Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54597.1
JCVISYN3A_0047

DNA polymerase III subunit gamma and tau.
M. mycoides homolog: Q6MUI3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 60
Unique PROST Go: 3
Unique BLAST Go: 23
Unique Foldseek Go: 12

Total Homologs: 224
Unique PROST Homologs: 7
Unique BLAST Homologs: 80
Unique Foldseek Homologs: 36

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: DNA polymerase III, gamma subunit
Zhang et al. [4]: GO:0003689|DNA clamp loader activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 3. BF was A4WLY0 (Replication factor C small subunit 2) with a FATCAT P-Value: 0 and RMSD of 2.21 angstrom. The sequence alignment identity is 15.3%.
Structural alignment shown in left. Query protein AVX54597.1 colored as red in alignment, homolog A4WLY0 colored as blue. Query protein AVX54597.1 is also shown in right top, homolog A4WLY0 showed in right bottom. They are colored based on secondary structures. 

  AVX54597.1 MNTNKQSL--YRTYRPKDFNSVAGHNNIKEILEKQIKDNRINHALLFSGQRGTGKTSVARIFAKTINCLNLTNSTACEQCNNCKLANQNQLIDIIEIDAA 98
      A4WLY0 MS----ELFWFEKYRPRSFDEVVDLEEVKARLREFVRGGNMPH-LLFYGPPGTGKTTMALVLAR-----ELYG----EYW------RENTL----ELNAS 76

  AVX54597.1 SNNGVDEIRE-IKNSVSTLPL-NSKYKVYIIDEVHMLTKQAFNALLKTLEEPPVYA---IFILATTEFNKIPQTILSRCQIFNFTKIDKNSLKNRLQYIA 193
      A4WLY0 DERGINVIRERVKEFARTAPVGKAPFKLVILDEADNMTSDAQQALRRIME---MYAQNTRFILLANYISGIIEPIQSRTVMIRFSPLPKEAVFARLRYIA 173

  AVX54597.1 NQENYQIEKEVLDEMFYLSEGSLRDAINILEQLMLATDDLITIKTL-KSIFLIATKQEQLQVVHQSLNNNTSFIISYFQKANDQ--GMNWDVFALGLIEI 290
      A4WLY0 DNEGVKISDDALEAIYEFTQGDMRRAINAL-QIAATTGKEITEETVAKALGMVSPR-----LLRETLND--AF-RGNFGKAATQIYGFVVDG-GIGELEI 263

  AVX54597.1 LKEII--EYKLTNNTEFLNILEKNEVEQFNSVNANNLFIL--ADNLAEAYFKTKAANISFNYLLLSLLK-T--INSNNNNLQTVSKTINTKQVEQNQEIL 383
      A4WLY0 VKQLHREALKL-DVPEYL----KPEIAYI--IAEAHYAILRGAHGLTQIY--GALAKIR------KLLKYTASI-------------------------- 322

  AVX54597.1 KPNDITPEILDEPIIDEPVIQQPIIDEPVLQQPVIDEPVIQQPVIDNLSLTKDLDDKTLIKNTIENDKPLDSTNLDDPINEFDFYNQKEQTIDEICKTLS 483
      A4WLY0 ---------------------------------------------------------------------------------------------------- 322

  AVX54597.1 ELKIKFNIHISQAINSKVKMLFNEDLISILIETKNYKNQIHNIEQLLEDLFLQDDNQLVNAQIASELFMLLDSKIISLTNDVIVLKTQTKAQANLINDSM 583
      A4WLY0 ---------------------------------------------------------------------------------------------------- 322

  AVX54597.1 LDNHVLQQIYNWFKKPYLIFAIDKMKWDEIKTIFIDLKNKNKLSEYSEINLKQLKEKYLTINDEIDQDLINKAKDLFNDDFMIGD 668
      A4WLY0 ------------------------------------------------------------------------------------- 322

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0003677 DNA binding
