Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54598.1
JCVISYN3A_0054
Uncharacterized peroxiredoxin.
M. mycoides homolog: Q6MUH8.
TIGRfam Classification: 2=Generic.
Category: Nonessential.
Statistics
Total GO Annotation: 185
Unique PROST Go: 73
Unique BLAST Go: 24
Unique Foldseek Go: 14
Total Homologs: 439
Unique PROST Homologs: 154
Unique BLAST Homologs: 14
Unique Foldseek Homologs: 45
Literature
Danchin and Fang [1]: peroxiredoxin|expression controlled by PerR in Staphylococcus aureus
Yang and Tsui [2]: Putative peroxiredoxin bcp
Antczak et al. [3]: bcp; Bacterioferritin comigratory protein
Zhang et al. [4]: GO:0008379|thioredoxin peroxidase activity
Bianchi et al. [5]: Peroxiredoxin (bcpB-like)
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P0AE54
(Putative peroxiredoxin bcp) with a FATCAT P-Value: 0 and RMSD of 2.30 angstrom. The sequence alignment identity is 27.5%.
Structural alignment shown in left. Query protein AVX54598.1 colored as red in alignment, homolog P0AE54 colored as blue.
Query protein AVX54598.1 is also shown in right top, homolog P0AE54 showed in right bottom. They are colored based on secondary structures.
AVX54598.1 ---------MKNYQLQDHKNNLVELNSLVGQKGLIIFFYPKAKTSLCTLEVIEYQKHLDEFKQLGFNVVGVSQDEPNKNDEFCCEQNLSFLLLSDLNKDL 91 P0AE54 MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQR-VLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQV 99 AVX54598.1 VNEFNLTSETIVLDDEPFV-K-YE---RSTFVL--DNQL-NLLKEFRNVDHIEHVSD-LLEYLKKND 149 P0AE54 CEQFGVWGE------KSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNH--H--DVVLNWLKEHA 156
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0010310 | regulation of hydrogen peroxide metabolic process |
| 1. PBF | GO:0032872 | regulation of stress-activated MAPK cascade |
| 1. PBF | GO:0051920 | peroxiredoxin activity |
| 1. PBF | GO:0005829 | cytosol |
| 1. PBF | GO:0043209 | myelin sheath |
| 1. PBF | GO:0042744 | hydrogen peroxide catabolic process |
| 1. PBF | GO:0045321 | leukocyte activation |
| 1. PBF | GO:0030194 | positive regulation of blood coagulation |
| 1. PBF | GO:0002536 | respiratory burst involved in inflammatory response |
| 1. PBF | GO:2001240 | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 1. PBF | GO:0008379 | thioredoxin peroxidase activity |
| 1. PBF | GO:0006979 | response to oxidative stress |
| 1. PBF | GO:0070301 | cellular response to hydrogen peroxide |
| 1. PBF | GO:0032496 | response to lipopolysaccharide |
| 1. PBF | GO:0004601 | peroxidase activity |
| 1. PBF | GO:0042098 | T cell proliferation |
| 1. PBF | GO:0102039 | alkylhydroperoxide reductase activity |
| 1. PBF | GO:0034599 | cellular response to oxidative stress |
| 1. PBF | GO:0016209 | antioxidant activity |
| 1. PBF | GO:0045454 | cell redox homeostasis |
| 1. PBF | GO:0030101 | natural killer cell activation |
| 1. PBF | GO:0034101 | erythrocyte homeostasis |
| 1. PBF | GO:0002357 | defense response to tumor cell |
| 1. PBF | GO:0042267 | natural killer cell mediated cytotoxicity |
| 1. PBF | GO:0045581 | negative regulation of T cell differentiation |
| 1. PBF | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 1. PBF | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PBF | GO:0042542 | response to hydrogen peroxide |
| 1. PBF | GO:0019430 | removal of superoxide radicals |
