171 |
6. F | Q1JET3 | Ribosomal protein L11 methyltransferase | 1.89e-09 | NA | NA | 0.6038 |
6. F | P67689 | Ribosomal protein L11 methyltransferase | 3.38e-08 | NA | NA | 0.6487 |
6. F | B9DTA9 | Ribosomal protein L11 methyltransferase | 4.61e-10 | NA | NA | 0.6285 |
6. F | Q2J4A4 | Ribosomal RNA small subunit methyltransferase G | 1.95e-05 | NA | NA | 0.6237 |
6. F | A4WRK3 | Ribosomal RNA small subunit methyltransferase A | 1.53e-04 | NA | NA | 0.5538 |
6. F | B3R6K3 | Ribosomal protein L11 methyltransferase | 7.76e-08 | NA | NA | 0.5909 |
6. F | B4SVF6 | tRNA U34 carboxymethyltransferase | 3.61e-08 | NA | NA | 0.5165 |
6. F | A5VJF8 | Ribosomal protein L11 methyltransferase | 1.07e-09 | NA | NA | 0.6759 |
6. F | Q3IHA0 | Ribosomal RNA small subunit methyltransferase F | 1.82e-03 | NA | NA | 0.5408 |
6. F | B2U4X2 | tRNA U34 carboxymethyltransferase | 4.81e-08 | NA | NA | 0.5173 |
6. F | H2E7T9 | Sterol methyltransferase-like 2 | 1.45e-07 | NA | NA | 0.6094 |
6. F | Q3YWZ0 | Ribosomal protein L11 methyltransferase | 2.66e-08 | NA | NA | 0.649 |
6. F | B1LGM4 | Ribosomal protein L11 methyltransferase | 2.26e-08 | NA | NA | 0.6495 |
6. F | A0AIS2 | Ribosomal protein L11 methyltransferase | 5.71e-10 | NA | NA | 0.6285 |
6. F | Q18GB5 | Probable ribosomal RNA small subunit methyltransferase A | 2.67e-04 | NA | NA | 0.5807 |
6. F | Q89FW1 | Ribosomal protein L11 methyltransferase | 1.41e-09 | NA | NA | 0.6463 |
6. F | A2RGK2 | Ribosomal protein L11 methyltransferase | 1.16e-09 | NA | NA | 0.6407 |
6. F | A6QQV6 | Protein arginine N-methyltransferase 7 | 8.16e-03 | NA | NA | 0.3556 |
6. F | Q2K6E0 | Ribosomal protein L11 methyltransferase | 2.85e-10 | NA | NA | 0.6924 |
6. F | B0UV84 | Ribosomal protein L11 methyltransferase | 2.56e-08 | NA | NA | 0.6152 |
6. F | A9L5E5 | Ribosomal protein L11 methyltransferase | 1.16e-08 | NA | NA | 0.6661 |
6. F | B5YSY4 | Ribosomal protein L11 methyltransferase | 3.20e-08 | NA | NA | 0.6151 |
6. F | Q0HUY4 | tRNA U34 carboxymethyltransferase | 9.77e-08 | NA | NA | 0.5239 |
6. F | B1LD37 | Ribosomal RNA small subunit methyltransferase F | 4.73e-04 | NA | NA | 0.5564 |
6. F | Q643C8 | Phenylpyruvate C(3)-methyltransferase | 4.21e-05 | NA | NA | 0.5262 |
6. F | Q57N91 | tRNA U34 carboxymethyltransferase | 3.75e-08 | NA | NA | 0.5166 |
6. F | Q8PU28 | tRNA (guanine(26)-N(2))-dimethyltransferase | 1.56e-06 | NA | NA | 0.5493 |
6. F | C1CG04 | Ribosomal protein L11 methyltransferase | 1.27e-09 | NA | NA | 0.6598 |
6. F | C1CMA0 | Ribosomal protein L11 methyltransferase | 1.91e-09 | NA | NA | 0.6386 |
6. F | B0JX03 | Ribosomal protein L11 methyltransferase | 4.77e-10 | NA | NA | 0.6148 |
6. F | B1JQP6 | Ribosomal RNA large subunit methyltransferase I | 2.26e-08 | NA | NA | 0.595 |
6. F | L0E172 | Methyltransferase phqN | 1.83e-06 | NA | NA | 0.6356 |
6. F | A0A0A2IBN3 | O-methyltransferase cnsE | 1.25e-06 | NA | NA | 0.543 |
6. F | Q4L6S8 | Ribosomal protein L11 methyltransferase | 4.23e-10 | NA | NA | 0.68 |
6. F | B5R145 | tRNA U34 carboxymethyltransferase | 3.58e-08 | NA | NA | 0.5068 |
6. F | A3MRB1 | Ribosomal protein L11 methyltransferase | 9.15e-08 | NA | NA | 0.5955 |
6. F | F5HAU9 | tRNA (guanine(37)-N1)-methyltransferase | 2.15e-05 | NA | NA | 0.5505 |
6. F | A0A0D4BS77 | Indolepyruvate C-methyltransferase | 5.75e-05 | NA | NA | 0.4943 |
6. F | Q48R70 | Ribosomal protein L11 methyltransferase | 1.20e-09 | NA | NA | 0.6442 |
6. F | C3P8L8 | Ribosomal protein L11 methyltransferase | 2.29e-10 | NA | NA | 0.6631 |
6. F | A6QKK0 | Ribosomal RNA small subunit methyltransferase G | 8.69e-11 | NA | NA | 0.7016 |
6. F | B1LD00 | tRNA U34 carboxymethyltransferase | 4.91e-08 | NA | NA | 0.5172 |
6. F | C3L5R5 | Ribosomal protein L11 methyltransferase | 2.10e-10 | NA | NA | 0.663 |
6. F | Q7CHM1 | Ribosomal RNA large subunit methyltransferase I | 2.00e-08 | NA | NA | 0.6017 |
6. F | P60594 | Polyamine aminopropyltransferase | 3.90e-06 | NA | NA | 0.5704 |
6. F | B2IH12 | Ribosomal protein L11 methyltransferase | 8.06e-10 | NA | NA | 0.6969 |
6. F | C4ZSZ5 | Ribosomal protein L11 methyltransferase | 2.52e-08 | NA | NA | 0.6491 |
6. F | A1S6P5 | tRNA U34 carboxymethyltransferase | 1.28e-07 | NA | NA | 0.5195 |
6. F | Q1C310 | Ribosomal RNA large subunit methyltransferase G | 1.31e-09 | NA | NA | 0.6274 |
6. F | Q5ZIB9 | Protein arginine N-methyltransferase 7 | 7.08e-03 | NA | NA | 0.4754 |
6. F | Q8DS02 | Ribosomal protein L11 methyltransferase | 9.70e-10 | NA | NA | 0.6451 |
6. F | Q47HS4 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.07e-06 | NA | NA | 0.644 |
