Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54596.1
JCVISYN3A_0046
Recombination protein.
M. mycoides homolog: Q6MUI4.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 4
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 652
Unique PROST Homologs: 0
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
C1CFP3
(Recombination protein RecR) with a FATCAT P-Value: 0 and RMSD of 2.38 angstrom. The sequence alignment identity is 35.7%.
Structural alignment shown in left. Query protein AVX54596.1 colored as red in alignment, homolog C1CFP3 colored as blue.
Query protein AVX54596.1 is also shown in right top, homolog C1CFP3 showed in right bottom. They are colored based on secondary structures.
AVX54596.1 ML-ETTFDEIIESIRTNQGLTKKTSERLLVDLL-INKDKLDQFIDQLNKAKQLISTCKICGYLSENDKCLVCSLENRNQNIICIVSTIL---DAKNI--- 92 C1CFP3 MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDDPCSICTDSTRDQ------TTILVLEDSRDVAAM 94 AVX54596.1 ENTNKYKGVYHILNGEIN-LNKNITLDKLNISSIFKRINDN--TEIILALNSTFEGELTANYLYKLLSTKNIKITRLAKGIPMGASLDYMDEFTLQSAFL 189 C1CFP3 ENIQEYHGLYHVLHGLISPMN-GISPDDINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADIEYADEVTLLRAIE 193 AVX54596.1 NRKKYGE 196 C1CFP3 NRTEL-- 198
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006281 | DNA repair |
| 1. PBF | GO:0003677 | DNA binding |
| 1. PBF | GO:0006310 | DNA recombination |
| 1. PBF | GO:0046872 | metal ion binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003677 | DNA binding |
| GO:0006281 | DNA repair |
| GO:0006974 | cellular response to DNA damage stimulus |
| GO:0006310 | DNA recombination |
| GO:0046872 | metal ion binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q73FZ1 | Recombination protein RecR | 0.00e+00 | 2.17e-53 | 2.70e-38 | 0.8975 |
| 1. PBF | Q11W94 | Recombination protein RecR | 0.00e+00 | 7.44e-49 | 2.77e-38 | 0.891 |
| 1. PBF | Q8DV99 | Recombination protein RecR | 0.00e+00 | 1.97e-50 | 9.84e-36 | 0.8703 |
| 1. PBF | B3E1K3 | Recombination protein RecR | 0.00e+00 | 1.24e-42 | 2.58e-36 | 0.9196 |
| 1. PBF | Q0HHZ4 | Recombination protein RecR | 0.00e+00 | 5.12e-46 | 1.24e-27 | 0.8814 |
| 1. PBF | B2UU73 | Recombination protein RecR | 0.00e+00 | 9.81e-41 | 5.02e-11 | 0.8125 |
| 1. PBF | A4J0J1 | Recombination protein RecR | 0.00e+00 | 9.70e-43 | 9.82e-38 | 0.8985 |
| 1. PBF | C1CM11 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8785 |
| 1. PBF | B0UWK7 | Recombination protein RecR | 0.00e+00 | 9.27e-45 | 1.31e-28 | 0.8883 |
| 1. PBF | A7MUE4 | Recombination protein RecR | 0.00e+00 | 4.66e-49 | 8.46e-30 | 0.879 |
| 1. PBF | Q2GFZ4 | Recombination protein RecR | 0.00e+00 | 8.29e-45 | 4.09e-30 | 0.8974 |
| 1. PBF | Q9Z8N9 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 3.57e-22 | 0.8258 |
| 1. PBF | A0Q3R3 | Recombination protein RecR | 0.00e+00 | 1.37e-48 | 1.13e-41 | 0.8913 |
| 1. PBF | Q81W16 | Recombination protein RecR | 0.00e+00 | 1.90e-44 | 1.01e-42 | 0.8895 |
| 1. PBF | A5FN24 | Recombination protein RecR | 0.00e+00 | 3.17e-46 | 1.20e-34 | 0.8791 |
| 1. PBF | A7IGE1 | Recombination protein RecR | 0.00e+00 | 4.08e-46 | 4.13e-29 | 0.8925 |
| 1. PBF | A4SEY8 | Recombination protein RecR | 0.00e+00 | 3.36e-45 | 1.58e-38 | 0.8806 |
| 1. PBF | A0ZZN6 | Recombination protein RecR | 0.00e+00 | 8.67e-45 | 1.68e-43 | 0.916 |
| 1. PBF | A0Q9T5 | Recombination protein RecR | 0.00e+00 | 1.21e-42 | 6.42e-39 | 0.8572 |
| 1. PBF | Q8KE84 | Recombination protein RecR | 0.00e+00 | 7.27e-44 | 4.03e-35 | 0.8839 |
| 1. PBF | Q2YPN0 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.04e-31 | 0.8924 |
| 1. PBF | A8FX84 | Recombination protein RecR | 0.00e+00 | 5.24e-46 | 9.02e-26 | 0.8783 |
| 1. PBF | A1V4L5 | Recombination protein RecR | 0.00e+00 | 2.69e-48 | 2.91e-33 | 0.8946 |
| 1. PBF | A6T5N5 | Recombination protein RecR | 0.00e+00 | 3.02e-48 | 2.36e-29 | 0.8826 |
| 1. PBF | A5UTH3 | Recombination protein RecR | 0.00e+00 | 3.29e-38 | 1.86e-33 | 0.9057 |
| 1. PBF | A3NA68 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 2.17e-33 | 0.8935 |
| 1. PBF | Q932G3 | Recombination protein RecR | 0.00e+00 | 1.43e-48 | 4.92e-41 | 0.9037 |
| 1. PBF | Q9PCH1 | Recombination protein RecR | 0.00e+00 | 5.74e-53 | 2.64e-33 | 0.8909 |
| 1. PBF | A1UU36 | Recombination protein RecR | 0.00e+00 | 9.18e-50 | 4.85e-33 | 0.8847 |
| 1. PBF | A9IMX8 | Recombination protein RecR | 0.00e+00 | 4.13e-47 | 2.68e-33 | 0.879 |
| 1. PBF | Q6HPZ0 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.891 |
| 1. PBF | A8FMW9 | Recombination protein RecR | 0.00e+00 | 1.86e-41 | 2.79e-21 | 0.8013 |
| 1. PBF | B0KPW7 | Recombination protein RecR | 0.00e+00 | 8.81e-52 | 1.31e-32 | 0.8678 |
| 1. PBF | Q1LLH0 | Recombination protein RecR | 0.00e+00 | 1.06e-38 | 1.68e-32 | 0.8948 |
| 1. PBF | Q1QCM0 | Recombination protein RecR | 0.00e+00 | 1.64e-46 | 6.46e-38 | 0.8833 |
| 1. PBF | A8LQA8 | Recombination protein RecR | 0.00e+00 | 7.62e-49 | 1.04e-30 | 0.9174 |
| 1. PBF | Q5WT52 | Recombination protein RecR | 0.00e+00 | 9.46e-46 | 5.62e-27 | 0.908 |
| 1. PBF | Q2JH53 | Recombination protein RecR | 0.00e+00 | 2.84e-42 | 5.44e-34 | 0.8871 |
| 1. PBF | B1I162 | Recombination protein RecR | 0.00e+00 | 2.51e-48 | 6.35e-39 | 0.8993 |
| 1. PBF | Q83N83 | Recombination protein RecR | 0.00e+00 | 8.99e-51 | 4.92e-41 | 0.9059 |
| 1. PBF | Q14I28 | Recombination protein RecR | 0.00e+00 | 5.61e-46 | 3.58e-29 | 0.901 |
| 1. PBF | C0QAG9 | Recombination protein RecR | 0.00e+00 | 8.86e-45 | 1.62e-36 | 0.8731 |
| 1. PBF | A3PMA3 | Recombination protein RecR | 0.00e+00 | 3.10e-46 | 5.41e-32 | 0.889 |
| 1. PBF | B4T9H9 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8824 |
| 1. PBF | Q21YG1 | Recombination protein RecR | 0.00e+00 | 4.18e-48 | 1.88e-30 | 0.8934 |
| 1. PBF | Q1H0Z5 | Recombination protein RecR | 0.00e+00 | 2.01e-46 | 1.19e-35 | 0.8973 |
| 1. PBF | O30823 | Recombination protein RecR | 0.00e+00 | 1.90e-14 | 9.20e-26 | 0.9033 |
| 1. PBF | Q89BN4 | Recombination protein RecR | 0.00e+00 | 4.97e-50 | 7.92e-33 | 0.8933 |
| 1. PBF | B7NIF8 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8823 |
| 1. PBF | A4SWQ6 | Recombination protein RecR | 0.00e+00 | 8.45e-36 | 3.24e-32 | 0.884 |
| 1. PBF | A4W7F6 | Recombination protein RecR | 0.00e+00 | 7.60e-50 | 4.18e-29 | 0.8795 |
| 1. PBF | C6E8Y9 | Recombination protein RecR | 0.00e+00 | 3.21e-45 | 4.09e-33 | 0.9052 |
| 1. PBF | Q6MH30 | Recombination protein RecR | 0.00e+00 | 9.27e-45 | 1.68e-28 | 0.8925 |
| 1. PBF | B5Z7S9 | Recombination protein RecR | 0.00e+00 | 1.65e-39 | 5.24e-12 | 0.8125 |
| 1. PBF | Q9ZKS6 | Recombination protein RecR | 0.00e+00 | 1.68e-40 | 3.51e-10 | 0.7824 |
| 1. PBF | A1TQI0 | Recombination protein RecR | 0.00e+00 | 6.07e-40 | 1.24e-30 | 0.8986 |
| 1. PBF | B2U4S5 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8841 |
| 1. PBF | A9VN38 | Recombination protein RecR | 0.00e+00 | 9.07e-45 | 8.72e-43 | 0.8925 |
| 1. PBF | A3Q7A7 | Recombination protein RecR | 0.00e+00 | 4.51e-45 | 5.76e-39 | 0.8604 |
| 1. PBF | Q7V6R9 | Recombination protein RecR | 0.00e+00 | 9.70e-45 | 9.73e-34 | 0.8853 |
| 1. PBF | B7HPT6 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8904 |
| 1. PBF | A2S287 | Recombination protein RecR | 0.00e+00 | 2.69e-48 | 2.91e-33 | 0.8898 |
| 1. PBF | A5UA46 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 4.56e-30 | 0.8778 |
| 1. PBF | B8G7M4 | Recombination protein RecR | 0.00e+00 | 4.61e-41 | 1.90e-31 | 0.9008 |
| 1. PBF | Q16BD5 | Recombination protein RecR | 0.00e+00 | 3.29e-45 | 3.54e-29 | 0.8712 |