| 1. PBF | GO:0005782 | peroxisomal matrix |
| 1. PBF | GO:0048538 | thymus development |
| 1. PBF | GO:0018171 | peptidyl-cysteine oxidation |
| 1. PBF | GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway |
| 1. PBF | GO:0048872 | homeostasis of number of cells |
| 2. PF | GO:0047184 | 1-acylglycerophosphocholine O-acyltransferase activity |
| 2. PF | GO:0004602 | glutathione peroxidase activity |
| 2. PF | GO:0047499 | calcium-independent phospholipase A2 activity |
| 2. PF | GO:0102568 | |
| 2. PF | GO:0016616 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor |
| 2. PF | GO:0102567 | |
| 2. PF | GO:0047017 | prostaglandin-F synthase activity |
| 2. PF | GO:0015945 | methanol metabolic process |
| 2. PF | GO:0005764 | lysosome |
| 2. PF | GO:0004623 | phospholipase A2 activity |
| 2. PF | GO:0045670 | regulation of osteoclast differentiation |
| 2. PF | GO:0001516 | prostaglandin biosynthetic process |
| 3. BF | GO:0051881 | regulation of mitochondrial membrane potential |
| 3. BF | GO:0043027 | cysteine-type endopeptidase inhibitor activity involved in apoptotic process |
| 3. BF | GO:0071453 | cellular response to oxygen levels |
| 3. BF | GO:0005737 | cytoplasm |
| 3. BF | GO:0009543 | chloroplast thylakoid lumen |
| 3. BF | GO:0001893 | maternal placenta development |
| 3. BF | GO:0030099 | myeloid cell differentiation |
| 3. BF | GO:0033673 | negative regulation of kinase activity |
| 3. BF | GO:0034614 | cellular response to reactive oxygen species |
| 4. PB | GO:2001237 | negative regulation of extrinsic apoptotic signaling pathway |
| 4. PB | GO:0033195 | response to alkyl hydroperoxide |
| 4. PB | GO:0008283 | cell population proliferation |
| 4. PB | GO:0000791 | euchromatin |
| 4. PB | GO:0042743 | hydrogen peroxide metabolic process |
| 4. PB | GO:0043410 | positive regulation of MAPK cascade |
| 4. PB | GO:0051409 | response to nitrosative stress |
| 4. PB | GO:0005739 | mitochondrion |
| 4. PB | GO:0016684 | oxidoreductase activity, acting on peroxide as acceptor |
| 4. PB | GO:0000302 | response to reactive oxygen species |
| 4. PB | GO:0009321 | alkyl hydroperoxide reductase complex |
| 4. PB | GO:0061692 | cellular detoxification of hydrogen peroxide |
| 4. PB | GO:0008430 | selenium binding |
| 4. PB | GO:0042802 | identical protein binding |
| 4. PB | GO:1902882 | regulation of response to oxidative stress |
| 4. PB | GO:0090727 | positive regulation of brood size |
| 4. PB | GO:0033194 | response to hydroperoxide |
| 4. PB | GO:0009970 | cellular response to sulfate starvation |
| 4. PB | GO:0032843 | hydroperoxide reductase activity |
| 5. P | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 5. P | GO:0031315 | extrinsic component of mitochondrial outer membrane |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0050727 | regulation of inflammatory response |
| 5. P | GO:0007605 | sensory perception of sound |
| 5. P | GO:0051450 | myoblast proliferation |
| 5. P | GO:0047066 | phospholipid-hydroperoxide glutathione peroxidase activity |
| 5. P | GO:0036171 | filamentous growth of a population of unicellular organisms in response to chemical stimulus |
| 5. P | GO:0009609 | response to symbiotic bacterium |
| 5. P | GO:0032355 | response to estradiol |
| 5. P | GO:0007283 | spermatogenesis |