1. PBF GO:0006261 DNA-dependent DNA replication
1. PBF GO:0006260 DNA replication
1. PBF GO:0017116 single-stranded DNA helicase activity
1. PBF GO:0005524 ATP binding
1. PBF GO:0003887 DNA-directed DNA polymerase activity
1. PBF GO:0009360 DNA polymerase III complex
1. PBF GO:0003689 DNA clamp loader activity
1. PBF GO:0005663 DNA replication factor C complex
3. BF GO:0009378 four-way junction helicase activity
3. BF GO:1900264 positive regulation of DNA-directed DNA polymerase activity
3. BF GO:0031390 Ctf18 RFC-like complex
3. BF GO:0016539 intein-mediated protein splicing
3. BF GO:0006281 DNA repair
3. BF GO:0008408 3'-5' exonuclease activity
3. BF GO:0006310 DNA recombination
3. BF GO:0031391 Elg1 RFC-like complex
3. BF GO:0004519 endonuclease activity
3. BF GO:0031389 Rad17 RFC-like complex
4. PB GO:0008047 enzyme activator activity
4. PB GO:0043846 DNA polymerase III, clamp loader complex
4. PB GO:0006282 regulation of DNA repair
5. P GO:0030337 DNA polymerase processivity factor activity
5. P GO:0042626 ATPase-coupled transmembrane transporter activity
5. P GO:0009314 response to radiation
6. F GO:0009532 plastid stroma
6. F GO:0043197 dendritic spine
6. F GO:0005938 cell cortex
6. F GO:0009570 chloroplast stroma
6. F GO:0000724 double-strand break repair via homologous recombination
6. F GO:0007276 gamete generation
6. F GO:0042555 MCM complex
6. F GO:0097362 MCM8-MCM9 complex
6. F GO:0098871 postsynaptic actin cytoskeleton
6. F GO:0006974 cellular response to DNA damage stimulus
6. F GO:0007292 female gamete generation
6. F GO:0046683 response to organophosphorus
7. B GO:0030894 replisome
7. B GO:0019899 enzyme binding
7. B GO:0005886 plasma membrane
7. B GO:0031348 negative regulation of defense response
7. B GO:0000076 DNA replication checkpoint signaling
7. B GO:0070914 UV-damage excision repair
7. B GO:1903460 mitotic DNA replication leading strand elongation
7. B GO:0140603 obsolete ATP hydrolysis activity
7. B GO:0032508 DNA duplex unwinding
7. B GO:0005634 nucleus
7. B GO:0031935 obsolete regulation of chromatin silencing
7. B GO:0046872 metal ion binding
7. B GO:0043599 nuclear DNA replication factor C complex
7. B GO:0007062 sister chromatid cohesion
7. B GO:0010026 trichome differentiation
7. B GO:0051570 regulation of histone H3-K9 methylation
7. B GO:1903461 Okazaki fragment processing involved in mitotic DNA replication
7. B GO:0005737 cytoplasm
7. B GO:0006271 DNA strand elongation involved in DNA replication
7. B GO:0061860 DNA clamp unloader activity
7. B GO:0006272 leading strand elongation
7. B GO:0009432 SOS response
7. B GO:0010091 trichome branching

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0016779 nucleotidyltransferase activity