| 1. PBF | A0Q768 | Recombination protein RecR | 0.00e+00 | 5.19e-47 | 4.86e-30 | 0.8895 |
| 1. PBF | Q6FA18 | Recombination protein RecR | 0.00e+00 | 6.77e-45 | 2.98e-39 | 0.9138 |
| 1. PBF | P9WHI2 | Recombination protein RecR | 0.00e+00 | 8.88e-44 | 5.00e-39 | 0.8883 |
| 1. PBF | C1D0V5 | Recombination protein RecR | 0.00e+00 | 1.03e-46 | 1.83e-39 | 0.9207 |
| 1. PBF | B1YRE7 | Recombination protein RecR | 0.00e+00 | 5.62e-49 | 5.99e-33 | 0.8913 |
| 1. PBF | Q8E641 | Recombination protein RecR | 0.00e+00 | 2.30e-49 | 5.96e-38 | 0.8743 |
| 1. PBF | P96053 | Recombination protein RecR | 0.00e+00 | 8.07e-46 | 1.18e-35 | 0.8761 |
| 1. PBF | Q8XPB8 | Recombination protein RecR | 0.00e+00 | 9.70e-52 | 1.45e-40 | 0.9047 |
| 1. PBF | B3QCG7 | Recombination protein RecR | 0.00e+00 | 7.24e-45 | 2.76e-35 | 0.9001 |
| 1. PBF | Q2SIW9 | Recombination protein RecR | 0.00e+00 | 4.92e-48 | 6.07e-27 | 0.9148 |
| 1. PBF | Q9XAI4 | Recombination protein RecR | 0.00e+00 | 3.52e-45 | 3.42e-37 | 0.9175 |
| 1. PBF | Q46ZF9 | Recombination protein RecR | 0.00e+00 | 2.58e-40 | 3.38e-33 | 0.8925 |
| 1. PBF | Q0T7B2 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8821 |
| 1. PBF | Q31NH0 | Recombination protein RecR | 0.00e+00 | 4.78e-46 | 2.58e-31 | 0.8795 |
| 1. PBF | Q3K1U0 | Recombination protein RecR | 0.00e+00 | 2.30e-49 | 5.96e-38 | 0.8727 |
| 1. PBF | A6TXC7 | Recombination protein RecR | 0.00e+00 | 1.64e-46 | 2.06e-37 | 0.8921 |
| 1. PBF | B8IFQ5 | Recombination protein RecR | 0.00e+00 | 2.45e-48 | 1.62e-32 | 0.8815 |
| 1. PBF | P65993 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8783 |
| 1. PBF | Q73MF9 | Recombination protein RecR | 0.00e+00 | 1.55e-56 | 3.06e-36 | 0.8592 |
| 1. PBF | Q3A7K8 | Recombination protein RecR | 0.00e+00 | 7.33e-47 | 6.22e-33 | 0.8788 |
| 1. PBF | Q9JUB6 | Recombination protein RecR | 0.00e+00 | 3.81e-46 | 1.18e-24 | 0.8929 |
| 1. PBF | Q39FP6 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 1.41e-34 | 0.9081 |
| 1. PBF | A1R2K7 | Recombination protein RecR | 0.00e+00 | 8.22e-47 | 7.28e-39 | 0.9188 |
| 1. PBF | B1LJM9 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8816 |
| 1. PBF | B1YGD0 | Recombination protein RecR | 0.00e+00 | 1.01e-45 | 2.29e-43 | 0.8926 |
| 1. PBF | Q82EQ7 | Recombination protein RecR | 0.00e+00 | 9.44e-47 | 7.12e-36 | 0.9038 |
| 1. PBF | Q6NC55 | Recombination protein RecR | 0.00e+00 | 7.24e-45 | 2.76e-35 | 0.8995 |
| 1. PBF | B7K2B2 | Recombination protein RecR | 0.00e+00 | 3.60e-45 | 1.93e-34 | 0.895 |
| 1. PBF | Q2SWF7 | Recombination protein RecR | 0.00e+00 | 1.76e-47 | 1.21e-32 | 0.8948 |
| 1. PBF | A5IHT0 | Recombination protein RecR | 0.00e+00 | 9.46e-46 | 5.62e-27 | 0.9083 |
| 1. PBF | B3W9Z0 | Recombination protein RecR | 0.00e+00 | 2.27e-44 | 4.88e-37 | 0.8934 |
| 1. PBF | Q5LDK8 | Recombination protein RecR | 0.00e+00 | 2.96e-46 | 1.39e-33 | 0.884 |
| 1. PBF | B2GAD9 | Recombination protein RecR | 0.00e+00 | 1.21e-45 | 3.58e-34 | 0.8895 |
| 1. PBF | B4EU79 | Recombination protein RecR | 0.00e+00 | 9.46e-46 | 1.21e-28 | 0.8904 |
| 1. PBF | B1XFQ9 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8823 |
| 1. PBF | A5IQ32 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 3.83e-41 | 0.9041 |
| 1. PBF | B3QMU8 | Recombination protein RecR | 0.00e+00 | 3.29e-45 | 2.54e-36 | 0.8837 |
| 1. PBF | P65996 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8785 |
| 1. PBF | B1AI75 | Recombination protein RecR | 0.00e+00 | 8.16e-54 | 4.55e-33 | 0.8908 |
| 1. PBF | A0KY04 | Recombination protein RecR | 0.00e+00 | 9.90e-46 | 6.73e-28 | 0.8833 |
| 1. PBF | Q0IBC2 | Recombination protein RecR | 0.00e+00 | 3.00e-45 | 1.76e-31 | 0.8882 |
| 1. PBF | Q12B97 | Recombination protein RecR | 0.00e+00 | 2.03e-36 | 2.70e-29 | 0.9023 |
| 1. PBF | B0T1T2 | Recombination protein RecR | 0.00e+00 | 1.89e-43 | 2.15e-33 | 0.907 |
| 1. PBF | Q9JZ92 | Recombination protein RecR | 0.00e+00 | 5.87e-46 | 3.83e-25 | 0.9022 |
| 1. PBF | B5QU75 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8832 |
| 1. PBF | A3QF51 | Recombination protein RecR | 0.00e+00 | 8.56e-49 | 2.11e-28 | 0.8771 |
| 1. PBF | B3EIC5 | Recombination protein RecR | 0.00e+00 | 1.06e-46 | 1.75e-34 | 0.8811 |
| 1. PBF | Q0C593 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 8.84e-36 | 0.9066 |
| 1. PBF | Q9PKF4 | Recombination protein RecR | 0.00e+00 | 1.25e-49 | 2.71e-23 | 0.8461 |
| 1. PBF | B5EJE1 | Recombination protein RecR | 0.00e+00 | 7.60e-50 | 3.28e-34 | 0.9177 |
| 1. PBF | A9KQC9 | Recombination protein RecR | 0.00e+00 | 1.88e-50 | 6.42e-36 | 0.8825 |
| 1. PBF | Q0BEV4 | Recombination protein RecR | 0.00e+00 | 5.62e-49 | 5.99e-33 | 0.8926 |
| 1. PBF | A4JEQ3 | Recombination protein RecR | 0.00e+00 | 9.18e-49 | 7.59e-33 | 0.8934 |
| 1. PBF | Q9ABF8 | Recombination protein RecR | 0.00e+00 | 3.98e-44 | 4.73e-35 | 0.9004 |
| 1. PBF | B7LLP8 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8824 |
| 1. PBF | A8GNG2 | Recombination protein RecR | 0.00e+00 | 1.37e-49 | 9.64e-31 | 0.8911 |
| 1. PBF | Q92SW9 | Recombination protein RecR | 0.00e+00 | 4.88e-49 | 1.16e-33 | 0.898 |
| 1. PBF | P0DD88 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.878 |
| 1. PBF | Q8PNG0 | Recombination protein RecR | 0.00e+00 | 3.37e-54 | 1.35e-33 | 0.8882 |
| 1. PBF | C4KZX2 | Recombination protein RecR | 0.00e+00 | 7.92e-45 | 3.14e-41 | 0.8934 |
| 1. PBF | C3KXT0 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8886 |
| 1. PBF | Q1QQZ3 | Recombination protein RecR | 0.00e+00 | 9.85e-49 | 4.17e-36 | 0.8839 |
| 1. PBF | A1TGJ3 | Recombination protein RecR | 0.00e+00 | 1.24e-45 | 1.75e-38 | 0.8495 |
| 1. PBF | C3PNG9 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.64e-29 | 0.8979 |
| 1. PBF | Q8NY07 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.8945 |
| 1. PBF | Q2G492 | Recombination protein RecR | 0.00e+00 | 5.99e-51 | 1.27e-36 | 0.8701 |
| 1. PBF | A6UF23 | Recombination protein RecR | 0.00e+00 | 2.18e-48 | 4.74e-31 | 0.9 |
| 1. PBF | A1KQ47 | Recombination protein RecR | 0.00e+00 | 8.88e-44 | 5.00e-39 | 0.8805 |
| 1. PBF | P0CB76 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8827 |
| 1. PBF | B2G5V1 | Recombination protein RecR | 0.00e+00 | 9.41e-48 | 1.60e-37 | 0.8981 |
| 1. PBF | Q6GC08 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.8933 |
| 1. PBF | Q72I96 | Recombination protein RecR | 0.00e+00 | 1.01e-44 | 9.56e-38 | 0.9116 |
| 1. PBF | Q1AYP4 | Recombination protein RecR | 0.00e+00 | 2.98e-44 | 9.83e-30 | 0.8944 |
| 1. PBF | Q0A8I0 | Recombination protein RecR | 0.00e+00 | 5.09e-50 | 1.63e-35 | 0.9029 |
| 1. PBF | Q2Y7X0 | Recombination protein RecR | 0.00e+00 | 3.13e-52 | 3.96e-35 | 0.9042 |
| 1. PBF | Q1JL26 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8793 |
| 1. PBF | B2SGT0 | Recombination protein RecR | 0.00e+00 | 8.64e-46 | 4.53e-29 | 0.8995 |
| 1. PBF | Q3BWK3 | Recombination protein RecR | 0.00e+00 | 1.70e-53 | 2.21e-33 | 0.8868 |
| 1. PBF | Q2FJG2 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.9023 |
| 1. PBF | B0TY95 | Recombination protein RecR | 0.00e+00 | 1.60e-46 | 1.63e-27 | 0.8961 |
| 1. PBF | C0ZHA2 | Recombination protein RecR | 0.00e+00 | 4.67e-46 | 5.65e-34 | 0.8856 |
| 1. PBF | Q1J5W6 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8767 |
| 1. PBF | A1WTL2 | Recombination protein RecR | 0.00e+00 | 3.86e-49 | 8.40e-42 | 0.9105 |
| 1. PBF | Q8A8T6 | Recombination protein RecR | 0.00e+00 | 5.36e-46 | 4.54e-33 | 0.8887 |