| 5. P | GO:1902176 | negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway |
| 5. P | GO:0006641 | triglyceride metabolic process |
| 5. P | GO:0045444 | fat cell differentiation |
| 5. P | GO:1902905 | positive regulation of supramolecular fiber organization |
| 5. P | GO:0005615 | extracellular space |
| 5. P | GO:0051702 | biological process involved in interaction with symbiont |
| 5. P | GO:0051402 | neuron apoptotic process |
| 5. P | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 5. P | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress |
| 5. P | GO:0032060 | bleb assembly |
| 5. P | GO:0005635 | nuclear envelope |
| 5. P | GO:0007600 | sensory perception |
| 5. P | GO:0060047 | heart contraction |
| 5. P | GO:0098869 | cellular oxidant detoxification |
| 5. P | GO:0019372 | lipoxygenase pathway |
| 5. P | GO:0045821 | positive regulation of glycolytic process |
| 5. P | GO:0048026 | positive regulation of mRNA splicing, via spliceosome |
| 5. P | GO:0030152 | bacteriocin biosynthetic process |
| 5. P | GO:0006325 | chromatin organization |
| 5. P | GO:0046872 | metal ion binding |
| 5. P | GO:1903205 | regulation of hydrogen peroxide-induced cell death |
| 5. P | GO:0018158 | protein oxidation |
| 5. P | GO:0060055 | angiogenesis involved in wound healing |
| 5. P | GO:0001885 | endothelial cell development |
| 5. P | GO:0097413 | Lewy body |
| 5. P | GO:0033599 | regulation of mammary gland epithelial cell proliferation |
| 5. P | GO:0030985 | high molecular weight kininogen binding |
| 5. P | GO:0002862 | negative regulation of inflammatory response to antigenic stimulus |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0051897 | positive regulation of protein kinase B signaling |
| 5. P | GO:0040029 | regulation of gene expression, epigenetic |
| 5. P | GO:0061407 | positive regulation of transcription from RNA polymerase II promoter in response to hydrogen peroxide |
| 5. P | GO:0014902 | myotube differentiation |
| 5. P | GO:0043534 | blood vessel endothelial cell migration |
| 5. P | GO:0019207 | kinase regulator activity |
| 5. P | GO:0048741 | skeletal muscle fiber development |
| 5. P | GO:0007568 | aging |
| 5. P | GO:0010332 | response to gamma radiation |
| 5. P | GO:0009410 | response to xenobiotic stimulus |
| 5. P | GO:0043403 | skeletal muscle tissue regeneration |
| 5. P | GO:0007031 | peroxisome organization |
| 5. P | GO:0010269 | response to selenium ion |
| 5. P | GO:0090087 | regulation of peptide transport |
| 5. P | GO:0051258 | protein polymerization |
| 5. P | GO:0005783 | endoplasmic reticulum |
| 5. P | GO:0009269 | response to desiccation |
| 5. P | GO:0006982 | response to lipid hydroperoxide |
| 5. P | GO:0042311 | vasodilation |
| 5. P | GO:0071447 | cellular response to hydroperoxide |
| 5. P | GO:0017124 | SH3 domain binding |
| 5. P | GO:0001659 | temperature homeostasis |
| 5. P | GO:0019369 | arachidonic acid metabolic process |
| 5. P | GO:0006749 | glutathione metabolic process |
| 5. P | GO:0010231 | maintenance of seed dormancy |
| 5. P | GO:0061136 | regulation of proteasomal protein catabolic process |
| 5. P | GO:0045494 | photoreceptor cell maintenance |
| 5. P | GO:0009650 | UV protection |
| 5. P | GO:0004096 | catalase activity |
| 5. P | GO:0110076 | negative regulation of ferroptosis |