6. F | O25443 | tRNA (guanine-N(7)-)-methyltransferase | 9.08e-04 | NA | NA | 0.5371 |
6. F | B7MC29 | Ribosomal protein L11 methyltransferase | 2.48e-08 | NA | NA | 0.6493 |
6. F | Q0AQC3 | Ribosomal RNA small subunit methyltransferase A | 2.19e-04 | NA | NA | 0.5418 |
6. F | Q2RFW1 | Release factor glutamine methyltransferase | 3.91e-12 | NA | NA | 0.7365 |
6. F | B1XHM8 | Ribosomal protein L11 methyltransferase | 2.92e-08 | NA | NA | 0.604 |
6. F | B1YKT1 | Ribosomal protein L11 methyltransferase | 5.22e-10 | NA | NA | 0.6762 |
6. F | A5EIA8 | Ribosomal RNA small subunit methyltransferase A | 1.63e-06 | NA | NA | 0.5305 |
6. F | Q2SZE1 | Ribosomal protein L11 methyltransferase | 7.69e-08 | NA | NA | 0.5948 |
6. F | Q7VKC4 | Ribosomal RNA small subunit methyltransferase B | 9.58e-04 | NA | NA | 0.5796 |
6. F | A0KW34 | Ribosomal RNA small subunit methyltransferase F | 6.65e-04 | NA | NA | 0.5353 |
6. F | A4VM39 | Ribosomal RNA large subunit methyltransferase K/L | 3.57e-05 | NA | NA | 0.623 |
6. F | P46326 | Uncharacterized protein YxbB | 2.64e-09 | NA | NA | 0.5213 |
6. F | Q0T031 | Ribosomal protein L11 methyltransferase | 3.11e-08 | NA | NA | 0.6151 |
6. F | Q15TV2 | Ribosomal RNA large subunit methyltransferase I | 1.98e-08 | NA | NA | 0.5953 |
6. F | O66506 | Release factor glutamine methyltransferase | 5.17e-13 | NA | NA | 0.7168 |
6. F | H2E7T6 | Squalene methyltransferase 2 | 4.60e-08 | NA | NA | 0.6203 |
6. F | F6VSS6 | tRNA (guanine(37)-N1)-methyltransferase | 4.14e-04 | NA | NA | 0.5184 |
6. F | Q9CJ97 | Ribosomal protein L11 methyltransferase | 8.49e-10 | NA | NA | 0.6194 |
6. F | F4NUJ6 | tRNA (guanine(37)-N1)-methyltransferase | 1.15e-02 | NA | NA | 0.514 |
6. F | Q1C2X7 | Ribosomal RNA small subunit methyltransferase B | 7.44e-05 | NA | NA | 0.5932 |
6. F | Q7MYI0 | Ribosomal RNA small subunit methyltransferase B | 6.81e-05 | NA | NA | 0.4863 |
6. F | A9WBM9 | Release factor glutamine methyltransferase | 1.03e-11 | NA | NA | 0.6599 |
6. F | Q60A25 | Ribosomal protein L11 methyltransferase | 6.04e-09 | NA | NA | 0.6739 |
6. F | Q5KBP2 | tRNA (guanine(37)-N1)-methyltransferase | 1.61e-02 | NA | NA | 0.4813 |
6. F | A7MZM6 | Ribosomal RNA large subunit methyltransferase I | 2.18e-08 | NA | NA | 0.6026 |
6. F | C1ESK6 | Ribosomal protein L11 methyltransferase | 2.41e-10 | NA | NA | 0.6629 |
6. F | Q07VV2 | Ribosomal RNA large subunit methyltransferase I | 6.14e-08 | NA | NA | 0.6099 |
6. F | Q8PQ06 | Ribosomal protein L11 methyltransferase | 5.82e-08 | NA | NA | 0.5917 |
6. F | Q1R669 | Ribosomal protein L11 methyltransferase | 3.10e-08 | NA | NA | 0.6039 |
6. F | Q5HS34 | Ribosomal RNA small subunit methyltransferase G | 1.40e-10 | NA | NA | 0.6923 |
6. F | B5EPA4 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.15e-06 | NA | NA | 0.5742 |
6. F | A7X2X9 | Ribosomal protein L11 methyltransferase | 4.42e-10 | NA | NA | 0.6297 |
6. F | Q9X5T6 | Mitomycin biosynthesis 6-O-methyltransferase | 4.60e-08 | NA | NA | 0.5497 |
6. F | Q6F9P9 | Ribosomal protein L11 methyltransferase | 6.41e-09 | NA | NA | 0.6291 |
6. F | B8ZMW2 | Ribosomal protein L11 methyltransferase | 2.93e-09 | NA | NA | 0.6578 |
6. F | Q482P5 | Ribosomal RNA large subunit methyltransferase I | 3.95e-08 | NA | NA | 0.6103 |
6. F | A0KS74 | Ribosomal protein L11 methyltransferase | 1.31e-08 | NA | NA | 0.6693 |
6. F | Q8EEE6 | tRNA U34 carboxymethyltransferase | 7.76e-08 | NA | NA | 0.5241 |
6. F | B1JJH6 | Ribosomal RNA small subunit methyltransferase B | 5.70e-05 | NA | NA | 0.5933 |
6. F | B4P925 | Protein arginine N-methyltransferase 7 | 4.13e-02 | NA | NA | 0.6192 |
6. F | B5FTI4 | Ribosomal RNA small subunit methyltransferase F | 5.34e-04 | NA | NA | 0.5421 |
6. F | Q0I1Y6 | Ribosomal protein L11 methyltransferase | 2.63e-08 | NA | NA | 0.6154 |
6. F | C1KVB8 | Ribosomal protein L11 methyltransferase | 5.76e-10 | NA | NA | 0.6287 |
6. F | Q88VP9 | Ribosomal protein L11 methyltransferase | 1.43e-09 | NA | NA | 0.6922 |
6. F | Q31N39 | Ribosomal protein L11 methyltransferase | 2.77e-09 | NA | NA | 0.6601 |
6. F | A3D474 | tRNA U34 carboxymethyltransferase | 6.86e-08 | NA | NA | 0.5243 |
6. F | G2K044 | Ribosomal protein L11 methyltransferase | 6.03e-10 | NA | NA | 0.6279 |
6. F | A9WD89 | Ribosomal protein L11 methyltransferase | 1.12e-09 | NA | NA | 0.6237 |
6. F | P75419 | Uncharacterized protein MG259 homolog | 2.05e-05 | NA | NA | 0.636 |
6. F | Q3YS70 | Ribosomal RNA small subunit methyltransferase A | 9.44e-07 | NA | NA | 0.4716 |
6. F | A3N2I5 | Ribosomal protein L11 methyltransferase | 1.50e-08 | NA | NA | 0.6603 |