| 1. PBF | Q2J2D3 | Recombination protein RecR | 0.00e+00 | 3.35e-47 | 6.46e-36 | 0.8967 |
| 1. PBF | A1SWZ8 | Recombination protein RecR | 0.00e+00 | 8.55e-50 | 9.77e-27 | 0.8855 |
| 1. PBF | Q2VZR6 | Recombination protein RecR | 0.00e+00 | 5.87e-46 | 1.36e-29 | 0.9085 |
| 1. PBF | A5GLY6 | Recombination protein RecR | 0.00e+00 | 7.37e-46 | 2.66e-32 | 0.88 |
| 1. PBF | Q7U7Q3 | Recombination protein RecR | 0.00e+00 | 2.62e-48 | 2.44e-35 | 0.8826 |
| 1. PBF | B1GZS8 | Recombination protein RecR | 0.00e+00 | 1.30e-48 | 4.20e-35 | 0.9168 |
| 1. PBF | B7MDZ4 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8837 |
| 1. PBF | A5HXS8 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8882 |
| 1. PBF | Q8FU10 | Recombination protein RecR | 0.00e+00 | 1.49e-38 | 1.47e-33 | 0.8383 |
| 1. PBF | Q97MR4 | Recombination protein RecR | 0.00e+00 | 1.11e-47 | 9.87e-40 | 0.8929 |
| 1. PBF | Q2P6V6 | Recombination protein RecR | 0.00e+00 | 5.87e-55 | 2.87e-32 | 0.8858 |
| 1. PBF | Q3ARC4 | Recombination protein RecR | 0.00e+00 | 7.54e-46 | 2.09e-36 | 0.8924 |
| 1. PBF | A6V7W8 | Recombination protein RecR | 0.00e+00 | 4.60e-52 | 6.37e-34 | 0.8661 |
| 1. PBF | Q8EFF8 | Recombination protein RecR | 0.00e+00 | 4.52e-47 | 3.98e-27 | 0.881 |
| 1. PBF | A6Q485 | Recombination protein RecR | 0.00e+00 | 9.96e-39 | 1.15e-18 | 0.8147 |
| 1. PBF | Q07H54 | Recombination protein RecR | 0.00e+00 | 2.07e-47 | 1.64e-34 | 0.8917 |
| 1. PBF | A9AGY1 | Recombination protein RecR | 0.00e+00 | 8.99e-48 | 4.06e-33 | 0.8972 |
| 1. PBF | Q0TV20 | Recombination protein RecR | 0.00e+00 | 9.70e-52 | 1.45e-40 | 0.9074 |
| 1. PBF | B1KNK2 | Recombination protein RecR | 0.00e+00 | 6.65e-48 | 3.11e-28 | 0.8816 |
| 1. PBF | Q5P7F1 | Recombination protein RecR | 0.00e+00 | 4.31e-45 | 5.87e-34 | 0.9155 |
| 1. PBF | A1JNB5 | Recombination protein RecR | 0.00e+00 | 8.97e-49 | 5.13e-28 | 0.8876 |
| 1. PBF | Q8EY84 | Recombination protein RecR | 0.00e+00 | 7.44e-49 | 1.06e-34 | 0.855 |
| 1. PBF | B8EP17 | Recombination protein RecR | 0.00e+00 | 1.21e-46 | 1.10e-36 | 0.8929 |
| 1. PBF | B1MVT6 | Recombination protein RecR | 0.00e+00 | 1.91e-45 | 9.39e-35 | 0.8724 |
| 1. PBF | P0A7H7 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8846 |
| 1. PBF | C0RG96 | Recombination protein RecR | 0.00e+00 | 3.60e-49 | 1.58e-31 | 0.8956 |
| 1. PBF | Q64UM9 | Recombination protein RecR | 0.00e+00 | 2.96e-46 | 1.39e-33 | 0.8842 |
| 1. PBF | Q5X1D9 | Recombination protein RecR | 0.00e+00 | 9.46e-46 | 5.62e-27 | 0.9077 |
| 1. PBF | Q03SS5 | Recombination protein RecR | 0.00e+00 | 7.78e-50 | 1.46e-32 | 0.8973 |
| 1. PBF | Q6G0M8 | Recombination protein RecR | 0.00e+00 | 7.30e-48 | 5.18e-32 | 0.8927 |
| 1. PBF | A3DHB7 | Recombination protein RecR | 0.00e+00 | 1.58e-43 | 2.83e-40 | 0.8777 |
| 1. PBF | Q1WSU5 | Recombination protein RecR | 0.00e+00 | 9.07e-45 | 3.17e-37 | 0.8841 |
| 1. PBF | P0DD89 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8738 |
| 1. PBF | A0KL54 | Recombination protein RecR | 0.00e+00 | 3.89e-44 | 4.51e-30 | 0.8758 |
| 1. PBF | Q65SE7 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 7.83e-31 | 0.88 |
| 1. PBF | Q32J52 | Recombination protein RecR | 0.00e+00 | 6.60e-50 | 2.60e-29 | 0.8799 |
| 1. PBF | A1B870 | Recombination protein RecR | 0.00e+00 | 1.70e-49 | 1.03e-33 | 0.8959 |
| 1. PBF | Q5L3X4 | Recombination protein RecR | 0.00e+00 | 2.97e-42 | 2.14e-40 | 0.8875 |
| 1. PBF | Q67TJ3 | Recombination protein RecR | 0.00e+00 | 2.77e-46 | 7.32e-38 | 0.9065 |
| 1. PBF | Q1RF63 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8829 |
| 1. PBF | A5FRM7 | Recombination protein RecR | 0.00e+00 | 2.41e-43 | 3.07e-35 | 0.9089 |
| 1. PBF | A1W8D4 | Recombination protein RecR | 0.00e+00 | 3.52e-45 | 2.00e-30 | 0.8836 |
| 1. PBF | Q1CL30 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8899 |
| 1. PBF | A5D6B3 | Recombination protein RecR | 0.00e+00 | 9.70e-45 | 7.65e-39 | 0.9033 |
| 1. PBF | A0R899 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8899 |
| 1. PBF | Q0S8Y4 | Recombination protein RecR | 0.00e+00 | 2.20e-46 | 9.32e-38 | 0.9032 |
| 1. PBF | B2T3S5 | Recombination protein RecR | 0.00e+00 | 6.10e-47 | 3.85e-33 | 0.8964 |
| 1. PBF | C1KZQ7 | Recombination protein RecR | 0.00e+00 | 1.16e-44 | 8.82e-41 | 0.8928 |
| 1. PBF | B8GYE0 | Recombination protein RecR | 0.00e+00 | 3.98e-44 | 4.73e-35 | 0.9127 |
| 1. PBF | A8YTF7 | Recombination protein RecR | 0.00e+00 | 1.19e-48 | 7.15e-33 | 0.8888 |
| 1. PBF | Q31I96 | Recombination protein RecR | 0.00e+00 | 8.55e-50 | 2.69e-32 | 0.901 |
| 1. PBF | A7ZIN2 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.88 |
| 1. PBF | A9LZB7 | Recombination protein RecR | 0.00e+00 | 2.45e-45 | 2.17e-25 | 0.8917 |
| 1. PBF | A5VIC4 | Recombination protein RecR | 0.00e+00 | 9.41e-48 | 1.60e-37 | 0.8918 |
| 1. PBF | B7IS39 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8916 |
| 1. PBF | Q2GCN1 | Recombination protein RecR | 0.00e+00 | 3.81e-51 | 7.63e-38 | 0.9056 |
| 1. PBF | B9JYJ6 | Recombination protein RecR | 0.00e+00 | 5.19e-47 | 4.22e-32 | 0.8899 |
| 1. PBF | B8CN00 | Recombination protein RecR | 0.00e+00 | 8.01e-48 | 5.25e-29 | 0.8847 |
| 1. PBF | A2RDV9 | Recombination protein RecR | 0.00e+00 | 5.19e-51 | 9.96e-35 | 0.8835 |
| 1. PBF | B0BXK8 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.72e-29 | 0.8799 |
| 1. PBF | Q5SHY0 | Recombination protein RecR | 0.00e+00 | 5.65e-45 | 9.98e-38 | 0.8652 |
| 1. PBF | Q03ZG8 | Recombination protein RecR | 0.00e+00 | 1.16e-44 | 4.18e-35 | 0.8661 |
| 1. PBF | Q045U7 | Recombination protein RecR | 0.00e+00 | 3.51e-49 | 1.47e-33 | 0.8939 |
| 1. PBF | A1KU46 | Recombination protein RecR | 0.00e+00 | 5.87e-46 | 3.83e-25 | 0.8946 |
| 1. PBF | B8DQU5 | Recombination protein RecR | 0.00e+00 | 2.55e-42 | 6.45e-24 | 0.8558 |
| 1. PBF | C3LTV3 | Recombination protein RecR | 0.00e+00 | 6.32e-49 | 7.66e-29 | 0.8817 |
| 1. PBF | B7KVW7 | Recombination protein RecR | 0.00e+00 | 1.19e-46 | 4.96e-32 | 0.8785 |
| 1. PBF | O83969 | Recombination protein RecR | 0.00e+00 | 6.75e-51 | 1.70e-34 | 0.8583 |
| 1. PBF | Q2A2I5 | Recombination protein RecR | 0.00e+00 | 3.17e-46 | 1.78e-29 | 0.8971 |
| 1. PBF | Q0VNM7 | Recombination protein RecR | 0.00e+00 | 2.09e-45 | 2.09e-31 | 0.893 |
| 1. PBF | A8GAV1 | Recombination protein RecR | 0.00e+00 | 2.09e-45 | 7.95e-28 | 0.8872 |
| 1. PBF | B0K101 | Recombination protein RecR | 0.00e+00 | 2.83e-46 | 2.09e-35 | 0.8938 |
| 1. PBF | Q8PBW4 | Recombination protein RecR | 0.00e+00 | 6.95e-57 | 2.01e-31 | 0.887 |
| 1. PBF | Q03E59 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 4.58e-34 | 0.8973 |
| 1. PBF | Q6AGY5 | Recombination protein RecR | 0.00e+00 | 3.55e-48 | 8.98e-39 | 0.9124 |
| 1. PBF | Q87MQ4 | Recombination protein RecR | 0.00e+00 | 2.13e-48 | 2.40e-29 | 0.8807 |
| 1. PBF | C3P9H0 | Recombination protein RecR | 0.00e+00 | 1.90e-44 | 1.01e-42 | 0.8936 |
| 1. PBF | A4WPW1 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 7.55e-33 | 0.88 |
| 1. PBF | B3QYJ4 | Recombination protein RecR | 0.00e+00 | 6.73e-46 | 3.66e-33 | 0.8859 |
| 1. PBF | Q88F32 | Recombination protein RecR | 0.00e+00 | 1.28e-50 | 3.27e-33 | 0.875 |
| 1. PBF | A3D5Q2 | Recombination protein RecR | 0.00e+00 | 6.97e-48 | 3.18e-27 | 0.8852 |
| 1. PBF | B7UKF2 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8854 |
| 1. PBF | Q1DAZ9 | Recombination protein RecR | 0.00e+00 | 1.57e-47 | 3.39e-34 | 0.8778 |
| 1. PBF | P0A454 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8742 |