| 5. P | GO:1902042 | negative regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 5. P | GO:0097524 | sperm plasma membrane |
| 5. P | GO:0046475 | glycerophospholipid catabolic process |
| 6. F | GO:0016531 | copper chaperone activity |
| 6. F | GO:0016491 | oxidoreductase activity |
| 6. F | GO:0031305 | integral component of mitochondrial inner membrane |
| 6. F | GO:0001016 | RNA polymerase III transcription regulatory region sequence-specific DNA binding |
| 6. F | GO:0005778 | peroxisomal membrane |
| 6. F | GO:0016042 | lipid catabolic process |
| 6. F | GO:0016480 | negative regulation of transcription by RNA polymerase III |
| 6. F | GO:0003012 | muscle system process |
| 6. F | GO:0017004 | cytochrome complex assembly |
| 6. F | GO:0015036 | disulfide oxidoreductase activity |
| 6. F | GO:0004362 | glutathione-disulfide reductase (NADPH) activity |
| 6. F | GO:1904960 | positive regulation of cytochrome-c oxidase activity |
| 6. F | GO:0097573 | glutathione oxidoreductase activity |
| 6. F | GO:0033617 | mitochondrial cytochrome c oxidase assembly |
| 7. B | GO:0008284 | positive regulation of cell population proliferation |
| 7. B | GO:0009507 | chloroplast |
| 7. B | GO:0019901 | protein kinase binding |
| 7. B | GO:0019900 | kinase binding |
| 7. B | GO:0019290 | siderophore biosynthetic process |
| 7. B | GO:2000255 | negative regulation of male germ cell proliferation |
| 7. B | GO:0005790 | smooth endoplasmic reticulum |
| 7. B | GO:0008785 | alkyl hydroperoxide reductase activity |
| 7. B | GO:0010319 | stromule |
| 7. B | GO:0030198 | extracellular matrix organization |
| 7. B | GO:0007252 | I-kappaB phosphorylation |
| 7. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 7. B | GO:0043066 | negative regulation of apoptotic process |
| 7. B | GO:0008584 | male gonad development |
| 7. B | GO:0042981 | regulation of apoptotic process |
| 7. B | GO:0008340 | determination of adult lifespan |
| 7. B | GO:0005769 | early endosome |
| 7. B | GO:0007005 | mitochondrion organization |
| 7. B | GO:0043524 | negative regulation of neuron apoptotic process |
| 7. B | GO:0008022 | protein C-terminus binding |
| 7. B | GO:0072593 | reactive oxygen species metabolic process |
| 7. B | GO:0018401 | peptidyl-proline hydroxylation to 4-hydroxy-L-proline |
| 7. B | GO:0032991 | protein-containing complex |
| 7. B | GO:0022417 | protein maturation by protein folding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016209 | antioxidant activity |
| GO:0016491 | oxidoreductase activity |
| GO:0098869 | cellular oxidant detoxification |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q96468 | 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) | 2.02e-12 | 1.04e-15 | 1.03e-06 | 0.729 |
| 1. PBF | Q96XS5 | Peroxiredoxin 2 | 3.06e-12 | 3.91e-05 | 0.037 | 0.7885 |
| 1. PBF | P0AE11 | Alkyl hydroperoxide reductase C | 6.19e-13 | 3.02e-17 | 0.004 | 0.7677 |
| 1. PBF | Q8RCY5 | Peroxiredoxin 1 | 2.83e-12 | 8.85e-03 | 0.005 | 0.7906 |
| 1. PBF | Q6LY19 | Peroxiredoxin | 2.35e-12 | 1.90e-02 | 0.011 | 0.7568 |
| 1. PBF | P0AE10 | Alkyl hydroperoxide reductase C | 6.19e-13 | 3.02e-17 | 0.004 | 0.7502 |
| 1. PBF | P57279 | Alkyl hydroperoxide reductase C | 2.94e-13 | 5.31e-15 | 0.008 | 0.6922 |