6. F | Q9I7A9 | Ribosomal RNA small subunit methyltransferase B | 1.76e-03 | NA | NA | 0.5729 |
6. F | A3NDQ7 | Ribosomal protein L11 methyltransferase | 9.37e-08 | NA | NA | 0.5951 |
6. F | D0L1G3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 2.80e-07 | NA | NA | 0.6176 |
6. F | Q0K6X3 | Ribosomal protein L11 methyltransferase | 6.93e-08 | NA | NA | 0.6119 |
6. F | B7J921 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.54e-06 | NA | NA | 0.5745 |
6. F | B2U2N5 | Ribosomal protein L11 methyltransferase | 2.66e-08 | NA | NA | 0.6492 |
6. F | Q8KG70 | Ribosomal protein L11 methyltransferase | 5.98e-09 | NA | NA | 0.5514 |
6. F | B8F6T6 | Ribosomal protein L11 methyltransferase | 2.45e-08 | NA | NA | 0.6489 |
6. F | A4SPN8 | tRNA U34 carboxymethyltransferase | 6.25e-06 | NA | NA | 0.521 |
6. F | Q87QV5 | tRNA U34 carboxymethyltransferase | 4.22e-08 | NA | NA | 0.5194 |
6. F | Q8Z5W0 | tRNA U34 carboxymethyltransferase | 3.54e-08 | NA | NA | 0.5169 |
6. F | P64239 | Ribosomal RNA small subunit methyltransferase G | 6.94e-11 | NA | NA | 0.7024 |
6. F | C0NUP2 | tRNA (guanine(37)-N1)-methyltransferase | 5.96e-03 | NA | NA | 0.5399 |
6. F | E3WPP8 | tRNA (guanine(37)-N1)-methyltransferase | 1.21e-05 | NA | NA | 0.517 |
6. F | Q3JNI0 | Ribosomal protein L11 methyltransferase | 9.64e-08 | NA | NA | 0.5945 |
6. F | Q97P62 | Ribosomal protein L11 methyltransferase | 1.70e-09 | NA | NA | 0.6197 |
6. F | B4ETP0 | tRNA U34 carboxymethyltransferase | 4.06e-08 | NA | NA | 0.5201 |
6. F | A7ZSF3 | Ribosomal protein L11 methyltransferase | 2.95e-08 | NA | NA | 0.6487 |
6. F | C4ZQF5 | tRNA U34 carboxymethyltransferase | 4.70e-08 | NA | NA | 0.5131 |
6. F | A9R1N3 | Ribosomal RNA large subunit methyltransferase G | 1.46e-09 | NA | NA | 0.6231 |
6. F | B2S6P1 | Ribosomal protein L11 methyltransferase | 4.44e-08 | NA | NA | 0.6937 |
6. F | A8Z4B7 | Ribosomal protein L11 methyltransferase | 4.71e-10 | NA | NA | 0.6293 |
6. F | A7H342 | Ribosomal RNA small subunit methyltransferase G | 2.48e-09 | NA | NA | 0.6066 |
6. F | Q2S4C3 | Ribosomal protein L11 methyltransferase | 3.67e-10 | NA | NA | 0.6829 |
6. F | Q38XP2 | Ribosomal protein L11 methyltransferase | 1.03e-09 | NA | NA | 0.6376 |
6. F | B5ZWD8 | Ribosomal RNA small subunit methyltransferase A | 1.95e-06 | NA | NA | 0.559 |
6. F | Q32B79 | Ribosomal protein L11 methyltransferase | 3.06e-08 | NA | NA | 0.6489 |
6. F | B5R8V2 | Ribosomal RNA small subunit methyltransferase F | 1.18e-03 | NA | NA | 0.5392 |
6. F | B3PTU0 | Ribosomal protein L11 methyltransferase | 2.25e-10 | NA | NA | 0.6721 |
6. F | Q82TM7 | Uncharacterized RNA methyltransferase NE1857 | 1.76e-05 | NA | NA | 0.5452 |
6. F | B5R2S1 | Ribosomal RNA small subunit methyltransferase F | 5.33e-04 | NA | NA | 0.5416 |
6. F | B4SL82 | Ribosomal protein L11 methyltransferase | 3.63e-08 | NA | NA | 0.6376 |
6. F | B7H0I7 | Ribosomal protein L11 methyltransferase | 1.07e-08 | NA | NA | 0.6422 |
6. F | B5BH49 | tRNA U34 carboxymethyltransferase | 3.28e-08 | NA | NA | 0.519 |
6. F | B2U9U3 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.53e-06 | NA | NA | 0.6168 |
6. F | A2RLT4 | Ribosomal RNA small subunit methyltransferase H | 1.29e-06 | NA | NA | 0.528 |
6. F | Q81ZZ9 | Ribosomal protein L11 methyltransferase | 6.02e-08 | NA | NA | 0.6083 |
6. F | A6WP46 | Ribosomal RNA small subunit methyltransferase F | 4.87e-04 | NA | NA | 0.5339 |
6. F | B5YT08 | Ribosomal RNA small subunit methyltransferase B | 8.43e-05 | NA | NA | 0.5898 |
6. F | B5RH47 | Ribosomal RNA small subunit methyltransferase B | 8.46e-05 | NA | NA | 0.6379 |
6. F | Q5E6A4 | tRNA U34 carboxymethyltransferase | 4.26e-08 | NA | NA | 0.5189 |
6. F | A1AC00 | Ribosomal RNA small subunit methyltransferase F | 5.36e-04 | NA | NA | 0.5487 |
6. F | A0RIT1 | Ribosomal protein L11 methyltransferase | 1.85e-10 | NA | NA | 0.6631 |
6. F | Q8ZNV1 | tRNA U34 carboxymethyltransferase | 3.40e-08 | NA | NA | 0.5069 |
6. F | B2VJC1 | tRNA U34 carboxymethyltransferase | 3.70e-08 | NA | NA | 0.5203 |
6. F | A1RSC6 | Protein-L-isoaspartate O-methyltransferase | 5.97e-08 | NA | NA | 0.5751 |
6. F | A4IR29 | Ribosomal protein L11 methyltransferase | 2.51e-10 | NA | NA | 0.6767 |
6. F | B5XIN3 | Ribosomal protein L11 methyltransferase | 9.92e-10 | NA | NA | 0.606 |
6. F | H2E7T8 | Sterol methyltransferase-like 1 | 1.00e-07 | NA | NA | 0.5803 |
6. F | Q5WHF9 | Ribosomal protein L11 methyltransferase | 3.31e-10 | NA | NA | 0.7069 |
6. F | B3E5Z5 | Ribosomal protein L11 methyltransferase | 3.40e-09 | NA | NA | 0.6388 |