| 1. PBF | Q084C7 | Recombination protein RecR | 0.00e+00 | 1.37e-48 | 4.36e-33 | 0.8773 |
| 1. PBF | B7JC18 | Recombination protein RecR | 0.00e+00 | 7.60e-50 | 3.28e-34 | 0.9159 |
| 1. PBF | Q3J7Z8 | Recombination protein RecR | 0.00e+00 | 1.63e-45 | 1.23e-31 | 0.8835 |
| 1. PBF | Q02K17 | Recombination protein RecR | 0.00e+00 | 1.90e-51 | 2.80e-34 | 0.8649 |
| 1. PBF | B0TB20 | Recombination protein RecR | 0.00e+00 | 5.59e-43 | 1.55e-38 | 0.9097 |
| 1. PBF | C3LIZ7 | Recombination protein RecR | 0.00e+00 | 1.90e-44 | 1.01e-42 | 0.8936 |
| 1. PBF | C5BD00 | Recombination protein RecR | 0.00e+00 | 5.40e-48 | 3.27e-28 | 0.8777 |
| 1. PBF | Q5FM04 | Recombination protein RecR | 0.00e+00 | 1.71e-46 | 5.16e-34 | 0.8903 |
| 1. PBF | Q1C4P6 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8872 |
| 1. PBF | Q5ZRX0 | Recombination protein RecR | 0.00e+00 | 1.21e-46 | 1.69e-27 | 0.9131 |
| 1. PBF | A7GJT7 | Recombination protein RecR | 0.00e+00 | 3.81e-44 | 1.50e-42 | 0.8831 |
| 1. PBF | B9IYI9 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8836 |
| 1. PBF | A5U941 | Recombination protein RecR | 0.00e+00 | 8.88e-44 | 5.00e-39 | 0.8595 |
| 1. PBF | A5F2N5 | Recombination protein RecR | 0.00e+00 | 6.32e-49 | 7.66e-29 | 0.877 |
| 1. PBF | C6BXI4 | Recombination protein RecR | 0.00e+00 | 7.95e-43 | 9.24e-21 | 0.8791 |
| 1. PBF | A8GUU1 | Recombination protein RecR | 0.00e+00 | 6.00e-50 | 9.87e-30 | 0.8822 |
| 1. PBF | O84243 | Recombination protein RecR | 0.00e+00 | 1.08e-47 | 5.82e-22 | 0.8431 |
| 1. PBF | B5BD46 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8824 |
| 1. PBF | Q88YP8 | Recombination protein RecR | 0.00e+00 | 4.72e-51 | 4.46e-35 | 0.9005 |
| 1. PBF | C4K7W2 | Recombination protein RecR | 0.00e+00 | 3.13e-47 | 7.17e-28 | 0.8855 |
| 1. PBF | Q7UQ68 | Recombination protein RecR | 0.00e+00 | 4.08e-48 | 2.61e-29 | 0.8883 |
| 1. PBF | B4RDT6 | Recombination protein RecR | 0.00e+00 | 9.70e-45 | 6.49e-36 | 0.9098 |
| 1. PBF | A1RIQ0 | Recombination protein RecR | 0.00e+00 | 8.78e-48 | 1.67e-27 | 0.8835 |
| 1. PBF | Q57S78 | Recombination protein RecR | 0.00e+00 | 6.28e-51 | 2.06e-29 | 0.8798 |
| 1. PBF | Q99WC3 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 3.83e-41 | 0.8988 |
| 1. PBF | Q63HE8 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8914 |
| 1. PBF | A4XJV1 | Recombination protein RecR | 0.00e+00 | 1.63e-44 | 6.83e-37 | 0.916 |
| 1. PBF | B3ES21 | Recombination protein RecR | 0.00e+00 | 2.68e-45 | 4.82e-33 | 0.8561 |
| 1. PBF | C1C8R1 | Recombination protein RecR | 0.00e+00 | 3.95e-49 | 1.45e-38 | 0.8832 |
| 1. PBF | Q47HW7 | Recombination protein RecR | 0.00e+00 | 1.85e-48 | 9.73e-36 | 0.9005 |
| 1. PBF | C1CFP3 | Recombination protein RecR | 0.00e+00 | 3.95e-49 | 1.45e-38 | 0.8895 |
| 1. PBF | Q7MIV4 | Recombination protein RecR | 0.00e+00 | 9.62e-49 | 1.57e-28 | 0.8827 |
| 1. PBF | Q2NCT4 | Recombination protein RecR | 0.00e+00 | 3.48e-50 | 5.44e-32 | 0.8866 |
| 1. PBF | B1JBZ1 | Recombination protein RecR | 0.00e+00 | 1.55e-52 | 1.80e-34 | 0.8813 |
| 1. PBF | C4L8U4 | Recombination protein RecR | 0.00e+00 | 3.46e-51 | 2.93e-24 | 0.8839 |
| 1. PBF | A5GS45 | Recombination protein RecR | 0.00e+00 | 1.29e-24 | 1.44e-34 | 0.887 |
| 1. PBF | Q81JB9 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8929 |
| 1. PBF | A8ZU38 | Recombination protein RecR | 0.00e+00 | 1.79e-42 | 1.21e-31 | 0.8401 |
| 1. PBF | B7GT67 | Recombination protein RecR | 0.00e+00 | 1.75e-40 | 9.97e-41 | 0.9117 |
| 1. PBF | Q035W7 | Recombination protein RecR | 0.00e+00 | 2.27e-44 | 4.88e-37 | 0.8948 |
| 1. PBF | A8G5G7 | Recombination protein RecR | 0.00e+00 | 1.33e-45 | 8.58e-32 | 0.8924 |
| 1. PBF | Q31AC8 | Recombination protein RecR | 0.00e+00 | 9.64e-48 | 1.93e-31 | 0.8916 |
| 1. PBF | B8F5Q8 | Recombination protein RecR | 0.00e+00 | 6.05e-45 | 6.14e-31 | 0.88 |
| 1. PBF | Q3SLE3 | Recombination protein RecR | 0.00e+00 | 2.10e-49 | 1.29e-29 | 0.8929 |
| 1. PBF | A5CCA2 | Recombination protein RecR | 0.00e+00 | 5.27e-48 | 3.86e-29 | 0.8877 |
| 1. PBF | C0Q810 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8807 |
| 1. PBF | B7KEM9 | Recombination protein RecR | 0.00e+00 | 3.48e-46 | 7.84e-36 | 0.8962 |
| 1. PBF | Q2KDY8 | Recombination protein RecR | 0.00e+00 | 1.27e-46 | 7.60e-34 | 0.8902 |
| 1. PBF | Q98RF8 | Recombination protein RecR | 0.00e+00 | 4.18e-48 | 2.60e-23 | 0.8066 |
| 1. PBF | Q4L3D6 | Recombination protein RecR | 0.00e+00 | 1.19e-47 | 7.66e-41 | 0.8912 |
| 1. PBF | Q5QWR1 | Recombination protein RecR | 0.00e+00 | 1.08e-48 | 1.32e-32 | 0.9172 |
| 1. PBF | B2IRS7 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8813 |
| 1. PBF | Q3KFA5 | Recombination protein RecR | 0.00e+00 | 1.19e-52 | 3.56e-34 | 0.8741 |
| 1. PBF | B9JGT9 | Recombination protein RecR | 0.00e+00 | 2.64e-46 | 1.31e-34 | 0.8936 |
| 1. PBF | A3MK89 | Recombination protein RecR | 0.00e+00 | 2.69e-48 | 2.91e-33 | 0.8935 |
| 1. PBF | A7ZXD0 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8852 |
| 1. PBF | B0B7F6 | Recombination protein RecR | 0.00e+00 | 2.23e-48 | 2.05e-21 | 0.841 |
| 1. PBF | A0K7U9 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 1.41e-34 | 0.9078 |
| 1. PBF | C1D5E0 | Recombination protein RecR | 0.00e+00 | 2.59e-49 | 4.07e-34 | 0.9037 |
| 1. PBF | A8AJX1 | Recombination protein RecR | 0.00e+00 | 1.19e-46 | 2.75e-29 | 0.8832 |
| 1. PBF | C1DEK8 | Recombination protein RecR | 0.00e+00 | 1.69e-51 | 2.75e-32 | 0.8816 |
| 1. PBF | Q38YT8 | Recombination protein RecR | 0.00e+00 | 7.78e-50 | 2.96e-34 | 0.8866 |
| 1. PBF | A6LBX7 | Recombination protein RecR | 0.00e+00 | 2.19e-45 | 1.65e-31 | 0.8881 |
| 1. PBF | A8GS42 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.72e-29 | 0.882 |
| 1. PBF | A5G9K4 | Recombination protein RecR | 0.00e+00 | 1.33e-45 | 1.47e-31 | 0.908 |
| 1. PBF | A5VMY2 | Recombination protein RecR | 0.00e+00 | 4.97e-50 | 2.41e-31 | 0.9021 |
| 1. PBF | Q48GK6 | Recombination protein RecR | 0.00e+00 | 2.38e-50 | 6.25e-33 | 0.8793 |
| 1. PBF | Q8EU58 | Recombination protein RecR | 0.00e+00 | 8.29e-45 | 4.36e-37 | 0.8943 |
| 1. PBF | Q8RDI4 | Recombination protein RecR | 0.00e+00 | 1.76e-47 | 1.86e-39 | 0.891 |
| 1. PBF | Q1BGY7 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 1.41e-34 | 0.9035 |
| 1. PBF | Q17WX2 | Recombination protein RecR | 0.00e+00 | 7.12e-42 | 2.30e-12 | 0.8 |
| 1. PBF | Q927D9 | Recombination protein RecR | 0.00e+00 | 7.40e-45 | 2.61e-40 | 0.8893 |
| 1. PBF | B5XM64 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8782 |
| 1. PBF | A8EYY2 | Recombination protein RecR | 0.00e+00 | 7.27e-52 | 8.46e-30 | 0.9097 |
| 1. PBF | Q5H401 | Recombination protein RecR | 0.00e+00 | 5.87e-55 | 2.87e-32 | 0.8843 |
| 1. PBF | Q18CA2 | Recombination protein RecR | 0.00e+00 | 8.31e-43 | 6.98e-38 | 0.8968 |
| 1. PBF | Q4QNA2 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 4.56e-30 | 0.871 |
| 1. PBF | B5FLJ4 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8841 |
| 1. PBF | B7L797 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8821 |
| 1. PBF | Q04J97 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8795 |
| 1. PBF | Q9KGM3 | Recombination protein RecR | 0.00e+00 | 3.72e-46 | 1.88e-37 | 0.8859 |
| 1. PBF | Q5F8K5 | Recombination protein RecR | 0.00e+00 | 1.27e-44 | 5.73e-25 | 0.9013 |
| 1. PBF | A7WYM0 | Recombination protein RecR | 0.00e+00 | 1.43e-48 | 4.92e-41 | 0.9024 |
| 1. PBF | Q3KMC2 | Recombination protein RecR | 0.00e+00 | 1.08e-47 | 5.82e-22 | 0.8398 |