| 1. PBF | Q49UT8 | Alkyl hydroperoxide reductase C | 1.26e-12 | 1.72e-20 | 0.028 | 0.7699 |
| 1. PBF | P0C5D0 | 1-Cys peroxiredoxin B | 7.14e-13 | 1.44e-04 | 4.57e-04 | 0.7919 |
| 1. PBF | P44411 | Putative peroxiredoxin bcp | 0.00e+00 | 2.78e-44 | 8.34e-12 | 0.8771 |
| 1. PBF | Q6W8Q2 | 1-Cys peroxiredoxin PER1 | 1.83e-12 | 2.51e-03 | 0.001 | 0.7549 |
| 1. PBF | P0AE55 | Putative peroxiredoxin bcp | 0.00e+00 | 4.93e-44 | 1.15e-14 | 0.8838 |
| 1. PBF | P0A251 | Alkyl hydroperoxide reductase C | 6.31e-13 | 1.79e-16 | 0.006 | 0.7803 |
| 1. PBF | Q1XDL4 | Putative peroxiredoxin ycf42 | 1.90e-13 | 2.09e-14 | 4.63e-04 | 0.7625 |
| 1. PBF | A0A2Z5VKM8 | 2-cysteine peroxiredoxin, chloroplastic | 3.12e-13 | 1.17e-12 | 1.85e-06 | 0.7581 |
| 1. PBF | Q6DV14 | Peroxiredoxin-1 | 5.02e-13 | 2.54e-13 | 0.013 | 0.6972 |
| 1. PBF | P55979 | Putative peroxiredoxin bcp | 3.33e-16 | 1.91e-35 | 4.22e-12 | 0.8733 |
| 1. PBF | Q6L240 | Peroxiredoxin 1 | 1.38e-11 | 4.81e-02 | 0.004 | 0.7786 |
| 1. PBF | P99074 | Alkyl hydroperoxide reductase C | 7.26e-13 | 4.17e-21 | 4.84e-04 | 0.7729 |
| 1. PBF | P9WIE2 | Alkyl hydroperoxide reductase E | 1.11e-12 | 2.09e-37 | 7.19e-07 | 0.7276 |
| 1. PBF | Q8K3U7 | Peroxiredoxin-2 | 4.55e-13 | 5.39e-12 | 3.89e-05 | 0.7422 |
| 1. PBF | Q5RC63 | Peroxiredoxin-2 | 1.27e-13 | 4.47e-26 | 2.59e-04 | 0.742 |
| 1. PBF | P0AE09 | Alkyl hydroperoxide reductase C | 5.92e-13 | 3.02e-17 | 0.004 | 0.7503 |
| 1. PBF | Q5HIR5 | Alkyl hydroperoxide reductase C | 7.87e-13 | 4.17e-21 | 4.84e-04 | 0.7725 |
| 1. PBF | P0A0B6 | Alkyl hydroperoxide reductase C | 8.08e-13 | 4.17e-21 | 4.84e-04 | 0.7719 |
| 1. PBF | Q5JF30 | Peroxiredoxin | 1.84e-12 | 9.47e-03 | 4.91e-04 | 0.7415 |
| 1. PBF | Q26695 | Thioredoxin peroxidase | 7.04e-13 | 1.22e-13 | 0.001 | 0.7336 |
| 1. PBF | Q8P9V9 | Peroxiredoxin Bcp | 1.11e-16 | 3.88e-40 | 3.26e-19 | 0.8765 |
| 1. PBF | P0AE53 | Putative peroxiredoxin bcp | 0.00e+00 | 4.93e-44 | 1.15e-14 | 0.8826 |
| 1. PBF | P9WQB6 | Alkyl hydroperoxide reductase C | 6.84e-13 | 8.49e-24 | 2.22e-06 | 0.7276 |
| 1. PBF | A6UPH7 | Peroxiredoxin | 2.33e-12 | 2.89e-03 | 0.003 | 0.759 |
| 1. PBF | Q9ZHF0 | Putative peroxiredoxin bcp | 0.00e+00 | 1.24e-43 | 2.53e-11 | 0.8803 |
| 1. PBF | O29969 | Peroxiredoxin | 1.87e-12 | 1.15e-02 | 0.024 | 0.7909 |
| 1. PBF | P51272 | Putative peroxiredoxin ycf42 | 1.50e-13 | 1.55e-13 | 0.007 | 0.7359 |
| 1. PBF | P48822 | Peroxiredoxin 1 | 4.87e-12 | 2.17e-11 | 5.94e-05 | 0.7393 |
| 1. PBF | Q6GC91 | Alkyl hydroperoxide reductase C | 8.21e-13 | 4.17e-21 | 4.84e-04 | 0.7719 |
| 1. PBF | O58966 | Peroxiredoxin | 1.56e-12 | 1.75e-03 | 0.001 | 0.7414 |
| 1. PBF | P21762 | Alkyl hydroperoxide reductase C | 2.07e-14 | 7.61e-13 | 2.26e-10 | 0.737 |
| 1. PBF | O34564 | Putative peroxiredoxin YkuU | 9.81e-13 | 3.12e-25 | 0.024 | 0.6914 |
| 1. PBF | Q2FJN4 | Alkyl hydroperoxide reductase C | 7.41e-13 | 4.17e-21 | 4.84e-04 | 0.7729 |
| 1. PBF | Q5E947 | Peroxiredoxin-1 | 6.50e-13 | 1.32e-13 | 0.008 | 0.748 |
| 1. PBF | A0R1V9 | Alkyl hydroperoxide reductase C | 5.75e-13 | 2.42e-22 | 8.99e-05 | 0.753 |
| 1. PBF | K0J4Q8 | Alkyl hydroperoxide reductase C | 9.27e-13 | 1.42e-20 | 0.003 | 0.7653 |
| 1. PBF | P80602 | 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) | 2.12e-12 | 7.09e-16 | 1.24e-06 | 0.736 |