GO:0006260 DNA replication
GO:0005524 ATP binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0071897 DNA biosynthetic process
GO:0009360 DNA polymerase III complex
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF A2SQR6 Replication factor C large subunit 8.70e-05 2.89e-03 2.36e-04 0.4756
1. PBF P43746 DNA polymerase III subunit tau/gamma 1.08e-07 3.46e-34 4.00e-69 0.5245
1. PBF P74876 DNA polymerase III subunit tau 1.03e-07 2.90e-33 2.18e-67 0.5095
1. PBF Q9WYX8 Uncharacterized protein TM_0508 1.82e-06 1.46e-03 5.58e-08 0.5563
1. PBF P75177 DNA polymerase III subunit gamma/tau 4.21e-10 8.40e-63 1.68e-65 0.5053
1. PBF P47658 DNA polymerase III subunit gamma/tau 1.12e-12 1.77e-61 7.81e-63 0.5428
1. PBF Q9UWR2 Replication factor C large subunit 2.05e-05 3.83e-03 3.61e-06 0.3964
1. PBF P09122 DNA polymerase III subunit gamma/tau 1.76e-13 1.04e-36 1.56e-72 0.6139
1. PBF Q2FQR4 Replication factor C large subunit 1.24e-06 8.12e-04 0.005 0.3924
1. PBF A3CTR4 Replication factor C large subunit 9.65e-06 2.75e-03 2.32e-04 0.4315
1. PBF O29072 Replication factor C large subunit 1.69e-04 5.68e-04 6.38e-09 0.3951
1. PBF Q9V2G3 Replication factor C large subunit 1.85e-05 7.82e-03 2.04e-06 0.4797
1. PBF Q3ISA5 Replication factor C large subunit 2.97e-05 2.75e-03 6.81e-07 0.3889
1. PBF A7I781 Replication factor C large subunit 2.60e-06 2.00e-02 8.48e-06 0.4015
1. PBF P63976 DNA polymerase III subunit gamma/tau 2.07e-10 4.16e-26 1.69e-55 0.579
1. PBF Q12TX1 Replication factor C large subunit 2.45e-07 6.23e-04 0.001 0.5297
2. PF Q9HPI4 Replication factor C large subunit 1.34e-06 2.31e-04 NA 0.4036
2. PF Q0W3P4 Replication factor C large subunit 3.29e-05 5.92e-03 NA 0.3567
2. PF Q18GQ9 Replication factor C large subunit 2.52e-04 6.97e-04 NA 0.372
2. PF A0B6D7 Replication factor C large subunit 6.75e-05 1.16e-03 NA 0.4856
2. PF B0R601 Replication factor C large subunit 5.95e-06 2.31e-04 NA 0.4066
2. PF B9LPV1 Replication factor C large subunit 1.82e-05 2.14e-02 NA 0.3858
2. PF Q5V1F7 Replication factor C large subunit 2.35e-06 7.45e-03 NA 0.3799
2. PF Q8TZC5 Replication factor C large subunit 4.44e-05 8.58e-06 NA 0.4594
3. BF Q9HI47 Replication factor C small subunit 0.00e+00 NA 4.95e-19 0.8032
3. BF Q9HN27 Replication factor C small subunit 0.00e+00 NA 2.54e-23 0.7884
3. BF A2SQT3 Replication factor C small subunit 0.00e+00 NA 4.49e-20 0.8329
3. BF Q89A95 DNA polymerase III subunit gamma 0.00e+00 NA 1.53e-56 0.8894
3. BF O26343 Replication factor C small subunit 1.11e-16 NA 1.43e-23 0.7876
3. BF A5UMF3 Replication factor C small subunit 0.00e+00 NA 1.89e-22 0.8104
3. BF Q975D3 Replication factor C small subunit 0.00e+00 NA 2.84e-21 0.7923