| 1. PBF | Q8Y3X7 | Recombination protein RecR | 0.00e+00 | 1.16e-44 | 8.82e-41 | 0.8851 |
| 1. PBF | A8IGX4 | Recombination protein RecR | 0.00e+00 | 1.86e-44 | 9.10e-30 | 0.8627 |
| 1. PBF | A6T0H1 | Recombination protein RecR | 0.00e+00 | 1.06e-44 | 2.13e-32 | 0.9046 |
| 1. PBF | Q5XB92 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8796 |
| 1. PBF | Q8YEG8 | Recombination protein RecR | 0.00e+00 | 1.75e-50 | 8.68e-32 | 0.9019 |
| 1. PBF | Q609A9 | Recombination protein RecR | 0.00e+00 | 5.24e-46 | 6.23e-37 | 0.9079 |
| 1. PBF | A0JSD3 | Recombination protein RecR | 0.00e+00 | 2.06e-46 | 3.12e-40 | 0.9188 |
| 1. PBF | B1JTA5 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 1.41e-34 | 0.9083 |
| 1. PBF | P65991 | Recombination protein RecR | 0.00e+00 | 8.88e-44 | 5.00e-39 | 0.8629 |
| 1. PBF | B2ICM1 | Recombination protein RecR | 0.00e+00 | 4.66e-49 | 1.82e-32 | 0.8907 |
| 1. PBF | Q87Z00 | Recombination protein RecR | 0.00e+00 | 3.65e-50 | 1.19e-33 | 0.8766 |
| 1. PBF | A5CPD8 | Recombination protein RecR | 0.00e+00 | 1.08e-46 | 2.70e-41 | 0.919 |
| 1. PBF | Q68WU0 | Recombination protein RecR | 0.00e+00 | 1.97e-50 | 1.25e-30 | 0.8912 |
| 1. PBF | Q62JV0 | Recombination protein RecR | 0.00e+00 | 2.69e-48 | 2.91e-33 | 0.8934 |
| 1. PBF | Q5PB75 | Recombination protein RecR | 0.00e+00 | 1.13e-48 | 4.09e-30 | 0.9254 |
| 1. PBF | B7MQI7 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8818 |
| 1. PBF | Q8UJ45 | Recombination protein RecR | 0.00e+00 | 5.44e-47 | 1.42e-32 | 0.8949 |
| 1. PBF | A3CLS2 | Recombination protein RecR | 0.00e+00 | 9.70e-52 | 3.70e-38 | 0.865 |
| 1. PBF | Q6NJY0 | Recombination protein RecR | 0.00e+00 | 2.87e-36 | 1.75e-32 | 0.8384 |
| 1. PBF | A7FL89 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8877 |
| 1. PBF | Q5GRP0 | Recombination protein RecR | 0.00e+00 | 7.50e-53 | 8.76e-37 | 0.8772 |
| 1. PBF | B5ZAS4 | Recombination protein RecR | 0.00e+00 | 3.21e-54 | 4.16e-34 | 0.867 |
| 1. PBF | A5EY33 | Recombination protein RecR | 0.00e+00 | 3.25e-44 | 2.58e-36 | 0.8932 |
| 1. PBF | B7JJD6 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8929 |
| 1. PBF | B6JME6 | Recombination protein RecR | 0.00e+00 | 2.27e-40 | 5.40e-12 | 0.8156 |
| 1. PBF | A0LM17 | Recombination protein RecR | 0.00e+00 | 2.86e-41 | 2.11e-37 | 0.8603 |
| 1. PBF | A4G3Z0 | Recombination protein RecR | 0.00e+00 | 7.44e-43 | 3.98e-31 | 0.9057 |
| 1. PBF | Q1JAX6 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8799 |
| 1. PBF | B4S790 | Recombination protein RecR | 0.00e+00 | 8.41e-47 | 7.12e-39 | 0.8787 |
| 1. PBF | Q1GKB9 | Recombination protein RecR | 0.00e+00 | 2.41e-46 | 3.95e-30 | 0.88 |
| 1. PBF | Q7NFM5 | Recombination protein RecR | 0.00e+00 | 1.24e-48 | 2.22e-37 | 0.906 |
| 1. PBF | A0AM39 | Recombination protein RecR | 0.00e+00 | 1.19e-44 | 1.13e-40 | 0.8908 |
| 1. PBF | Q2RNN0 | Recombination protein RecR | 0.00e+00 | 2.25e-46 | 9.85e-34 | 0.9251 |
| 1. PBF | Q7WMF1 | Recombination protein RecR | 0.00e+00 | 9.62e-49 | 1.02e-34 | 0.8953 |
| 1. PBF | Q3Z8X4 | Recombination protein RecR | 0.00e+00 | 3.40e-41 | 2.77e-36 | 0.8921 |
| 1. PBF | A2BX84 | Recombination protein RecR | 0.00e+00 | 1.19e-46 | 2.22e-32 | 0.8837 |
| 1. PBF | Q5LMJ4 | Recombination protein RecR | 0.00e+00 | 4.80e-48 | 1.48e-30 | 0.8646 |
| 1. PBF | B8FY16 | Recombination protein RecR | 0.00e+00 | 2.14e-45 | 5.16e-40 | 0.9157 |
| 1. PBF | B2RKL4 | Recombination protein RecR | 0.00e+00 | 1.11e-45 | 6.46e-32 | 0.8787 |
| 1. PBF | Q0HU94 | Recombination protein RecR | 0.00e+00 | 5.12e-46 | 1.24e-27 | 0.8819 |
| 1. PBF | A9W381 | Recombination protein RecR | 0.00e+00 | 1.19e-46 | 4.96e-32 | 0.8798 |
| 1. PBF | Q3MAW5 | Recombination protein RecR | 0.00e+00 | 2.73e-33 | 8.09e-34 | 0.9044 |
| 1. PBF | A7MJW5 | Recombination protein RecR | 0.00e+00 | 5.96e-47 | 3.75e-29 | 0.8824 |
| 1. PBF | Q71W69 | Recombination protein RecR | 0.00e+00 | 1.16e-44 | 8.82e-41 | 0.8925 |
| 1. PBF | A5W0U7 | Recombination protein RecR | 0.00e+00 | 1.28e-50 | 3.27e-33 | 0.8755 |
| 1. PBF | Q2RZH8 | Recombination protein RecR | 0.00e+00 | 2.36e-27 | 5.95e-30 | 0.8899 |
| 1. PBF | B8HXF0 | Recombination protein RecR | 0.00e+00 | 2.02e-43 | 3.87e-38 | 0.8767 |
| 1. PBF | Q7NXL4 | Recombination protein RecR | 0.00e+00 | 6.39e-47 | 1.40e-30 | 0.8944 |
| 1. PBF | Q0BVJ5 | Recombination protein RecR | 0.00e+00 | 2.72e-42 | 7.98e-34 | 0.9015 |
| 1. PBF | C4K0J3 | Recombination protein RecR | 0.00e+00 | 1.74e-49 | 3.72e-28 | 0.8699 |
| 1. PBF | B7UVI8 | Recombination protein RecR | 0.00e+00 | 4.29e-51 | 3.12e-34 | 0.8917 |
| 1. PBF | Q830L4 | Recombination protein RecR | 0.00e+00 | 3.99e-48 | 6.42e-36 | 0.8919 |
| 1. PBF | Q8DGV8 | Recombination protein RecR | 0.00e+00 | 6.10e-47 | 2.36e-37 | 0.8876 |
| 1. PBF | A4IX62 | Recombination protein RecR | 0.00e+00 | 9.25e-46 | 2.46e-29 | 0.898 |
| 1. PBF | B5E722 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8771 |
| 1. PBF | Q9ZDA4 | Recombination protein RecR | 0.00e+00 | 3.09e-50 | 2.33e-30 | 0.9063 |
| 1. PBF | Q8E0G7 | Recombination protein RecR | 0.00e+00 | 2.30e-49 | 5.96e-38 | 0.877 |
| 1. PBF | A7NFA0 | Recombination protein RecR | 0.00e+00 | 4.97e-39 | 1.95e-36 | 0.9067 |
| 1. PBF | Q21L30 | Recombination protein RecR | 0.00e+00 | 6.92e-45 | 8.98e-31 | 0.8989 |
| 1. PBF | A4XVN4 | Recombination protein RecR | 0.00e+00 | 5.21e-50 | 1.46e-34 | 0.8665 |
| 1. PBF | B1ZGA0 | Recombination protein RecR | 0.00e+00 | 9.92e-44 | 2.83e-31 | 0.8887 |
| 1. PBF | B2V0W0 | Recombination protein RecR | 0.00e+00 | 2.65e-49 | 6.15e-39 | 0.902 |
| 1. PBF | Q0SWS6 | Recombination protein RecR | 0.00e+00 | 9.70e-52 | 1.45e-40 | 0.9002 |
| 1. PBF | B0S0K8 | Recombination protein RecR | 0.00e+00 | 1.31e-52 | 1.72e-32 | 0.8976 |
| 1. PBF | B5ZW36 | Recombination protein RecR | 0.00e+00 | 3.13e-47 | 1.01e-34 | 0.9025 |
| 1. PBF | Q4URN7 | Recombination protein RecR | 0.00e+00 | 6.95e-57 | 2.01e-31 | 0.891 |
| 1. PBF | Q6LTE6 | Recombination protein RecR | 0.00e+00 | 8.01e-48 | 2.53e-31 | 0.8789 |
| 1. PBF | Q823D7 | Recombination protein RecR | 0.00e+00 | 2.53e-49 | 2.13e-24 | 0.8407 |
| 1. PBF | Q8NTQ8 | Recombination protein RecR | 0.00e+00 | 5.11e-37 | 4.54e-32 | 0.8589 |
| 1. PBF | A4QAN3 | Recombination protein RecR | 0.00e+00 | 6.55e-37 | 9.94e-32 | 0.835 |
| 1. PBF | B9LZ13 | Recombination protein RecR | 0.00e+00 | 2.21e-41 | 5.35e-35 | 0.9071 |
| 1. PBF | B3R068 | Recombination protein RecR | 0.00e+00 | 3.51e-43 | 7.69e-35 | 0.9044 |
| 1. PBF | B8CZX0 | Recombination protein RecR | 0.00e+00 | 9.27e-45 | 8.59e-36 | 0.8837 |
| 1. PBF | Q47XW2 | Recombination protein RecR | 0.00e+00 | 9.20e-48 | 3.49e-28 | 0.9024 |
| 1. PBF | B2A302 | Recombination protein RecR | 0.00e+00 | 5.13e-42 | 3.19e-42 | 0.9011 |
| 1. PBF | C0QZV8 | Recombination protein RecR | 0.00e+00 | 2.31e-43 | 1.58e-30 | 0.8822 |
| 1. PBF | A4IJA1 | Recombination protein RecR | 0.00e+00 | 3.08e-43 | 2.68e-41 | 0.8842 |
| 1. PBF | A9L594 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 2.28e-27 | 0.886 |
| 1. PBF | Q4KFF7 | Recombination protein RecR | 0.00e+00 | 3.81e-51 | 4.66e-34 | 0.8765 |
| 1. PBF | Q744M5 | Recombination protein RecR | 0.00e+00 | 1.21e-42 | 6.42e-39 | 0.878 |
| 1. PBF | C1F111 | Recombination protein RecR | 0.00e+00 | 1.22e-48 | 1.04e-33 | 0.8845 |
| 1. PBF | A4TPA7 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8904 |
| 1. PBF | Q6G4V2 | Recombination protein RecR | 0.00e+00 | 1.85e-48 | 5.38e-34 | 0.8819 |
| 1. PBF | Q325C4 | Recombination protein RecR | 0.00e+00 | 6.60e-50 | 2.60e-29 | 0.8823 |