| 1. PBF | Q6GJR7 | Alkyl hydroperoxide reductase C | 1.04e-12 | 4.17e-21 | 4.84e-04 | 0.7706 |
| 1. PBF | P0A0B5 | Alkyl hydroperoxide reductase C | 8.80e-13 | 4.17e-21 | 4.84e-04 | 0.7766 |
| 1. PBF | O33665 | Peroxiredoxin 2 | 1.00e-12 | 9.08e-03 | 0.012 | 0.7778 |
| 1. PBF | Q979N7 | Peroxiredoxin | 1.57e-13 | 1.83e-05 | 9.77e-05 | 0.7806 |
| 1. PBF | Q89AS1 | Alkyl hydroperoxide reductase C | 3.37e-13 | 1.64e-12 | 0.009 | 0.7291 |
| 1. PBF | P56876 | Alkyl hydroperoxide reductase C | 1.84e-14 | 1.90e-12 | 9.53e-11 | 0.7377 |
| 1. PBF | P0CB50 | Peroxiredoxin-1 | 5.47e-13 | 1.46e-12 | 7.05e-04 | 0.6974 |
| 1. PBF | Q9ZMU4 | Putative peroxiredoxin bcp | 2.22e-16 | 3.34e-35 | 2.12e-12 | 0.8753 |
| 1. PBF | Q2PFZ3 | Peroxiredoxin-2 | 4.56e-13 | 8.32e-12 | 1.34e-04 | 0.7408 |
| 1. PBF | Q83CY8 | Putative peroxiredoxin bcp | 0.00e+00 | 2.09e-36 | 1.17e-10 | 0.8639 |
| 1. PBF | P52572 | 1-Cys peroxiredoxin PER1 | 1.96e-12 | 5.17e-03 | 0.001 | 0.8257 |
| 1. PBF | Q9MB35 | Peroxiredoxin Q, chloroplastic (Fragment) | 5.55e-16 | 5.49e-03 | 8.96e-13 | 0.8473 |
| 1. PBF | Q8T6C4 | Thioredoxin peroxidase | 3.70e-13 | 3.51e-14 | 5.02e-04 | 0.748 |
| 1. PBF | A5IIX7 | Peroxiredoxin | 2.19e-12 | 4.15e-04 | 0.002 | 0.7842 |
| 1. PBF | Q9JKY1 | Peroxiredoxin-1 | 6.39e-13 | 1.76e-12 | 0.004 | 0.742 |
| 1. PBF | Q6L140 | Peroxiredoxin 2 | 1.29e-13 | 5.94e-06 | 2.64e-06 | 0.7794 |
| 1. PBF | P19476 | Putative peroxiredoxin | 3.36e-12 | 7.81e-06 | 0.007 | 0.7266 |
| 1. PBF | Q55624 | Putative peroxiredoxin sll0755 | 4.36e-13 | 1.67e-11 | 5.57e-05 | 0.7554 |
| 1. PBF | Q9NL98 | Peroxiredoxin | 4.66e-13 | 8.82e-14 | 8.31e-05 | 0.7634 |
| 1. PBF | Q73RS4 | Peroxiredoxin | 1.24e-11 | 4.82e-03 | 0.005 | 0.7381 |
| 1. PBF | P23161 | Putative peroxiredoxin in rubredoxin operon | 4.92e-13 | 2.70e-27 | 0.013 | 0.7238 |
| 1. PBF | Q9HJL3 | Peroxiredoxin 2 | 1.25e-13 | 4.85e-04 | 5.27e-05 | 0.7634 |
| 1. PBF | A4FWZ9 | Peroxiredoxin | 2.48e-12 | 7.10e-03 | 0.016 | 0.7574 |
| 1. PBF | P65689 | Alkyl hydroperoxide reductase E | 1.13e-12 | 2.09e-37 | 7.19e-07 | 0.7278 |
| 1. PBF | P0AE54 | Putative peroxiredoxin bcp | 0.00e+00 | 4.93e-44 | 1.15e-14 | 0.8826 |
| 1. PBF | P9WIE0 | Putative peroxiredoxin MT2597 | 4.00e-14 | 6.20e-35 | 3.28e-18 | 0.8688 |
| 1. PBF | P9WID8 | Putative peroxiredoxin MT1643 | 0.00e+00 | 7.96e-38 | 1.09e-10 | 0.8565 |
| 1. PBF | Q8K9W0 | Alkyl hydroperoxide reductase C | 2.95e-13 | 8.03e-14 | 0.016 | 0.7135 |
| 1. PBF | Q796Y8 | Peroxiredoxin Bcp | 0.00e+00 | 5.19e-47 | 1.96e-17 | 0.8926 |
| 1. PBF | Q91191 | Peroxiredoxin | 5.83e-12 | 3.51e-14 | 0.009 | 0.745 |
| 1. PBF | Q8KBN8 | Peroxiredoxin | 1.54e-11 | 7.16e-03 | 0.040 | 0.7036 |
| 1. PBF | Q9UZV4 | Peroxiredoxin | 1.52e-12 | 1.73e-03 | 5.41e-04 | 0.7415 |
| 1. PBF | Q6B4U9 | Peroxiredoxin-1 | 6.77e-13 | 5.85e-13 | 0.036 | 0.7177 |
| 1. PBF | Q9WZR4 | Peroxiredoxin | 2.99e-12 | 1.57e-04 | 0.004 | 0.7845 |
| 1. PBF | Q2YVK2 | Alkyl hydroperoxide reductase C | 7.91e-13 | 4.17e-21 | 4.84e-04 | 0.7721 |
| 1. PBF | P49537 | Putative peroxiredoxin ycf42 | 7.23e-13 | 3.67e-12 | 4.87e-06 | 0.7667 |
| 1. PBF | P0C5C8 | 1-Cys peroxiredoxin A | 8.42e-13 | 4.54e-03 | 0.003 | 0.799 |
| 1. PBF | P0A252 | Alkyl hydroperoxide reductase C | 6.36e-13 | 1.79e-16 | 0.006 | 0.7803 |
| 1. PBF | Q974S8 | Peroxiredoxin 1 | 1.54e-12 | 1.69e-02 | 0.003 | 0.7749 |