6. F | Q081I3 | Ribosomal RNA small subunit methyltransferase F | 6.28e-04 | NA | NA | 0.5649 |
6. F | Q5P841 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.45e-06 | NA | NA | 0.5984 |
7. B | P58106 | Uncharacterized RNA methyltransferase TC_0118 | 3.88e-08 | NA | 2.97e-04 | NA |
7. B | Q8ZJW6 | Ribosomal RNA small subunit methyltransferase C | 3.06e-09 | NA | 1.05e-04 | NA |
7. B | Q87DF7 | Release factor glutamine methyltransferase | 1.46e-12 | NA | 4.93e-05 | NA |
7. B | Q0SX40 | Ribosomal RNA small subunit methyltransferase C | 4.04e-09 | NA | 7.94e-04 | NA |
7. B | A1SX22 | Ribosomal RNA large subunit methyltransferase G | 4.62e-10 | NA | 0.003 | NA |
7. B | B8E1A7 | Ribosomal protein L11 methyltransferase | 6.95e-10 | NA | 0.017 | NA |
7. B | Q8PC99 | Release factor glutamine methyltransferase | 2.50e-12 | NA | 1.75e-04 | NA |
7. B | Q57G51 | Ribosomal RNA small subunit methyltransferase C | 2.64e-09 | NA | 2.12e-05 | NA |
7. B | A7MEX5 | Ribosomal RNA large subunit methyltransferase K/L | 2.69e-05 | NA | 0.023 | NA |
7. B | B0TIX7 | Ribosomal RNA large subunit methyltransferase K/L | 4.83e-05 | NA | 3.65e-06 | NA |
7. B | Q8EFW4 | Ribosomal RNA large subunit methyltransferase K/L | 4.95e-05 | NA | 2.69e-04 | NA |
7. B | Q9JYY8 | Ribosomal RNA large subunit methyltransferase K | 1.21e-07 | NA | 0.014 | NA |
7. B | B6I942 | Ribosomal RNA large subunit methyltransferase I | 2.08e-08 | NA | 0.045 | NA |
7. B | Q8X510 | Ribosomal RNA small subunit methyltransferase C | 3.86e-09 | NA | 3.33e-04 | NA |
7. B | Q0HY38 | Ribosomal RNA large subunit methyltransferase G | 2.22e-09 | NA | 0.011 | NA |
7. B | A4VP05 | Ribosomal RNA large subunit methyltransferase F | 4.27e-09 | NA | 0.010 | NA |
7. B | B0U0U4 | Ribosomal RNA large subunit methyltransferase K/L | 6.24e-05 | NA | 0.011 | NA |
7. B | B1LJR4 | Ribosomal RNA large subunit methyltransferase K/L | 3.01e-05 | NA | 0.007 | NA |
7. B | B7UN46 | Ribosomal RNA large subunit methyltransferase I | 1.99e-08 | NA | 0.041 | NA |
7. B | B4T1Z1 | Ribosomal RNA large subunit methyltransferase K/L | 2.87e-05 | NA | 0.004 | NA |
7. B | P9WHV2 | Release factor glutamine methyltransferase | 1.88e-11 | NA | 1.06e-04 | NA |
7. B | Q32HV8 | Ribosomal RNA large subunit methyltransferase K/L | 3.04e-05 | NA | 0.003 | NA |
7. B | Q9CNW9 | Ribosomal RNA large subunit methyltransferase K/L | 3.74e-05 | NA | 0.002 | NA |
7. B | B5R6D3 | Ribosomal RNA large subunit methyltransferase I | 1.88e-08 | NA | 0.008 | NA |
7. B | Q0VQU5 | Ribosomal RNA large subunit methyltransferase K/L | 4.58e-05 | NA | 0.008 | NA |
7. B | B5YIQ8 | Release factor glutamine methyltransferase | 1.76e-13 | NA | 0.015 | NA |
7. B | Q8Z7S6 | Ribosomal RNA large subunit methyltransferase K/L | 2.85e-05 | NA | 0.004 | NA |
7. B | B4TSJ2 | Ribosomal RNA large subunit methyltransferase I | 2.40e-08 | NA | 0.008 | NA |
7. B | Q09357 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 1.03e-05 | NA | 7.61e-05 | NA |
7. B | Q8Z0V2 | Ribosomal RNA small subunit methyltransferase C | 4.69e-09 | NA | 1.08e-04 | NA |
7. B | A0A286LEZ7 | Psilocybin synthase | 3.21e-10 | NA | 9.08e-05 | NA |
7. B | B7MNC1 | Ribosomal RNA small subunit methyltransferase C | 1.92e-09 | NA | 3.07e-04 | NA |
7. B | B5BBK0 | Ribosomal RNA large subunit methyltransferase I | 2.65e-08 | NA | 0.009 | NA |
7. B | B7NH38 | Ribosomal RNA small subunit methyltransferase C | 3.95e-09 | NA | 3.33e-04 | NA |
7. B | Q892Z2 | Uncharacterized RNA methyltransferase CTC_01941 | 1.28e-07 | NA | 3.10e-05 | NA |
7. B | B1X8Q2 | Ribosomal RNA large subunit methyltransferase K/L | 2.73e-05 | NA | 0.003 | NA |
7. B | A1JMQ6 | Ribosomal RNA large subunit methyltransferase K/L | 2.83e-05 | NA | 0.048 | NA |
7. B | Q748B2 | Release factor glutamine methyltransferase | 1.01e-11 | NA | 1.31e-04 | NA |
7. B | A4W8X9 | Ribosomal RNA large subunit methyltransferase I | 1.79e-08 | NA | 0.029 | NA |
7. B | P0A293 | 50S ribosomal protein L3 glutamine methyltransferase | 3.36e-09 | NA | 7.37e-05 | NA |
7. B | Q0HLQ7 | Ribosomal RNA large subunit methyltransferase G | 2.14e-09 | NA | 0.024 | NA |
7. B | P39406 | Ribosomal RNA small subunit methyltransferase C | 1.85e-09 | NA | 3.07e-04 | NA |
7. B | P50840 | Putative RNA methyltransferase YpsC | 1.31e-04 | NA | 0.002 | NA |
7. B | P45253 | Release factor glutamine methyltransferase | 4.64e-11 | NA | 4.59e-05 | NA |
7. B | Q32GZ5 | Release factor glutamine methyltransferase | 1.48e-12 | NA | 3.09e-04 | NA |
7. B | A1A9L8 | Ribosomal RNA large subunit methyltransferase K/L | 3.06e-05 | NA | 0.004 | NA |