| 1. PBF | B7GFF3 | Recombination protein RecR | 0.00e+00 | 1.33e-43 | 6.49e-39 | 0.8824 |
| 1. PBF | Q2GJA0 | Recombination protein RecR | 0.00e+00 | 4.48e-48 | 8.57e-31 | 0.9149 |
| 1. PBF | A6VN19 | Recombination protein RecR | 0.00e+00 | 1.27e-48 | 3.36e-29 | 0.8809 |
| 1. PBF | Q1IY76 | Recombination protein RecR | 0.00e+00 | 7.15e-25 | 8.74e-40 | 0.9199 |
| 1. PBF | Q9CIL6 | Recombination protein RecR | 0.00e+00 | 2.05e-49 | 4.70e-38 | 0.8977 |
| 1. PBF | Q03LJ7 | Recombination protein RecR | 0.00e+00 | 4.78e-46 | 8.88e-36 | 0.8816 |
| 1. PBF | Q8YMF7 | Recombination protein RecR | 0.00e+00 | 2.41e-43 | 4.13e-35 | 0.8946 |
| 1. PBF | B9DXI6 | Recombination protein RecR | 0.00e+00 | 8.97e-49 | 6.10e-41 | 0.907 |
| 1. PBF | A7H2B7 | Recombination protein RecR | 0.00e+00 | 1.98e-41 | 7.80e-21 | 0.8007 |
| 1. PBF | Q3YSL1 | Recombination protein RecR | 0.00e+00 | 6.54e-47 | 3.32e-29 | 0.9132 |
| 1. PBF | Q9PR56 | Recombination protein RecR | 0.00e+00 | 8.16e-54 | 4.55e-33 | 0.8951 |
| 1. PBF | Q056Q1 | Recombination protein RecR | 0.00e+00 | 5.32e-51 | 3.22e-33 | 0.868 |
| 1. PBF | Q022F6 | Recombination protein RecR | 0.00e+00 | 1.69e-48 | 5.77e-32 | 0.8836 |
| 1. PBF | A9AUX0 | Recombination protein RecR | 0.00e+00 | 1.79e-40 | 3.38e-32 | 0.9056 |
| 1. PBF | Q2JGD6 | Recombination protein RecR | 0.00e+00 | 3.10e-46 | 3.57e-38 | 0.9086 |
| 1. PBF | B3EQT3 | Recombination protein RecR | 0.00e+00 | 3.48e-44 | 2.12e-34 | 0.8827 |
| 1. PBF | A6L4J6 | Recombination protein RecR | 0.00e+00 | 1.08e-49 | 1.47e-32 | 0.8923 |
| 1. PBF | Q73FI4 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.892 |
| 1. PBF | A1A8D8 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8839 |
| 1. PBF | A7HPP8 | Recombination protein RecR | 0.00e+00 | 2.36e-51 | 1.78e-35 | 0.8894 |
| 1. PBF | C3MC58 | Recombination protein RecR | 0.00e+00 | 1.03e-48 | 1.12e-33 | 0.9026 |
| 1. PBF | Q0RT19 | Recombination protein RecR | 0.00e+00 | 1.01e-44 | 5.50e-38 | 0.9106 |
| 1. PBF | A5UGV3 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 4.56e-30 | 0.8752 |
| 1. PBF | A1VMV7 | Recombination protein RecR | 0.00e+00 | 1.29e-36 | 1.27e-30 | 0.898 |
| 1. PBF | Q5Z354 | Recombination protein RecR | 0.00e+00 | 6.32e-45 | 1.27e-37 | 0.8548 |
| 1. PBF | A0PVF2 | Recombination protein RecR | 0.00e+00 | 1.45e-44 | 4.95e-38 | 0.8563 |
| 1. PBF | C6DB85 | Recombination protein RecR | 0.00e+00 | 1.36e-46 | 5.70e-31 | 0.8924 |
| 1. PBF | Q3ZWX3 | Recombination protein RecR | 0.00e+00 | 2.41e-43 | 3.07e-35 | 0.9078 |
| 1. PBF | C0MCW0 | Recombination protein RecR | 0.00e+00 | 6.59e-51 | 7.13e-35 | 0.8739 |
| 1. PBF | Q899U3 | Recombination protein RecR | 0.00e+00 | 1.22e-48 | 4.20e-40 | 0.9081 |
| 1. PBF | Q9PN35 | Recombination protein RecR | 0.00e+00 | 1.34e-41 | 7.97e-21 | 0.7995 |
| 1. PBF | Q4ULQ0 | Recombination protein RecR | 0.00e+00 | 9.85e-49 | 3.75e-31 | 0.897 |
| 1. PBF | Q28KG7 | Recombination protein RecR | 0.00e+00 | 2.16e-47 | 1.42e-29 | 0.895 |
| 1. PBF | B4SGN7 | Recombination protein RecR | 0.00e+00 | 6.36e-44 | 6.03e-34 | 0.8851 |
| 1. PBF | Q04NX9 | Recombination protein RecR | 0.00e+00 | 5.32e-51 | 3.22e-33 | 0.8652 |
| 1. PBF | C1ES27 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8915 |
| 1. PBF | A4VKJ5 | Recombination protein RecR | 0.00e+00 | 1.13e-52 | 3.42e-34 | 0.8786 |
| 1. PBF | A8H2R3 | Recombination protein RecR | 0.00e+00 | 2.79e-47 | 1.93e-29 | 0.8846 |
| 1. PBF | B2TR53 | Recombination protein RecR | 0.00e+00 | 3.47e-48 | 1.24e-38 | 0.91 |
| 1. PBF | A3NVY5 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 2.17e-33 | 0.8948 |
| 1. PBF | Q9I3H9 | Recombination protein RecR | 0.00e+00 | 4.29e-51 | 3.12e-34 | 0.8928 |
| 1. PBF | B5FFM4 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 2.78e-30 | 0.8777 |
| 1. PBF | Q6MAF1 | Recombination protein RecR | 0.00e+00 | 8.55e-50 | 5.10e-35 | 0.8694 |
| 1. PBF | B1M6N6 | Recombination protein RecR | 0.00e+00 | 2.49e-47 | 3.94e-34 | 0.8851 |
| 1. PBF | A1WF86 | Recombination protein RecR | 0.00e+00 | 5.59e-43 | 3.92e-29 | 0.8955 |
| 1. PBF | B8ZM67 | Recombination protein RecR | 0.00e+00 | 3.95e-49 | 1.45e-38 | 0.8854 |
| 1. PBF | A9WEA8 | Recombination protein RecR | 0.00e+00 | 3.38e-36 | 3.23e-31 | 0.8978 |
| 1. PBF | Q5NGM6 | Recombination protein RecR | 0.00e+00 | 5.61e-46 | 3.58e-29 | 0.8966 |
| 1. PBF | A6GZ60 | Recombination protein RecR | 0.00e+00 | 1.85e-48 | 2.21e-34 | 0.8852 |
| 1. PBF | Q1MN32 | Recombination protein RecR | 0.00e+00 | 1.16e-45 | 6.97e-34 | 0.8918 |
| 1. PBF | C1FPJ6 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.893 |
| 1. PBF | A6TYV4 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 3.83e-41 | 0.9036 |
| 1. PBF | Q74KZ9 | Recombination protein RecR | 0.00e+00 | 8.56e-49 | 7.00e-33 | 0.8928 |
| 1. PBF | Q1JG49 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8811 |
| 1. PBF | B7VL98 | Recombination protein RecR | 0.00e+00 | 7.47e-48 | 4.37e-29 | 0.8832 |
| 1. PBF | Q8G3B7 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.04e-31 | 0.8952 |
| 1. PBF | B3CV64 | Recombination protein RecR | 0.00e+00 | 1.33e-47 | 1.52e-28 | 0.8615 |
| 1. PBF | A6WPK9 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 2.28e-27 | 0.8871 |
| 1. PBF | Q2KVU4 | Recombination protein RecR | 0.00e+00 | 4.40e-40 | 5.56e-35 | 0.894 |
| 1. PBF | Q0BL35 | Recombination protein RecR | 0.00e+00 | 3.17e-46 | 1.78e-29 | 0.8957 |
| 1. PBF | Q3Z4S7 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8846 |
| 1. PBF | A7Z0E4 | Recombination protein RecR | 0.00e+00 | 1.86e-44 | 7.55e-39 | 0.8925 |
| 1. PBF | A9MW89 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8688 |
| 1. PBF | C3JXP7 | Recombination protein RecR | 0.00e+00 | 3.53e-53 | 6.10e-34 | 0.8772 |
| 1. PBF | P56214 | Recombination protein RecR | 0.00e+00 | 2.27e-40 | 5.40e-12 | 0.8123 |
| 1. PBF | A5N3V7 | Recombination protein RecR | 0.00e+00 | 8.97e-49 | 6.10e-41 | 0.9055 |
| 1. PBF | A4F6D1 | Recombination protein RecR | 0.00e+00 | 2.05e-45 | 1.07e-35 | 0.9028 |
| 1. PBF | O67455 | Recombination protein RecR | 0.00e+00 | 2.69e-26 | 1.02e-34 | 0.919 |
| 1. PBF | Q251Z0 | Recombination protein RecR | 0.00e+00 | 1.06e-44 | 6.26e-40 | 0.9156 |
| 1. PBF | A2BRS6 | Recombination protein RecR | 0.00e+00 | 5.15e-48 | 1.97e-32 | 0.8786 |
| 1. PBF | Q7N0P2 | Recombination protein RecR | 0.00e+00 | 1.13e-47 | 7.94e-29 | 0.8884 |
| 1. PBF | Q04E51 | Recombination protein RecR | 0.00e+00 | 3.58e-55 | 1.51e-37 | 0.8854 |
| 1. PBF | Q8Y050 | Recombination protein RecR | 0.00e+00 | 9.44e-32 | 7.20e-33 | 0.8984 |
| 1. PBF | B5R610 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8831 |
| 1. PBF | B8E703 | Recombination protein RecR | 0.00e+00 | 4.69e-48 | 2.28e-27 | 0.8869 |
| 1. PBF | P74533 | Recombination protein RecR | 0.00e+00 | 7.17e-17 | 3.95e-35 | 0.8845 |
| 1. PBF | Q4JSL5 | Recombination protein RecR | 0.00e+00 | 1.21e-18 | 2.91e-24 | 0.8995 |
| 1. PBF | Q48SP7 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8762 |
| 1. PBF | O69520 | Recombination protein RecR | 0.00e+00 | 4.81e-42 | 1.10e-36 | 0.8961 |
| 1. PBF | B5E9A4 | Recombination protein RecR | 0.00e+00 | 8.45e-46 | 4.53e-34 | 0.9061 |
| 1. PBF | Q1B277 | Recombination protein RecR | 0.00e+00 | 4.51e-45 | 5.76e-39 | 0.8543 |
| 1. PBF | A4SLX9 | Recombination protein RecR | 0.00e+00 | 1.11e-44 | 1.10e-27 | 0.8768 |
| 1. PBF | Q87CK8 | Recombination protein RecR | 0.00e+00 | 1.07e-53 | 8.52e-34 | 0.8931 |