| 1. PBF | Q9BGI3 | Peroxiredoxin-2 | 6.35e-13 | 4.49e-11 | 8.99e-04 | 0.7403 |
| 2. PF | Q641F0 | Peroxiredoxin-like 2A | 5.92e-08 | 2.38e-06 | NA | 0.6666 |
| 2. PF | P14293 | Putative peroxiredoxin-B | 1.44e-12 | 1.62e-21 | NA | 0.7356 |
| 2. PF | P64290 | Glutathione peroxidase homolog BsaA | 1.18e-08 | 2.49e-12 | NA | 0.61 |
| 2. PF | Q9CFV1 | Glutathione peroxidase | 6.03e-09 | 4.32e-13 | NA | 0.6139 |
| 2. PF | O77834 | Peroxiredoxin-6 | 5.73e-13 | 2.73e-04 | NA | 0.7773 |
| 2. PF | Q5ASN8 | Putative peroxiredoxin prxA | 5.10e-11 | 3.66e-14 | NA | 0.6499 |
| 2. PF | P0A865 | Thiol peroxidase | 4.82e-12 | 3.75e-15 | NA | 0.773 |
| 2. PF | P64291 | Glutathione peroxidase homolog BsaA | 1.39e-08 | 2.49e-12 | NA | 0.5898 |
| 2. PF | Q9K813 | Thiol peroxidase | 5.40e-12 | 4.44e-18 | NA | 0.7516 |
| 2. PF | Q2PFL9 | Peroxiredoxin-6 | 7.51e-13 | 3.20e-04 | NA | 0.8017 |
| 2. PF | P91883 | Thioredoxin peroxidase | 2.71e-13 | 2.08e-12 | NA | 0.7852 |
| 2. PF | O08368 | Glutathione peroxidase | 9.44e-07 | 1.15e-02 | NA | 0.5659 |
| 2. PF | Q8XVP0 | Thiol peroxidase | 3.41e-11 | 5.65e-16 | NA | 0.785 |
| 2. PF | O66780 | Thiol peroxidase | 4.02e-11 | 3.73e-16 | NA | 0.7286 |
| 2. PF | Q8DUK3 | Thiol peroxidase | 9.04e-12 | 9.84e-16 | NA | 0.7669 |
| 2. PF | Q6AZG8 | Prostamide/prostaglandin F synthase | 1.37e-09 | 7.57e-10 | NA | 0.6682 |
| 2. PF | Q17172 | Peroxiredoxin 2 | 6.83e-13 | 2.23e-15 | NA | 0.7591 |
| 2. PF | O18994 | Epididymal secretory glutathione peroxidase | 1.43e-06 | 7.54e-05 | NA | 0.6319 |
| 2. PF | Q8PYP6 | Peroxiredoxin | 2.02e-11 | 8.06e-03 | NA | 0.7768 |
| 2. PF | Q28IJ3 | Prostamide/prostaglandin F synthase | 1.02e-09 | 5.14e-11 | NA | 0.683 |
| 2. PF | O25151 | Thiol peroxidase | 1.02e-12 | 3.82e-18 | NA | 0.7484 |
| 2. PF | Q90384 | Peroxiredoxin | 5.35e-13 | 2.44e-13 | NA | 0.7308 |
| 2. PF | Q58CY6 | Prostamide/prostaglandin F synthase | 1.31e-09 | 1.58e-12 | NA | 0.755 |
| 2. PF | Q57127 | Uncharacterized protein HI_1453 | 1.82e-09 | 3.72e-03 | NA | 0.6175 |
| 2. PF | O43099 | Peroxiredoxin Asp f3 | 4.66e-11 | 9.56e-14 | NA | 0.6815 |
| 2. PF | Q5R7S9 | Prostamide/prostaglandin F synthase | 1.46e-09 | 6.21e-14 | NA | 0.6988 |
| 2. PF | P95895 | Peroxiredoxin | 5.01e-12 | 5.67e-04 | NA | 0.7899 |
| 2. PF | Q8F7T2 | Thiol peroxidase | 2.75e-11 | 4.41e-20 | NA | 0.6684 |
| 2. PF | Q8NRG3 | Thiol peroxidase | 4.96e-08 | 4.18e-18 | NA | 0.6853 |
| 2. PF | P0A864 | Thiol peroxidase | 4.69e-12 | 3.75e-15 | NA | 0.7728 |
| 2. PF | A0JPD7 | Peroxiredoxin-like 2A | 2.09e-08 | 3.72e-08 | NA | 0.679 |
| 2. PF | Q8E536 | Thiol peroxidase | 2.46e-11 | 2.79e-18 | NA | 0.7412 |
| 2. PF | P74250 | Hydroperoxy fatty acid reductase gpx1 | 8.40e-08 | 4.27e-11 | NA | 0.6164 |
| 2. PF | Q97E14 | Thiol peroxidase | 2.23e-12 | 2.13e-21 | NA | 0.6729 |
| 2. PF | P80239 | Alkyl hydroperoxide reductase C | 1.43e-12 | 6.21e-19 | NA | 0.7735 |
| 2. PF | Q57549 | Thiol peroxidase | 3.94e-12 | 6.19e-15 | NA | 0.7857 |
| 2. PF | Q8KED5 | Thiol peroxidase | 6.17e-11 | 3.23e-13 | NA | 0.7184 |
| 2. PF | P14292 | Putative peroxiredoxin-A | 2.17e-12 | 7.65e-21 | NA | 0.7282 |
| 2. PF | P52035 | Glutathione peroxidase homolog BsaA | 6.85e-09 | 2.09e-11 | NA | 0.5959 |
| 2. PF | P0C2T0 | Glutathione peroxidase homolog | 1.24e-07 | 8.11e-12 | NA | 0.5788 |