3. BF P37540 DNA polymerase III subunit delta' 5.53e-12 NA 2.19e-21 0.7126
3. BF A3MS28 Replication factor C small subunit 0.00e+00 NA 4.22e-22 0.7758
3. BF Q977Z9 Replication factor C small subunit 0.00e+00 NA 8.35e-19 0.8255
3. BF Q89AG8 DNA polymerase III subunit delta' 2.02e-11 NA 5.45e-10 0.6365
3. BF Q8TSX5 Replication factor C small subunit 0.00e+00 NA 3.82e-24 0.8283
3. BF A4FZ74 Replication factor C small subunit 0.00e+00 NA 2.68e-26 0.8286
3. BF A1RSA2 Replication factor C small subunit 1 1.89e-15 NA 3.78e-25 0.6457
3. BF Q0W037 Replication factor C small subunit 0.00e+00 NA 7.90e-26 0.8249
3. BF O57853 Replication factor C large subunit 1.94e-05 NA 3.39e-05 0.4815
3. BF Q8PVY4 Replication factor C small subunit 0.00e+00 NA 3.41e-22 0.8273
3. BF Q8K9J2 DNA polymerase III subunit delta' 7.78e-12 NA 7.99e-14 0.6446
3. BF Q8X082 Replication factor C subunit 5 1.02e-12 NA 0.008 0.5337
3. BF P57553 DNA polymerase III subunit gamma 0.00e+00 NA 6.64e-63 0.8546
3. BF P53033 Replication factor C subunit 2 0.00e+00 NA 4.24e-12 0.7545
3. BF A4WLY0 Replication factor C small subunit 2 0.00e+00 NA 1.68e-19 0.8699
3. BF Q18E75 Replication factor C small subunit 4.54e-13 NA 6.14e-13 0.7451
3. BF A4WGV2 Replication factor C small subunit 1 0.00e+00 NA 7.73e-23 0.7848
3. BF A6US36 Replication factor C small subunit 0.00e+00 NA 9.47e-25 0.8047
3. BF Q2NH89 Replication factor C small subunit 0.00e+00 NA 5.34e-22 0.8198
3. BF O74111 Replication factor C subunit 3 0.00e+00 NA 3.15e-25 0.7939
3. BF Q8U4J3 Replication factor C small subunit 1.23e-05 NA 4.39e-17 0.7025
3. BF P75105 Uncharacterized protein MG007 homolog 1.16e-06 NA 2.73e-04 0.5669
3. BF A9A6K6 Replication factor C small subunit 0.00e+00 NA 2.93e-25 0.8213
3. BF P57435 DNA polymerase III subunit delta' 8.92e-13 NA 5.21e-13 0.6452
3. BF P43748 DNA polymerase III subunit delta' 2.11e-12 NA 7.91e-14 0.6101
3. BF Q8TZC4 Replication factor C small subunit 2.26e-05 NA 3.13e-18 0.7224
3. BF Q9YBS7 Replication factor C small subunit 0.00e+00 NA 1.03e-21 0.8484
3. BF Q5JHP2 Replication factor C small subunit 9.70e-06 NA 1.30e-16 0.7133
3. BF Q4JAB0 Replication factor C small subunit 0.00e+00 NA 1.69e-20 0.8324
3. BF A1RWU6 Replication factor C large subunit 1.63e-07 NA 5.29e-05 0.447
3. BF Q6M044 Replication factor C small subunit 0.00e+00 NA 2.92e-26 0.8234
3. BF Q2FQT9 Replication factor C small subunit 0.00e+00 NA 3.26e-22 0.8291
3. BF Q5UZE5 Replication factor C small subunit 0.00e+00 NA 2.95e-24 0.8027
3. BF P60374 Replication factor C small subunit 1.11e-16 NA 3.25e-20 0.8044
3. BF Q5JHP1 Replication factor C large subunit 3.09e-06 NA 5.17e-05 0.3643
3. BF O26342 Replication factor C large subunit 2.81e-05 NA 7.71e-13 0.4184