| 1. PBF | Q1IQ76 | Recombination protein RecR | 0.00e+00 | 2.17e-50 | 2.88e-38 | 0.8863 |
| 1. PBF | A3PDK2 | Recombination protein RecR | 0.00e+00 | 2.79e-47 | 1.81e-32 | 0.8916 |
| 1. PBF | Q5FTB6 | Recombination protein RecR | 0.00e+00 | 2.54e-44 | 1.35e-35 | 0.903 |
| 1. PBF | B7HIJ3 | Recombination protein RecR | 0.00e+00 | 9.92e-45 | 6.87e-43 | 0.8847 |
| 1. PBF | Q9ZNA2 | Recombination protein RecR | 0.00e+00 | 1.17e-25 | 1.98e-38 | 0.9241 |
| 1. PBF | A2SIU8 | Recombination protein RecR | 0.00e+00 | 2.27e-50 | 6.80e-28 | 0.9114 |
| 1. PBF | B1I734 | Recombination protein RecR | 0.00e+00 | 5.72e-50 | 1.68e-38 | 0.8661 |
| 1. PBF | Q2IFP4 | Recombination protein RecR | 0.00e+00 | 7.20e-46 | 1.82e-32 | 0.8843 |
| 1. PBF | B4RLV1 | Recombination protein RecR | 0.00e+00 | 1.45e-44 | 4.85e-25 | 0.8948 |
| 1. PBF | Q5L609 | Recombination protein RecR | 0.00e+00 | 4.28e-48 | 9.44e-26 | 0.8332 |
| 1. PBF | A4VW30 | Recombination protein RecR | 0.00e+00 | 8.61e-52 | 6.71e-37 | 0.8823 |
| 1. PBF | Q49UY9 | Recombination protein RecR | 0.00e+00 | 3.43e-47 | 1.91e-39 | 0.9031 |
| 1. PBF | Q0ASK7 | Recombination protein RecR | 0.00e+00 | 6.97e-48 | 1.55e-35 | 0.8915 |
| 1. PBF | A6QED4 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.8938 |
| 1. PBF | B5EXM8 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8821 |
| 1. PBF | A5WG77 | Recombination protein RecR | 0.00e+00 | 1.73e-48 | 2.24e-36 | 0.8679 |
| 1. PBF | B0UP43 | Recombination protein RecR | 0.00e+00 | 2.01e-46 | 1.11e-32 | 0.875 |
| 1. PBF | A5G016 | Recombination protein RecR | 0.00e+00 | 3.76e-47 | 4.15e-35 | 0.886 |
| 1. PBF | B1XU64 | Recombination protein RecR | 0.00e+00 | 1.06e-35 | 3.64e-33 | 0.886 |
| 1. PBF | B2VCL6 | Recombination protein RecR | 0.00e+00 | 8.97e-50 | 7.29e-29 | 0.8874 |
| 1. PBF | B6I0C4 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8835 |
| 1. PBF | A8F1L4 | Recombination protein RecR | 0.00e+00 | 2.65e-49 | 5.57e-31 | 0.8843 |
| 1. PBF | Q8G6Y1 | Recombination protein RecR | 0.00e+00 | 5.84e-41 | 9.90e-40 | 0.9117 |
| 1. PBF | Q13Z78 | Recombination protein RecR | 0.00e+00 | 3.68e-47 | 3.65e-33 | 0.8942 |
| 1. PBF | Q7WAY7 | Recombination protein RecR | 0.00e+00 | 9.62e-49 | 1.02e-34 | 0.8949 |
| 1. PBF | Q4FNA8 | Recombination protein RecR | 0.00e+00 | 4.63e-50 | 2.12e-28 | 0.856 |
| 1. PBF | P24277 | Recombination protein RecR | 0.00e+00 | 1.39e-44 | 1.59e-38 | 0.8937 |
| 1. PBF | Q5WLZ3 | Recombination protein RecR | 0.00e+00 | 3.72e-48 | 2.64e-37 | 0.8906 |
| 1. PBF | A9MLY7 | Recombination protein RecR | 0.00e+00 | 1.16e-49 | 1.61e-27 | 0.8867 |
| 1. PBF | C4ZUS6 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8808 |
| 1. PBF | Q39Q42 | Recombination protein RecR | 0.00e+00 | 2.54e-44 | 8.42e-35 | 0.9019 |
| 1. PBF | A6WUV0 | Recombination protein RecR | 0.00e+00 | 1.85e-48 | 3.48e-32 | 0.9044 |
| 1. PBF | Q72LS5 | Recombination protein RecR | 0.00e+00 | 7.44e-49 | 1.06e-34 | 0.8724 |
| 1. PBF | Q6D7Z7 | Recombination protein RecR | 0.00e+00 | 1.88e-47 | 6.62e-31 | 0.8905 |
| 1. PBF | Q57FY2 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.04e-31 | 0.8905 |
| 1. PBF | Q1GWJ9 | Recombination protein RecR | 0.00e+00 | 2.25e-51 | 1.01e-34 | 0.8812 |
| 1. PBF | Q031X9 | Recombination protein RecR | 0.00e+00 | 2.09e-51 | 3.25e-37 | 0.8977 |
| 1. PBF | Q3AX77 | Recombination protein RecR | 0.00e+00 | 2.45e-45 | 4.94e-36 | 0.8842 |
| 1. PBF | Q11AW7 | Recombination protein RecR | 0.00e+00 | 3.16e-48 | 3.33e-31 | 0.9024 |
| 1. PBF | Q5M580 | Recombination protein RecR | 0.00e+00 | 8.07e-46 | 1.18e-35 | 0.8808 |
| 1. PBF | B4TMG4 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8836 |
| 1. PBF | Q5M0P4 | Recombination protein RecR | 0.00e+00 | 8.07e-46 | 1.18e-35 | 0.881 |
| 1. PBF | C5D347 | Recombination protein RecR | 0.00e+00 | 6.65e-44 | 4.35e-39 | 0.8872 |
| 1. PBF | B3R1M6 | Recombination protein RecR | 0.00e+00 | 4.25e-37 | 1.16e-32 | 0.8972 |
| 1. PBF | P0A7H9 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8832 |
| 1. PBF | Q9KT49 | Recombination protein RecR | 0.00e+00 | 6.32e-49 | 7.66e-29 | 0.8789 |
| 1. PBF | Q254J2 | Recombination protein RecR | 0.00e+00 | 3.68e-45 | 1.40e-21 | 0.8538 |
| 1. PBF | B1IZC2 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8804 |
| 1. PBF | Q0I4S5 | Recombination protein RecR | 0.00e+00 | 4.61e-45 | 1.54e-28 | 0.8872 |
| 1. PBF | A9M6N7 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.04e-31 | 0.8983 |
| 1. PBF | B8I551 | Recombination protein RecR | 0.00e+00 | 1.06e-44 | 2.27e-37 | 0.8996 |
| 1. PBF | A8AY67 | Recombination protein RecR | 0.00e+00 | 1.07e-51 | 2.68e-38 | 0.8768 |
| 1. PBF | A5ESR4 | Recombination protein RecR | 0.00e+00 | 1.27e-47 | 1.29e-33 | 0.8803 |
| 1. PBF | A1UMX3 | Recombination protein RecR | 0.00e+00 | 4.51e-45 | 5.76e-39 | 0.864 |
| 1. PBF | Q5PFK6 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8838 |
| 1. PBF | Q6GJJ3 | Recombination protein RecR | 0.00e+00 | 7.47e-48 | 1.44e-40 | 0.896 |
| 1. PBF | A1U126 | Recombination protein RecR | 0.00e+00 | 4.08e-52 | 6.72e-37 | 0.8964 |
| 1. PBF | B0C882 | Recombination protein RecR | 0.00e+00 | 2.62e-48 | 8.43e-37 | 0.8812 |
| 1. PBF | Q3SVQ7 | Recombination protein RecR | 0.00e+00 | 6.44e-50 | 1.60e-33 | 0.8699 |
| 1. PBF | A2RI71 | Recombination protein RecR | 0.00e+00 | 8.20e-52 | 1.30e-37 | 0.8914 |
| 1. PBF | B4U1Z1 | Recombination protein RecR | 0.00e+00 | 6.59e-51 | 7.13e-35 | 0.8791 |
| 1. PBF | B7M3W4 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8829 |
| 1. PBF | Q98BM4 | Recombination protein RecR | 0.00e+00 | 1.25e-50 | 1.38e-34 | 0.9031 |
| 1. PBF | A7NDC2 | Recombination protein RecR | 0.00e+00 | 3.17e-46 | 1.78e-29 | 0.8981 |
| 1. PBF | Q74GZ7 | Recombination protein RecR | 0.00e+00 | 2.90e-46 | 1.23e-35 | 0.9011 |
| 1. PBF | Q2YVW5 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.8967 |
| 1. PBF | Q47TY2 | Recombination protein RecR | 0.00e+00 | 1.13e-43 | 5.42e-40 | 0.9003 |
| 1. PBF | B4EAY2 | Recombination protein RecR | 0.00e+00 | 9.66e-47 | 1.41e-34 | 0.9025 |
| 1. PBF | A1S563 | Recombination protein RecR | 0.00e+00 | 1.60e-46 | 7.28e-30 | 0.8792 |
| 1. PBF | B1KRT7 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8931 |
| 1. PBF | B3PXF0 | Recombination protein RecR | 0.00e+00 | 2.90e-46 | 3.65e-34 | 0.8988 |
| 1. PBF | A1W0P8 | Recombination protein RecR | 0.00e+00 | 4.23e-41 | 1.44e-21 | 0.7986 |
| 1. PBF | A8Z0X4 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.898 |
| 1. PBF | Q4ZQZ4 | Recombination protein RecR | 0.00e+00 | 3.72e-51 | 1.59e-33 | 0.8761 |
| 1. PBF | Q5HTK0 | Recombination protein RecR | 0.00e+00 | 5.13e-41 | 3.17e-21 | 0.7963 |
| 1. PBF | Q8RG96 | Recombination protein RecR | 0.00e+00 | 2.02e-52 | 9.53e-37 | 0.9042 |
| 1. PBF | B1IDW8 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8943 |
| 1. PBF | Q0B0W3 | Recombination protein RecR | 0.00e+00 | 7.82e-52 | 1.91e-32 | 0.8727 |
| 1. PBF | A7G9D5 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8896 |
| 1. PBF | Q65PJ9 | Recombination protein RecR | 0.00e+00 | 3.08e-43 | 5.40e-39 | 0.8913 |
| 1. PBF | Q048W6 | Recombination protein RecR | 0.00e+00 | 1.30e-47 | 2.52e-35 | 0.8824 |
| 1. PBF | A0LWH7 | Recombination protein RecR | 0.00e+00 | 1.85e-48 | 2.36e-39 | 0.9054 |
| 1. PBF | P65992 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.8839 |
| 1. PBF | Q3IKN2 | Recombination protein RecR | 0.00e+00 | 1.92e-46 | 4.45e-30 | 0.8948 |
| 1. PBF | B9DUS1 | Recombination protein RecR | 0.00e+00 | 3.38e-51 | 1.32e-33 | 0.8778 |