7. B | A3N3U3 | Ribosomal RNA small subunit methyltransferase C | 3.37e-10 | NA | 0.010 | NA |
7. B | A7MGA7 | Ribosomal RNA small subunit methyltransferase C | 2.58e-09 | NA | 1.68e-05 | NA |
7. B | B5Y286 | Ribosomal RNA small subunit methyltransferase C | 2.98e-09 | NA | 6.75e-05 | NA |
7. B | A4W687 | Ribosomal RNA small subunit methyltransferase C | 4.05e-09 | NA | 1.67e-05 | NA |
7. B | A1AJP2 | Ribosomal RNA small subunit methyltransferase C | 3.74e-09 | NA | 3.42e-04 | NA |
7. B | B1IS49 | Ribosomal RNA small subunit methyltransferase C | 4.21e-09 | NA | 3.10e-04 | NA |
7. B | Q814U1 | Release factor glutamine methyltransferase | 3.73e-11 | NA | 3.33e-04 | NA |
7. B | B1IVW5 | Ribosomal RNA large subunit methyltransferase I | 2.08e-08 | NA | 0.045 | NA |
7. B | A0KTP8 | Ribosomal RNA large subunit methyltransferase G | 2.18e-09 | NA | 0.027 | NA |
7. B | Q327M6 | Ribosomal RNA small subunit methyltransferase C | 3.19e-09 | NA | 3.07e-04 | NA |
7. B | A6WPK6 | Ribosomal RNA large subunit methyltransferase K/L | 5.06e-05 | NA | 2.63e-05 | NA |
7. B | Q12K11 | Ribosomal RNA large subunit methyltransferase G | 2.73e-09 | NA | 0.010 | NA |
7. B | Q8XD85 | Ribosomal RNA large subunit methyltransferase I | 2.92e-08 | NA | 0.044 | NA |
7. B | P44453 | Ribosomal RNA small subunit methyltransferase C | 2.15e-10 | NA | 0.002 | NA |
7. B | B5XY38 | Ribosomal RNA large subunit methyltransferase I | 2.61e-08 | NA | 0.010 | NA |
7. B | A3QDY0 | Ribosomal RNA large subunit methyltransferase K/L | 6.11e-05 | NA | 8.13e-04 | NA |
7. B | Q74IX0 | Ribosomal protein L11 methyltransferase | 1.01e-09 | NA | 0.003 | NA |
7. B | Q12LC6 | Ribosomal RNA large subunit methyltransferase K/L | 3.63e-05 | NA | 0.020 | NA |
7. B | P39199 | 50S ribosomal protein L3 glutamine methyltransferase | 4.14e-09 | NA | 2.46e-05 | NA |
7. B | Q9JYC0 | 50S ribosomal protein L3 glutamine methyltransferase | 2.44e-09 | NA | 5.44e-05 | NA |
7. B | P0ACC2 | Release factor glutamine methyltransferase | 1.66e-12 | NA | 6.68e-05 | NA |
7. B | Q8R619 | Release factor glutamine methyltransferase | 1.41e-11 | NA | 0.004 | NA |
7. B | Q8DPZ3 | Release factor glutamine methyltransferase | 6.27e-11 | NA | 0.001 | NA |
7. B | A1S8P4 | Ribosomal RNA large subunit methyltransferase G | 1.57e-09 | NA | 1.28e-05 | NA |
7. B | A7ZYQ0 | Ribosomal RNA large subunit methyltransferase K/L | 2.77e-05 | NA | 0.003 | NA |
7. B | Q9JTA1 | 50S ribosomal protein L3 glutamine methyltransferase | 2.31e-09 | NA | 4.87e-05 | NA |
7. B | Q8Z7R6 | Ribosomal RNA large subunit methyltransferase I | 2.56e-08 | NA | 0.003 | NA |
7. B | A9R7L5 | Ribosomal RNA large subunit methyltransferase K/L | 2.64e-05 | NA | 0.026 | NA |
7. B | B5QZF1 | Ribosomal RNA large subunit methyltransferase K/L | 2.66e-05 | NA | 0.004 | NA |
7. B | A7ZK71 | Ribosomal RNA large subunit methyltransferase I | 2.03e-08 | NA | 0.044 | NA |
7. B | A6VUQ2 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.45e-07 | NA | 0.045 | NA |
7. B | A0Q1R2 | Ribosomal protein L11 methyltransferase | 5.32e-10 | NA | 0.037 | NA |
7. B | A8GCK7 | Ribosomal RNA large subunit methyltransferase K/L | 2.43e-05 | NA | 0.010 | NA |
7. B | B5BBL9 | Ribosomal RNA large subunit methyltransferase K/L | 2.68e-05 | NA | 0.004 | NA |
7. B | P55137 | Uncharacterized RNA methyltransferase CT_742 | 3.44e-08 | NA | 5.52e-04 | NA |
7. B | B4TRX1 | Ribosomal RNA large subunit methyltransferase K/L | 2.53e-05 | NA | 0.004 | NA |
7. B | A8A4P1 | Ribosomal RNA large subunit methyltransferase G | 2.50e-09 | NA | 0.009 | NA |
7. B | Q6LRA0 | Ribosomal RNA large subunit methyltransferase K/L | 4.71e-05 | NA | 0.004 | NA |
7. B | B3GZF1 | Ribosomal RNA small subunit methyltransferase C | 3.59e-10 | NA | 0.006 | NA |
7. B | A9NEC5 | Ribosomal RNA small subunit methyltransferase G | 2.00e-10 | NA | 0.002 | NA |
7. B | O86951 | Ribosomal protein L11 methyltransferase | 1.35e-10 | NA | 0.017 | NA |
7. B | Q0TJ93 | Ribosomal RNA large subunit methyltransferase I | 2.92e-08 | NA | 0.039 | NA |
7. B | B2TUD1 | Ribosomal RNA large subunit methyltransferase K/L | 3.02e-05 | NA | 0.003 | NA |
7. B | Q8EAR4 | Release factor glutamine methyltransferase | 2.22e-12 | NA | 7.36e-07 | NA |
7. B | Q5E6T2 | Release factor glutamine methyltransferase | 2.11e-12 | NA | 3.29e-07 | NA |
7. B | Q8ZQ64 | Ribosomal RNA large subunit methyltransferase I | 2.27e-08 | NA | 0.009 | NA |
7. B | Q57QU1 | Ribosomal RNA large subunit methyltransferase K/L | 2.73e-05 | NA | 0.004 | NA |
7. B | B5FQZ1 | Ribosomal RNA large subunit methyltransferase K/L | 2.91e-05 | NA | 0.004 | NA |