3. BF A3DNV9 Replication factor C small subunit 0.00e+00 NA 1.63e-24 0.7999
3. BF A7I8Y0 Replication factor C small subunit 0.00e+00 NA 2.42e-22 0.8387
3. BF Q9UXF5 Replication factor C small subunit 0.00e+00 NA 4.46e-19 0.8148
3. BF Q8ZYK4 Replication factor C small subunit 1 0.00e+00 NA 3.79e-23 0.7376
3. BF B0R7H7 Replication factor C small subunit 1.11e-16 NA 2.54e-23 0.7863
3. BF P0C7N7 Replication factor C subunit 2 7.77e-16 NA 3.04e-14 0.6277
3. BF A1RV38 Replication factor C small subunit 2 0.00e+00 NA 1.44e-20 0.844
3. BF A3CUX9 Replication factor C small subunit 0.00e+00 NA 1.51e-20 0.8137
3. BF O57852 Replication factor C small subunit 9.57e-06 NA 2.93e-17 0.6779
3. BF Q8ZWS2 Replication factor C small subunit 2 0.00e+00 NA 2.03e-18 0.8845
3. BF Q3ITJ2 Replication factor C small subunit 0.00e+00 NA 6.16e-21 0.7897
3. BF A6VJ61 Replication factor C small subunit 0.00e+00 NA 8.98e-27 0.8145
3. BF Q05B83 Replication factor C subunit 2 0.00e+00 NA 1.81e-12 0.7697
3. BF Q46C63 Replication factor C small subunit 0.00e+00 NA 4.88e-22 0.8351
3. BF Q9V2G4 Replication factor C small subunit 1.85e-02 NA 2.75e-08 0.6882
3. BF Q8K983 DNA polymerase III subunit gamma 0.00e+00 NA 2.63e-57 0.8167
3. BF Q6L1I0 Replication factor C small subunit 0.00e+00 NA 5.67e-20 0.8363
3. BF O28219 Replication factor C small subunit 0.00e+00 NA 4.41e-27 0.7729
3. BF P9WQN0 Uncharacterized AAA domain-containing protein MT2636 9.25e-07 NA 0.005 0.53
3. BF A1RWU7 Replication factor C small subunit 0.00e+00 NA 2.16e-21 0.8301
4. PB A3DNV8 Replication factor C large subunit 1.15e-07 4.52e-02 0.004 NA
4. PB Q9UXF6 Replication factor C large subunit 1.03e-07 4.17e-02 3.15e-06 NA
4. PB A6URV8 Replication factor C large subunit 5.60e-06 5.28e-03 1.92e-10 NA
4. PB A4FZL6 Replication factor C large subunit 4.03e-06 1.74e-03 5.06e-11 NA
4. PB A6VIW1 Replication factor C large subunit 3.05e-06 1.06e-02 3.22e-11 NA
4. PB P9WNT8 DNA polymerase III subunit gamma/tau 3.23e-11 4.16e-26 1.69e-55 NA
4. PB P9WNT9 DNA polymerase III subunit gamma/tau 2.94e-10 4.16e-26 1.69e-55 NA
4. PB A6UWR5 Replication factor C large subunit 1.90e-06 8.68e-03 1.60e-07 NA
4. PB Q975D4 Replication factor C large subunit 1.63e-05 3.72e-03 1.67e-06 NA
4. PB A5UMF4 Replication factor C large subunit 4.54e-06 2.02e-03 1.61e-07 NA
4. PB P06710 DNA polymerase III subunit tau 3.69e-09 2.49e-33 6.12e-67 NA
4. PB Q58294 Replication factor C large subunit 2.12e-05 8.54e-04 2.32e-07 NA
4. PB A9A6N2 Replication factor C large subunit 3.82e-06 1.53e-02 2.09e-10 NA
4. PB Q2NH88 Replication factor C large subunit 1.05e-06 6.04e-03 2.02e-09 NA
5. P A2BL93 Replication factor C large subunit 4.08e-06 4.20e-02 NA NA