| 1. PBF | Q2LYF5 | Recombination protein RecR | 0.00e+00 | 2.27e-50 | 5.70e-26 | 0.9079 |
| 1. PBF | Q1G921 | Recombination protein RecR | 0.00e+00 | 1.30e-47 | 2.52e-35 | 0.8859 |
| 1. PBF | A0M3M1 | Recombination protein RecR | 0.00e+00 | 5.92e-48 | 2.08e-30 | 0.8795 |
| 1. PBF | Q1RH45 | Recombination protein RecR | 0.00e+00 | 6.00e-50 | 9.87e-30 | 0.8834 |
| 1. PBF | Q5E466 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 2.78e-30 | 0.874 |
| 1. PBF | B6JJQ1 | Recombination protein RecR | 0.00e+00 | 4.85e-47 | 6.68e-34 | 0.8832 |
| 1. PBF | A1SDH8 | Recombination protein RecR | 0.00e+00 | 2.68e-45 | 2.84e-38 | 0.8822 |
| 1. PBF | Q8CMS3 | Recombination protein RecR | 0.00e+00 | 3.72e-48 | 1.01e-39 | 0.8954 |
| 1. PBF | Q1QXJ5 | Recombination protein RecR | 0.00e+00 | 2.10e-49 | 5.62e-36 | 0.9032 |
| 1. PBF | Q3JRN7 | Recombination protein RecR | 0.00e+00 | 2.69e-48 | 2.91e-33 | 0.8913 |
| 1. PBF | A7HGU3 | Recombination protein RecR | 0.00e+00 | 2.85e-47 | 2.18e-32 | 0.8848 |
| 1. PBF | B9LJ32 | Recombination protein RecR | 0.00e+00 | 3.38e-36 | 3.23e-31 | 0.8804 |
| 1. PBF | Q5NPC4 | Recombination protein RecR | 0.00e+00 | 3.40e-50 | 2.33e-32 | 0.9108 |
| 1. PBF | A1K421 | Recombination protein RecR | 0.00e+00 | 5.47e-43 | 3.79e-31 | 0.9079 |
| 1. PBF | C0M8S3 | Recombination protein RecR | 0.00e+00 | 8.40e-52 | 1.09e-35 | 0.8788 |
| 1. PBF | Q7VY12 | Recombination protein RecR | 0.00e+00 | 4.03e-47 | 1.64e-34 | 0.8976 |
| 1. PBF | Q8ZC97 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8846 |
| 1. PBF | Q4FTL1 | Recombination protein RecR | 0.00e+00 | 7.37e-46 | 8.93e-38 | 0.8862 |
| 1. PBF | Q66DP9 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8868 |
| 1. PBF | A0L8F5 | Recombination protein RecR | 0.00e+00 | 3.54e-51 | 4.66e-34 | 0.9006 |
| 1. PBF | Q63UU6 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 2.17e-33 | 0.8948 |
| 1. PBF | Q83DP0 | Recombination protein RecR | 0.00e+00 | 3.22e-51 | 8.48e-31 | 0.9032 |
| 1. PBF | Q0TKG9 | Recombination protein RecR | 0.00e+00 | 8.97e-50 | 3.79e-29 | 0.8786 |
| 1. PBF | Q1CSU9 | Recombination protein RecR | 0.00e+00 | 9.70e-40 | 6.37e-12 | 0.8192 |
| 1. PBF | A7FQ67 | Recombination protein RecR | 0.00e+00 | 4.38e-48 | 5.44e-40 | 0.8925 |
| 1. PBF | Q5HRS7 | Recombination protein RecR | 0.00e+00 | 3.72e-48 | 1.01e-39 | 0.8931 |
| 1. PBF | A5VDM1 | Recombination protein RecR | 0.00e+00 | 3.07e-51 | 2.13e-32 | 0.8933 |
| 1. PBF | Q7V0Z7 | Recombination protein RecR | 0.00e+00 | 2.49e-47 | 6.57e-32 | 0.8814 |
| 1. PBF | B9DLF7 | Recombination protein RecR | 0.00e+00 | 1.65e-48 | 8.18e-41 | 0.9018 |
| 1. PBF | B0K800 | Recombination protein RecR | 0.00e+00 | 1.33e-46 | 1.88e-35 | 0.8934 |
| 1. PBF | B0BBM1 | Recombination protein RecR | 0.00e+00 | 2.23e-48 | 2.05e-21 | 0.8427 |
| 1. PBF | Q3IZZ6 | Recombination protein RecR | 0.00e+00 | 3.10e-46 | 5.41e-32 | 0.8879 |
| 1. PBF | P65994 | Recombination protein RecR | 0.00e+00 | 6.00e-52 | 1.58e-34 | 0.8819 |
| 1. PBF | Q1ICI0 | Recombination protein RecR | 0.00e+00 | 4.72e-51 | 8.79e-34 | 0.8784 |
| 1. PBF | A8FAE6 | Recombination protein RecR | 0.00e+00 | 4.22e-45 | 7.13e-40 | 0.8903 |
| 1. PBF | B8FG16 | Recombination protein RecR | 0.00e+00 | 5.08e-47 | 4.86e-35 | 0.8888 |
| 1. PBF | A9R0Q4 | Recombination protein RecR | 0.00e+00 | 1.51e-49 | 1.00e-26 | 0.8881 |
| 1. PBF | Q8DB22 | Recombination protein RecR | 0.00e+00 | 9.62e-49 | 1.57e-28 | 0.8818 |
| 1. PBF | B2JG60 | Recombination protein RecR | 0.00e+00 | 1.71e-45 | 2.59e-32 | 0.8943 |
| 1. PBF | A3MYE6 | Recombination protein RecR | 0.00e+00 | 3.03e-46 | 1.75e-29 | 0.8878 |
| 1. PBF | Q6AB99 | Recombination protein RecR | 0.00e+00 | 1.50e-48 | 2.59e-37 | 0.9197 |
| 1. PBF | B8DAT9 | Recombination protein RecR | 0.00e+00 | 1.16e-44 | 8.82e-41 | 0.8939 |
| 1. PBF | Q7MV45 | Recombination protein RecR | 0.00e+00 | 7.74e-45 | 6.26e-33 | 0.8622 |
| 1. PBF | Q13F14 | Recombination protein RecR | 0.00e+00 | 1.79e-45 | 3.59e-35 | 0.8947 |
| 1. PBF | A4YLB4 | Recombination protein RecR | 0.00e+00 | 1.16e-47 | 2.05e-33 | 0.8748 |
| 1. PBF | Q3A8S2 | Recombination protein RecR | 0.00e+00 | 1.45e-44 | 2.26e-31 | 0.903 |
| 1. PBF | B3DUB4 | Recombination protein RecR | 0.00e+00 | 5.84e-41 | 9.90e-40 | 0.9097 |
| 1. PBF | Q20WW8 | Recombination protein RecR | 0.00e+00 | 9.68e-46 | 2.88e-36 | 0.8782 |
| 1. PBF | B5Z3Y2 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8852 |
| 1. PBF | P44712 | Recombination protein RecR | 0.00e+00 | 1.68e-47 | 4.56e-30 | 0.8814 |
| 1. PBF | B0TP04 | Recombination protein RecR | 0.00e+00 | 3.16e-48 | 3.84e-29 | 0.8856 |
| 1. PBF | Q5N5P2 | Recombination protein RecR | 0.00e+00 | 4.78e-46 | 2.58e-31 | 0.8803 |
| 1. PBF | Q3B3D7 | Recombination protein RecR | 0.00e+00 | 1.57e-47 | 1.45e-34 | 0.8709 |
| 1. PBF | B6EJ44 | Recombination protein RecR | 0.00e+00 | 1.72e-47 | 3.72e-30 | 0.8713 |
| 1. PBF | B4SWX9 | Recombination protein RecR | 0.00e+00 | 4.85e-50 | 2.93e-29 | 0.883 |
| 1. PBF | B0CI52 | Recombination protein RecR | 0.00e+00 | 6.92e-50 | 1.04e-31 | 0.8921 |
| 1. PBF | Q2RMH0 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 2.05e-39 | 0.8944 |
| 1. PBF | A9HZ10 | Recombination protein RecR | 0.00e+00 | 5.52e-48 | 1.87e-35 | 0.8944 |
| 1. PBF | A2C8B2 | Recombination protein RecR | 0.00e+00 | 2.40e-45 | 4.18e-33 | 0.8838 |
| 1. PBF | Q5HIJ7 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | 0.9004 |
| 1. PBF | Q2NV59 | Recombination protein RecR | 0.00e+00 | 3.77e-49 | 2.47e-28 | 0.8949 |
| 1. PBF | Q83MQ8 | Recombination protein RecR | 0.00e+00 | 2.36e-51 | 7.03e-41 | 0.9004 |
| 1. PBF | A1BFN2 | Recombination protein RecR | 0.00e+00 | 4.07e-44 | 1.26e-31 | 0.8741 |
| 1. PBF | B9E8X2 | Recombination protein RecR | 0.00e+00 | 4.67e-46 | 9.31e-41 | 0.8817 |
| 1. PBF | A0R5R0 | Recombination protein RecR | 0.00e+00 | 9.49e-44 | 2.35e-37 | 0.8448 |
| 1. PBF | A8MKQ1 | Recombination protein RecR | 0.00e+00 | 9.27e-45 | 1.59e-36 | 0.8758 |
| 1. PBF | Q15RT5 | Recombination protein RecR | 0.00e+00 | 6.29e-50 | 1.96e-32 | 0.8876 |
| 1. PBF | B5Y0N5 | Recombination protein RecR | 0.00e+00 | 1.11e-47 | 1.03e-29 | 0.887 |
| 1. PBF | B8DVK3 | Recombination protein RecR | 0.00e+00 | 4.92e-41 | 9.89e-44 | 0.9136 |
| 1. PBF | B7N925 | Recombination protein RecR | 0.00e+00 | 4.14e-49 | 2.47e-29 | 0.8833 |
| 1. PBF | Q92I11 | Recombination protein RecR | 0.00e+00 | 3.74e-50 | 1.23e-29 | 0.8852 |
| 1. PBF | A1AKR3 | Recombination protein RecR | 0.00e+00 | 3.39e-42 | 1.60e-35 | 0.9014 |
| 1. PBF | B9KLQ5 | Recombination protein RecR | 0.00e+00 | 3.10e-46 | 5.41e-32 | 0.8857 |
| 1. PBF | P0A7H8 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | 0.8824 |
| 1. PBF | C1CST7 | Recombination protein RecR | 0.00e+00 | 3.20e-49 | 1.08e-38 | 0.8795 |
| 1. PBF | P57826 | Recombination protein RecR | 0.00e+00 | 1.64e-47 | 3.81e-33 | 0.882 |
| 1. PBF | A4Y7T8 | Recombination protein RecR | 0.00e+00 | 8.78e-48 | 1.67e-27 | 0.8783 |
| 1. PBF | Q3AJ44 | Recombination protein RecR | 0.00e+00 | 5.08e-47 | 1.32e-33 | 0.892 |
| 1. PBF | Q12PB3 | Recombination protein RecR | 0.00e+00 | 1.52e-45 | 4.57e-27 | 0.8764 |
| 1. PBF | Q2JUS3 | Recombination protein RecR | 0.00e+00 | 3.04e-42 | 2.80e-33 | 0.8906 |
| 4. PB | Q2G0T3 | Recombination protein RecR | 0.00e+00 | 3.09e-48 | 3.71e-41 | NA |
| 4. PB | P9WHI3 | Recombination protein RecR | 0.00e+00 | 8.88e-44 | 5.00e-39 | NA |
| 4. PB | P0A7H6 | Recombination protein RecR | 0.00e+00 | 7.08e-50 | 2.34e-29 | NA |