7. B | Q7VXJ6 | 50S ribosomal protein L3 glutamine methyltransferase | 1.19e-09 | NA | 2.74e-04 | NA |
7. B | Q8XIT6 | Ribosomal protein L11 methyltransferase | 7.73e-10 | NA | 0.037 | NA |
7. B | Q8XDB2 | Ribosomal RNA large subunit methyltransferase K/L | 2.99e-05 | NA | 0.004 | NA |
7. B | B2FJ58 | Ribosomal RNA large subunit methyltransferase K/L | 2.81e-05 | NA | 0.002 | NA |
7. B | Q8ZQ73 | Ribosomal RNA large subunit methyltransferase K/L | 2.61e-05 | NA | 0.004 | NA |
7. B | B7LEL6 | Ribosomal RNA small subunit methyltransferase C | 3.45e-09 | NA | 3.27e-04 | NA |
7. B | Q1R2D5 | Ribosomal RNA small subunit methyltransferase C | 3.75e-09 | NA | 3.42e-04 | NA |
7. B | B1XFI0 | Ribosomal RNA small subunit methyltransferase C | 1.99e-09 | NA | 3.07e-04 | NA |
7. B | Q3IHQ6 | Ribosomal RNA large subunit methyltransferase G | 5.66e-10 | NA | 3.89e-05 | NA |
7. B | Q7TUS7 | Ribosomal protein L11 methyltransferase | 2.15e-09 | NA | 0.006 | NA |
7. B | Q8R5Z8 | Uncharacterized RNA methyltransferase FN1713 | 4.62e-07 | NA | 0.032 | NA |
7. B | B1LEH4 | Ribosomal RNA small subunit methyltransferase C | 3.81e-09 | NA | 2.90e-04 | NA |
7. B | B5QZH0 | Ribosomal RNA large subunit methyltransferase I | 1.86e-08 | NA | 0.008 | NA |
7. B | O51215 | Release factor glutamine methyltransferase | NA | NA | 8.59e-05 | NA |
7. B | B5FR09 | Ribosomal RNA large subunit methyltransferase I | 2.62e-08 | NA | 0.009 | NA |
7. B | Q8R6G7 | Ribosomal protein L11 methyltransferase | 2.18e-09 | NA | 0.030 | NA |
7. B | Q60354 | Putative methyltransferase MJ0046 | 3.05e-11 | NA | 5.66e-05 | NA |
7. B | Q8EHW5 | Ribosomal RNA large subunit methyltransferase G | 2.39e-09 | NA | 0.007 | NA |
7. B | B4SQ79 | Ribosomal RNA large subunit methyltransferase K/L | 2.85e-05 | NA | 0.002 | NA |
7. B | A5UFI6 | Ribosomal RNA small subunit methyltransferase C | 2.98e-10 | NA | 0.007 | NA |
7. B | Q31YL1 | Ribosomal RNA large subunit methyltransferase K/L | 2.99e-05 | NA | 0.003 | NA |
7. B | B7LNK6 | Ribosomal RNA small subunit methyltransferase C | 3.65e-09 | NA | 2.53e-04 | NA |
7. B | A4JBD7 | Ribosomal protein L11 methyltransferase | 8.98e-08 | NA | 0.009 | NA |
7. B | B7IFP7 | Ribosomal protein L11 methyltransferase | 2.82e-09 | NA | 0.008 | NA |
7. B | O67870 | Ribosomal protein L11 methyltransferase | 3.75e-09 | NA | 0.011 | NA |
7. B | B1IVY4 | Ribosomal RNA large subunit methyltransferase K/L | 2.81e-05 | NA | 0.003 | NA |
7. B | Q0T686 | Ribosomal RNA large subunit methyltransferase K/L | 3.13e-05 | NA | 0.002 | NA |
7. B | B4TGY8 | Ribosomal RNA small subunit methyltransferase C | 2.91e-09 | NA | 1.00e-04 | NA |
7. B | Q820Z6 | Ribosomal RNA small subunit methyltransferase C | 3.88e-09 | NA | 0.001 | NA |
7. B | A7ZK52 | Ribosomal RNA large subunit methyltransferase K/L | 3.17e-05 | NA | 0.004 | NA |
7. B | B5R6B4 | Ribosomal RNA large subunit methyltransferase K/L | 2.76e-05 | NA | 0.004 | NA |
7. B | A9MRB9 | Ribosomal RNA small subunit methyltransferase C | 1.81e-09 | NA | 1.70e-04 | NA |
7. B | P75864 | Ribosomal RNA large subunit methyltransferase K/L | 2.81e-05 | NA | 0.003 | NA |
7. B | A1RKM2 | Ribosomal RNA large subunit methyltransferase K/L | 5.26e-05 | NA | 9.80e-06 | NA |
7. B | A8FW59 | Ribosomal RNA large subunit methyltransferase K/L | 3.78e-05 | NA | 4.01e-04 | NA |
7. B | Q0SRE9 | Ribosomal protein L11 methyltransferase | 1.56e-09 | NA | 0.037 | NA |
7. B | B0BU33 | Ribosomal RNA small subunit methyltransferase C | 3.64e-10 | NA | 0.009 | NA |
7. B | B5Z4Q2 | Ribosomal RNA small subunit methyltransferase C | 3.99e-09 | NA | 3.33e-04 | NA |
7. B | C0Q8C5 | Ribosomal RNA large subunit methyltransferase I | 2.58e-08 | NA | 0.008 | NA |
7. B | A0M4S0 | Ribosomal RNA large subunit methyltransferase F | 1.94e-09 | NA | 0.001 | NA |
7. B | Q290Z2 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 1.07e-10 | NA | 0.013 | NA |
7. B | A4Y5X4 | Ribosomal RNA large subunit methyltransferase K/L | 5.07e-05 | NA | 1.55e-05 | NA |
7. B | B8FUN2 | Ribosomal protein L11 methyltransferase | 2.61e-09 | NA | 0.036 | NA |
7. B | Q8FJ71 | Ribosomal RNA large subunit methyltransferase I | 2.50e-08 | NA | 0.039 | NA |
7. B | Q39JS9 | Ribosomal protein L11 methyltransferase | 1.03e-07 | NA | 0.013 | NA |
7. B | Q6D459 | Ribosomal RNA large subunit methyltransferase K/L | 2.55e-05 | NA | 0.050 | NA |
7. B | A0Q621 | Ribosomal RNA large subunit methyltransferase K/L | 5.82e-05 | NA | 0.030 | NA |
7. B | Q59043 | Putative ribosomal RNA large subunit methyltransferase MJ1649 | 8.21e-08 | NA | 0.025 | NA |