5. P Q8ZJT1 ATPase RavA 2.05e-02 1.76e-02 NA NA
5. P P44496 DNA repair protein RecN 2.32e-01 3.44e-02 NA NA
5. P B9LSM6 Translation initiation factor 2 subunit gamma 6.37e-01 2.20e-02 NA NA
5. P Q1CNU2 ATPase RavA 1.18e-02 1.76e-02 NA NA
5. P Q9YBS5 Replication factor C large subunit 1.52e-06 5.80e-04 NA NA
5. P A8AC24 Replication factor C large subunit 6.84e-06 2.79e-02 NA NA
6. F A1RSA3 Replication factor C large subunit 5.26e-07 NA NA 0.4638
6. F A4QJX4 Protein Ycf2 5.01e-01 NA NA 0.2735
6. F A4WGV3 Replication factor C large subunit 5.12e-07 NA NA 0.5034
6. F A0M8S4 Cortactin-binding protein 2 2.29e-01 NA NA 0.2386
6. F Q6EVY7 Protein Ycf2 3.88e-01 NA NA 0.2732
6. F A8W3G3 Protein Ycf2 6.86e-01 NA NA 0.2318
6. F Q2IBE6 Cortactin-binding protein 2 1.78e-01 NA NA 0.2445
6. F A6MMQ1 Protein Ycf2 6.07e-01 NA NA 0.2869
6. F A8SEE7 Protein Ycf2 6.94e-01 NA NA 0.281
6. F A4QJP2 Protein Ycf2 4.35e-01 NA NA 0.2802
6. F B1YC69 Replication factor C large subunit 5.16e-07 NA NA 0.4736
6. F Q09YI1 Cortactin-binding protein 2 3.07e-01 NA NA 0.2627
6. F Q6NRM6 DNA helicase MCM9 5.97e-02 NA NA 0.2105
6. F Q8Q084 Replication factor C large subunit 3.12e-04 NA NA 0.3266
6. F Q8S8U1 Protein Ycf2 B 5.88e-01 NA NA 0.3025
6. F Q46AT6 Replication factor C large subunit 1.70e-06 NA NA 0.3428
6. F Q6M2F0 ATP-dependent zinc metalloprotease FtsH 1.87e-03 NA NA 0.2998
6. F Q8S8V2 Protein Ycf2 A 7.15e-01 NA NA 0.281
6. F Q8TPU4 Replication factor C large subunit 2.73e-06 NA NA 0.3587
6. F Q06GJ7 Protein Ycf2 2.65e-01 NA NA 0.2733
6. F F1N2W9 DNA helicase MCM9 4.28e-02 NA NA 0.2069
6. F Q2IBF8 Cortactin-binding protein 2 1.61e-01 NA NA 0.2605
6. F Q2TBV1 Replication factor C subunit 3 2.03e-12 NA NA 0.5179
6. F Q14F97 Protein Ycf2 4.30e-01 NA NA 0.2665
6. F Q0ZIV6 Protein Ycf2 4.09e-01 NA NA 0.2705
6. F Q0G9F7 Protein Ycf2 5.39e-01 NA NA 0.2822
6. F B2LMN7 Protein Ycf2 5.71e-01 NA NA 0.2934
6. F Q27RY7 Protein Ycf2 5.40e-01 NA NA 0.2961
6. F Q07DX4 Cortactin-binding protein 2 1.75e-01 NA NA 0.2363
6. F A4QKN5 Protein Ycf2 6.98e-01 NA NA 0.2883
6. F Q8ZYK3 Replication factor C large subunit 4.28e-07 NA NA 0.5008
6. F P30072 Protein Ycf2 5.08e-01 NA NA 0.2352
6. F A0A379 Protein Ycf2 5.83e-01 NA NA 0.2797
6. F Q7Y667 Protein Ycf2 6.82e-01 NA NA 0.2785
6. F Q2MIC5 Protein Ycf2 5.52e-01 NA NA 0.2853
6. F Q09FY5 Protein Ycf2 6.35e-01 NA NA 0.2773
7. B P45262 Replication-associated recombination protein A 6.06e-06 NA 1.38e-06 NA
7. B Q9D0F6 Replication factor C subunit 5 0.00e+00 NA 1.00e-16 NA
7. B F4JRP0 Protein STICHEL-like 3 3.43e-06 NA 1.06e-30 NA
7. B Q9WUK4 Replication factor C subunit 2 0.00e+00 NA 4.18e-12 NA
7. B Q6LT48 Holliday junction ATP-dependent DNA helicase RuvB 1.42e-06 NA 0.021 NA