7. B | Q043X8 | Ribosomal protein L11 methyltransferase | 4.45e-09 | NA | 0.024 | NA |
7. B | P40816 | Release factor glutamine methyltransferase | 2.00e-12 | NA | 5.18e-04 | NA |
7. B | A4W8W0 | Ribosomal RNA large subunit methyltransferase K/L | 3.26e-05 | NA | 0.023 | NA |
7. B | B1LJ30 | Ribosomal RNA large subunit methyltransferase I | 2.96e-08 | NA | 0.047 | NA |
7. B | Q9I347 | 50S ribosomal protein L3 glutamine methyltransferase | 4.58e-09 | NA | 2.78e-05 | NA |
7. B | B5F512 | Ribosomal RNA small subunit methyltransferase C | 3.30e-09 | NA | 1.05e-04 | NA |
7. B | B5R9T9 | Ribosomal RNA small subunit methyltransferase C | 2.94e-09 | NA | 1.18e-04 | NA |
7. B | B5BL07 | Ribosomal RNA small subunit methyltransferase C | 3.07e-09 | NA | 1.01e-04 | NA |
7. B | P0DPA9 | Psilocybin synthase | 7.57e-10 | NA | 1.37e-05 | NA |
7. B | A6T766 | Ribosomal RNA large subunit methyltransferase I | 2.12e-08 | NA | 0.023 | NA |
7. B | Q8R933 | Uncharacterized RNA methyltransferase TTE1797 | 1.67e-07 | NA | 0.001 | NA |
7. B | Q5NIA7 | Release factor glutamine methyltransferase | 7.70e-12 | NA | 0.002 | NA |
7. B | A8AID1 | Ribosomal RNA large subunit methyltransferase K/L | 2.61e-05 | NA | 0.010 | NA |
7. B | Q0T8U3 | Ribosomal RNA small subunit methyltransferase C | 3.89e-09 | NA | 3.01e-04 | NA |
7. B | A9N6W0 | Ribosomal RNA large subunit methyltransferase I | 1.87e-08 | NA | 0.009 | NA |
7. B | Q7CHK7 | Ribosomal RNA large subunit methyltransferase K/L | 2.62e-05 | NA | 0.026 | NA |
7. B | B5XY56 | Ribosomal RNA large subunit methyltransferase K/L | 2.78e-05 | NA | 0.002 | NA |
7. B | Q5PK16 | Ribosomal RNA small subunit methyltransferase C | 1.94e-09 | NA | 1.01e-04 | NA |
7. B | Q24SS5 | Ribosomal protein L11 methyltransferase | 2.42e-09 | NA | 0.037 | NA |
7. B | A1A9N6 | Ribosomal RNA large subunit methyltransferase I | 2.93e-08 | NA | 0.039 | NA |
7. B | B7MTB6 | Ribosomal RNA small subunit methyltransferase C | 4.12e-09 | NA | 3.12e-04 | NA |
7. B | Q488Q3 | Ribosomal RNA large subunit methyltransferase G | 2.33e-09 | NA | 0.017 | NA |
7. B | Q0T667 | Ribosomal RNA large subunit methyltransferase I | 2.12e-08 | NA | 0.044 | NA |
7. B | A6Q2V7 | tRNA/tmRNA (uracil-C(5))-methyltransferase | 2.67e-08 | NA | 0.046 | NA |
7. B | P44524 | Ribosomal RNA large subunit methyltransferase K/L | 3.57e-05 | NA | 0.044 | NA |
7. B | B0V5N2 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.21e-07 | NA | 0.039 | NA |
7. B | B2VDF6 | Ribosomal RNA large subunit methyltransferase K/L | 3.14e-05 | NA | 0.029 | NA |
7. B | A9N6Y0 | Ribosomal RNA large subunit methyltransferase K/L | 2.58e-05 | NA | 0.004 | NA |
7. B | C4ZQ93 | Ribosomal RNA large subunit methyltransferase I | 2.00e-08 | NA | 0.045 | NA |
7. B | Q5PGE3 | Ribosomal RNA large subunit methyltransferase K/L | 2.77e-05 | NA | 0.004 | NA |
7. B | A9L591 | Ribosomal RNA large subunit methyltransferase K/L | 5.76e-05 | NA | 9.03e-06 | NA |
7. B | B7I675 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.45e-07 | NA | 0.040 | NA |
7. B | Q9PD67 | Release factor glutamine methyltransferase | 1.43e-12 | NA | 4.25e-05 | NA |
7. B | B5F1U5 | Ribosomal RNA large subunit methyltransferase K/L | 2.74e-05 | NA | 0.004 | NA |
7. B | A3DF23 | Ribosomal protein L11 methyltransferase | 1.82e-09 | NA | 0.023 | NA |
7. B | Q57QS3 | Ribosomal RNA large subunit methyltransferase I | 2.00e-08 | NA | 0.009 | NA |
7. B | Q1CGJ3 | Ribosomal RNA large subunit methyltransferase K/L | 2.45e-05 | NA | 0.026 | NA |
7. B | A8ALZ1 | Ribosomal RNA small subunit methyltransferase C | 4.02e-09 | NA | 0.001 | NA |
7. B | B4TDY8 | Ribosomal RNA large subunit methyltransferase K/L | 2.62e-05 | NA | 0.004 | NA |
7. B | B5FTB3 | Ribosomal RNA small subunit methyltransferase C | 2.93e-09 | NA | 1.05e-04 | NA |
7. B | Q1CA41 | Ribosomal RNA large subunit methyltransferase K/L | 2.51e-05 | NA | 0.026 | NA |
7. B | B4T4F9 | Ribosomal RNA small subunit methyltransferase C | 2.83e-09 | NA | 6.69e-05 | NA |
7. B | P0ACC1 | Release factor glutamine methyltransferase | 1.73e-12 | NA | 6.68e-05 | NA |
7. B | B5YT98 | Ribosomal RNA large subunit methyltransferase I | 2.56e-08 | NA | 0.044 | NA |
7. B | B7H018 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.79e-07 | NA | 0.039 | NA |
7. B | Q1H501 | Ribosomal RNA large subunit methyltransferase F | 1.92e-08 | NA | 0.006 | NA |
7. B | Q8RB66 | Ribosomal protein L11 methyltransferase | 3.78e-09 | NA | 0.002 | NA |
7. B | Q4QPN2 | Ribosomal RNA small subunit methyltransferase C | 2.72e-10 | NA | 0.004 | NA |