7. B Q58817 Replication factor C small subunit 9.70e-02 NA 1.95e-05 NA
7. B P38629 Replication factor C subunit 3 0.00e+00 NA 3.55e-17 NA
7. B P60373 Replication factor C large subunit 3.16e-07 NA 1.91e-06 NA
7. B P53034 Replication factor C subunit 2 0.00e+00 NA 8.86e-11 NA
7. B Q4JAB1 Replication factor C large subunit 6.86e-07 NA 1.63e-06 NA
7. B Q2R2B4 Replication factor C subunit 1 1.40e-03 NA 4.62e-05 NA
7. B P38630 Replication factor C subunit 1 8.60e-04 NA 0.002 NA
7. B O94449 Replication factor C subunit 4 0.00e+00 NA 2.17e-10 NA
7. B P52024 DNA polymerase III subunit delta' 1.77e-12 NA 4.18e-10 NA
7. B P35249 Replication factor C subunit 4 0.00e+00 NA 1.80e-14 NA
7. B O13984 ATPase WRNIP1 homolog C26H5.02c 9.85e-07 NA 1.11e-07 NA
7. B Q9FXM3 Replication factor C subunit 2 0.00e+00 NA 5.72e-17 NA
7. B Q8VXX4 Replication factor C subunit 3 1.32e-12 NA 6.18e-09 NA
7. B O69170 DNA polymerase III subunit delta' 2.44e-12 NA 6.40e-12 NA
7. B C3MQ13 Replication factor C large subunit 9.84e-08 NA 7.68e-06 NA
7. B Q97GT1 Holliday junction ATP-dependent DNA helicase RuvB 4.40e-06 NA 0.046 NA
7. B Q9CAM7 Replication factor C subunit 2 0.00e+00 NA 3.15e-11 NA
7. B C3NE95 Replication factor C large subunit 7.85e-08 NA 7.68e-06 NA
7. B Q99J62 Replication factor C subunit 4 0.00e+00 NA 2.85e-14 NA
7. B Q553R3 Eukaryotic translation initiation factor 4 gamma 4.00e-01 NA 0.031 NA
7. B P9WQN1 Uncharacterized AAA domain-containing protein Rv2559c 1.10e-06 NA 0.005 NA
7. B Q641W4 Replication factor C subunit 2 0.00e+00 NA 3.55e-12 NA
7. B C3NHF4 Replication factor C large subunit 8.77e-08 NA 1.18e-05 NA
7. B C4KHA7 Replication factor C large subunit 8.05e-08 NA 6.12e-06 NA
7. B Q4A6N6 Holliday junction ATP-dependent DNA helicase RuvB 2.84e-06 NA 0.006 NA
7. B P0AAZ6 Replication-associated recombination protein A 2.01e-06 NA 0.002 NA
7. B Q54MD4 Probable replication factor C subunit 4 0.00e+00 NA 1.23e-14 NA
7. B Q54BN3 Probable replication factor C subunit 3 2.19e-12 NA 7.04e-06 NA
7. B O14003 Replication factor C subunit 3 0.00e+00 NA 3.10e-22 NA
7. B P40339 Replication factor C subunit 4 0.00e+00 NA 6.03e-15 NA
7. B Q6YZ54 Replication factor C subunit 3 0.00e+00 NA 3.38e-21 NA
7. B C3MVD2 Replication factor C large subunit 1.24e-07 NA 1.34e-05 NA
7. B Q852K3 Replication factor C subunit 5 1.72e-12 NA 4.35e-08 NA
7. B P40348 Replication factor C subunit 2 7.77e-16 NA 7.24e-19 NA
7. B Q8SQM0 Replication factor C subunit 4 0.00e+00 NA 8.34e-22 NA
7. B Q7XRX1 Replication factor C subunit 4 0.00e+00 NA 4.30e-12 NA
7. B Q1D2J8 Holliday junction ATP-dependent DNA helicase RuvB 6.06e-07 NA 0.042 NA