7. B | A5UFS2 | Ribosomal RNA large subunit methyltransferase K/L | 3.74e-05 | NA | 0.046 | NA |
7. B | A7ZYR9 | Ribosomal RNA large subunit methyltransferase I | 1.85e-08 | NA | 0.045 | NA |
7. B | B4TU29 | Ribosomal RNA small subunit methyltransferase C | 3.00e-09 | NA | 1.05e-04 | NA |
7. B | A5UBC5 | Ribosomal RNA small subunit methyltransferase C | 2.79e-10 | NA | 0.036 | NA |
7. B | Q61J97 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 1.22e-05 | NA | 6.37e-04 | NA |
7. B | B2HTF7 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.43e-07 | NA | 0.040 | NA |
7. B | Q0TJB3 | Ribosomal RNA large subunit methyltransferase K/L | 3.05e-05 | NA | 0.006 | NA |
7. B | Q892R2 | Ribosomal protein L11 methyltransferase | 1.23e-09 | NA | 0.001 | NA |
7. B | B5YT79 | Ribosomal RNA large subunit methyltransferase K/L | 2.92e-05 | NA | 0.004 | NA |
7. B | B0VKL3 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 5.33e-07 | NA | 0.032 | NA |
7. B | Q1QCP8 | Ribosomal RNA large subunit methyltransferase K/L | 8.98e-05 | NA | 5.61e-04 | NA |
7. B | Q554C9 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 6.80e-05 | NA | 0.009 | NA |
7. B | O42662 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 3.18e-09 | NA | 6.01e-05 | NA |
7. B | B5R2I6 | Ribosomal RNA small subunit methyltransferase C | 3.20e-09 | NA | 1.05e-04 | NA |
7. B | A6T742 | Ribosomal RNA large subunit methyltransferase K/L | 2.81e-05 | NA | 0.002 | NA |
7. B | Q4FTN9 | Ribosomal RNA large subunit methyltransferase K/L | 9.43e-05 | NA | 8.19e-04 | NA |
7. B | B1JQR7 | Ribosomal RNA large subunit methyltransferase K/L | 2.42e-05 | NA | 0.026 | NA |
7. B | Q89AI2 | Ribosomal RNA small subunit methyltransferase C | 7.97e-10 | NA | 0.008 | NA |
7. B | B2JYS1 | Ribosomal RNA large subunit methyltransferase K/L | 2.59e-05 | NA | 0.029 | NA |
7. B | A3D5Q0 | Ribosomal RNA large subunit methyltransferase K/L | 6.00e-05 | NA | 2.66e-05 | NA |
7. B | Q6ANQ6 | Ribosomal RNA large subunit methyltransferase F | 5.47e-09 | NA | 0.007 | NA |
7. B | B2TTS7 | Ribosomal RNA large subunit methyltransferase I | 1.95e-08 | NA | 0.041 | NA |
7. B | B1X8S1 | Ribosomal RNA large subunit methyltransferase I | 1.97e-08 | NA | 0.045 | NA |
7. B | A6H162 | Release factor glutamine methyltransferase | 2.95e-11 | NA | 9.44e-08 | NA |
7. B | A6THY6 | Ribosomal RNA small subunit methyltransferase C | 2.89e-09 | NA | 0.022 | NA |
7. B | Q5PGB6 | Ribosomal RNA large subunit methyltransferase I | 2.41e-08 | NA | 0.009 | NA |
7. B | A8H3Y1 | Ribosomal RNA large subunit methyltransferase K/L | 4.63e-05 | NA | 1.29e-05 | NA |
7. B | P75876 | Ribosomal RNA large subunit methyltransferase I | 1.93e-08 | NA | 0.045 | NA |
7. B | B9MJY9 | Ribosomal protein L11 methyltransferase | 1.51e-09 | NA | 8.35e-04 | NA |
7. B | Q0I4C6 | Ribosomal RNA large subunit methyltransferase K/L | 3.54e-05 | NA | 0.002 | NA |
7. B | Q31YN0 | Ribosomal RNA large subunit methyltransferase I | 1.92e-08 | NA | 0.044 | NA |
7. B | Q5F783 | 50S ribosomal protein L3 glutamine methyltransferase | 2.24e-09 | NA | 9.75e-06 | NA |
7. B | A9MHU0 | Ribosomal RNA large subunit methyltransferase K/L | 2.78e-05 | NA | 0.002 | NA |
7. B | Q83LM0 | Ribosomal RNA large subunit methyltransferase I | 2.06e-08 | NA | 0.043 | NA |
7. B | Q8Y4A9 | Release factor glutamine methyltransferase | 1.90e-11 | NA | 0.021 | NA |
7. B | A9N7C4 | Ribosomal RNA small subunit methyltransferase C | 2.92e-09 | NA | 1.17e-04 | NA |
7. B | Q5P7U3 | Ubiquinone biosynthesis O-methyltransferase | 1.38e-10 | NA | 3.35e-04 | NA |
7. B | A0L8B5 | Ribosomal RNA large subunit methyltransferase K/L | 4.14e-05 | NA | 0.038 | NA |
7. B | A8AIB0 | Ribosomal RNA large subunit methyltransferase I | 1.95e-08 | NA | 0.015 | NA |
7. B | E4ZBM0 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 7.50e-07 | NA | 0.019 | NA |
7. B | Q1RDP5 | Ribosomal RNA large subunit methyltransferase I | 2.96e-08 | NA | 0.040 | NA |
7. B | B3PIL6 | Ribosomal RNA large subunit methyltransferase K/L | 8.82e-05 | NA | 0.003 | NA |
7. B | B5F1W3 | Ribosomal RNA large subunit methyltransferase I | 2.49e-08 | NA | 0.009 | NA |
7. B | P45558 | Ribosomal protein L11 methyltransferase | 1.68e-09 | NA | 0.003 | NA |
7. B | P9WHV3 | Release factor glutamine methyltransferase | 2.00e-11 | NA | 9.83e-05 | NA |
7. B | Q81JX2 | Release factor glutamine methyltransferase | 4.22e-11 | NA | 0.001 | NA |
7. B | B4TE06 | Ribosomal RNA large subunit methyltransferase I | 2.61e-08 | NA | 0.009 | NA |
7. B | Q8ECQ4 | 50S ribosomal protein L3 glutamine methyltransferase | 2.83e-09 | NA | 0.008 | NA |