7. B Q9CAQ8 Replication factor C subunit 5 0.00e+00 NA 4.92e-19 NA
7. B B1AJ89 Holliday junction ATP-dependent DNA helicase RuvB 1.05e-07 NA 0.010 NA
7. B O64301 Sliding-clamp-loader large subunit NA NA 0.021 NA
7. B B3R0J0 Holliday junction ATP-dependent DNA helicase RuvB 5.12e-06 NA 1.40e-04 NA
7. B P40937 Replication factor C subunit 5 0.00e+00 NA 5.73e-17 NA
7. B P38251 Replication factor C subunit 5 3.77e-12 NA 1.26e-05 NA
7. B P70828 Holliday junction ATP-dependent DNA helicase RuvB 1.28e-05 NA 0.035 NA
7. B P35250 Replication factor C subunit 2 0.00e+00 NA 6.42e-12 NA
7. B A9NF62 Holliday junction ATP-dependent DNA helicase RuvB 9.47e-07 NA 1.06e-05 NA
7. B P28631 DNA polymerase III subunit delta' 6.48e-12 NA 7.79e-09 NA
7. B Q93ZX1 Replication factor C subunit 4 0.00e+00 NA 2.06e-16 NA
7. B A3MS27 Replication factor C large subunit 5.17e-07 NA 0.002 NA
7. B P47253 Uncharacterized protein MG007 7.71e-07 NA 0.006 NA
7. B Q6M0E9 Replication factor C large subunit 1.02e-05 NA 5.48e-10 NA
7. B Q9PQ42 Holliday junction ATP-dependent DNA helicase RuvB 9.46e-08 NA 0.010 NA
7. B P75242 Holliday junction ATP-dependent DNA helicase RuvB 1.32e-07 NA 0.003 NA
7. B P0AAZ4 Replication-associated recombination protein A 1.11e-06 NA 0.002 NA
7. B F4HW65 Protein STICHEL-like 1 9.52e-06 NA 5.71e-39 NA
7. B P40151 DNA-dependent ATPase MGS1 7.80e-06 NA 1.39e-07 NA
7. B O17607 RuvB-like 1 7.12e-03 NA 0.020 NA
7. B Q98PR1 Holliday junction ATP-dependent DNA helicase RuvB 1.10e-06 NA 3.76e-05 NA
7. B O64728 Protein STICHEL 8.44e-05 NA 4.00e-38 NA
7. B Q54E21 Probable replication factor C subunit 2 0.00e+00 NA 3.15e-12 NA
7. B C3N5N1 Replication factor C large subunit 8.09e-08 NA 1.34e-05 NA
7. B Q0SPE2 Holliday junction ATP-dependent DNA helicase RuvB 5.33e-06 NA 0.022 NA
7. B Q54ST4 Probable replication factor C subunit 5 0.00e+00 NA 8.69e-19 NA
7. B Q75JU2 ATPase WRNIP1 4.80e-04 NA 3.70e-04 NA
7. B Q5UP47 Putative replication factor C small subunit L499 NA NA 2.89e-18 NA
7. B Q5UQ72 Putative replication factor C small subunit L510 NA NA 8.15e-13 NA
7. B P0AAZ5 Replication-associated recombination protein A 1.19e-06 NA 0.002 NA
7. B P34429 Probable replication factor C subunit 5 0.00e+00 NA 2.13e-16 NA
7. B Q09843 Replication factor C subunit 2 0.00e+00 NA 1.03e-16 NA
7. B P53016 Replication factor C subunit 4 4.55e-15 NA 2.63e-15 NA
7. B F4KEM0 Protein STICHEL-like 4 2.51e-06 NA 1.49e-26 NA
7. B Q5UQ47 Putative replication factor C small subunit R395 NA NA 1.64e-06 NA
7. B Q03YJ6 Holliday junction ATP-dependent DNA helicase RuvB 2.48e-06 NA 0.046 NA
7. B F4JRP8 Protein STICHEL-like 2 3.38e-11 NA 2.63e-37 NA
7. B O34528 Uncharacterized AAA domain-containing protein YrvN 1.05e-06 NA 0.001 NA