| 2. PF | Q5HRY1 | Alkyl hydroperoxide reductase C | 1.06e-12 | 2.16e-21 | NA | 0.7756 |
| 2. PF | Q57109 | Peroxiredoxin | 3.52e-12 | 3.32e-03 | NA | 0.7743 |
| 2. PF | P57880 | Thiol peroxidase | 3.59e-08 | 1.64e-15 | NA | 0.6669 |
| 2. PF | P57668 | Thiol peroxidase | 5.70e-08 | 6.73e-15 | NA | 0.6985 |
| 2. PF | O31699 | Thiol-disulfide oxidoreductase YkuV | 5.00e-10 | 4.37e-15 | NA | 0.675 |
| 2. PF | O17433 | 1-Cys peroxiredoxin | 3.87e-12 | 1.41e-03 | NA | 0.7933 |
| 2. PF | P73728 | Peroxiredoxin sll1621 | 6.26e-12 | 1.04e-17 | NA | 0.7318 |
| 2. PF | A5F3A2 | Thiol peroxidase | 2.22e-10 | 5.43e-17 | NA | 0.7169 |
| 2. PF | Q8CSR9 | Glutathione peroxidase homolog BsaA | 8.46e-09 | 6.96e-12 | NA | 0.6168 |
| 2. PF | P0C2J8 | Thiol peroxidase | 1.89e-11 | 1.04e-17 | NA | 0.7665 |
| 2. PF | P0A863 | Thiol peroxidase | 5.07e-12 | 3.75e-15 | NA | 0.7731 |
| 2. PF | P99097 | Glutathione peroxidase homolog BsaA | 1.18e-08 | 2.49e-12 | NA | 0.5881 |
| 2. PF | Q6GHD0 | Glutathione peroxidase homolog BsaA | 1.29e-08 | 2.49e-12 | NA | 0.584 |
| 2. PF | Q6E2Z6 | 1-Cys peroxiredoxin | 3.77e-12 | 1.28e-02 | NA | 0.7902 |
| 2. PF | Q53212 | Peroxiredoxin y4vD | 1.08e-12 | 5.84e-20 | NA | 0.7071 |
| 2. PF | Q3ZBK2 | Peroxiredoxin-like 2A | 3.58e-08 | 8.94e-10 | NA | 0.6867 |
| 2. PF | Q8AV19 | Peroxiredoxin-like 2C | 1.40e-08 | 1.63e-14 | NA | 0.7052 |
| 2. PF | A9PCL4 | Peroxiredoxin-2 | 3.26e-12 | 3.03e-23 | NA | 0.7275 |
| 2. PF | Q8ZP65 | Thiol peroxidase | 3.70e-12 | 2.08e-15 | NA | 0.7373 |
| 2. PF | Q72NR4 | Thiol peroxidase | 2.48e-11 | 4.41e-20 | NA | 0.6432 |
| 2. PF | A9CQL8 | Prostamide/prostaglandin F synthase | 1.01e-09 | 8.75e-12 | NA | 0.7236 |
| 2. PF | A1KV41 | Glutathione peroxidase homolog | 1.27e-07 | 8.11e-12 | NA | 0.592 |
| 2. PF | O26262 | Peroxiredoxin | 2.96e-12 | 7.52e-04 | NA | 0.7822 |
| 2. PF | P31307 | Thiol peroxidase | 1.37e-11 | 1.50e-14 | NA | 0.7465 |
| 2. PF | P80864 | Thiol peroxidase | 2.11e-12 | 6.66e-18 | NA | 0.7402 |
| 2. PF | Q9Y8B8 | Peroxiredoxin Pen c 3 | 2.59e-11 | 2.86e-13 | NA | 0.6499 |
| 2. PF | Q8R844 | Peroxiredoxin 2 | 6.17e-12 | 8.64e-06 | NA | 0.7831 |
| 2. PF | Q8ZE42 | Thiol peroxidase | 4.17e-12 | 5.48e-13 | NA | 0.7779 |
| 2. PF | C1C416 | Prostamide/prostaglandin F synthase | 1.25e-09 | 8.15e-09 | NA | 0.6684 |
| 2. PF | Q01116 | Putative peroxisomal peroxiredoxin | 5.53e-12 | 3.20e-17 | NA | 0.7319 |
| 2. PF | P0A866 | Thiol peroxidase | 5.08e-12 | 3.75e-15 | NA | 0.7733 |
| 2. PF | P73824 | Hydroperoxy fatty acid reductase Gpx2 | 5.61e-08 | 5.26e-16 | NA | 0.5644 |
| 2. PF | P0C6P9 | Thiol peroxidase | 2.83e-10 | 2.89e-17 | NA | 0.7151 |
| 2. PF | Q92BC5 | Thiol peroxidase | 1.04e-11 | 1.26e-17 | NA | 0.7033 |
| 2. PF | Q04JB8 | Thiol peroxidase | 1.86e-11 | 1.04e-17 | NA | 0.7635 |
| 2. PF | Q6G9Q8 | Glutathione peroxidase homolog BsaA | 1.43e-08 | 2.49e-12 | NA | 0.5858 |
| 2. PF | Q9ZKE7 | Thiol peroxidase | 1.27e-12 | 8.95e-19 | NA | 0.7616 |
| 2. PF | P56577 | Putative peroxiredoxin | 1.07e-12 | 8.52e-15 | NA | 0.7515 |
| 2. PF | Q02UU0 | Alkyl hydroperoxide reductase C | 3.75e-13 | 5.56e-18 | NA | 0.7461 |
| 2. PF | Q5R7E0 | Peroxiredoxin-6 | 5.71e-13 | 1.39e-04 | NA | 0.803 |
| 2. PF | P52570 | 1-Cys peroxiredoxin | 2.55e-12 | 5.30e-03 | NA | 0.8075 |
| 2. PF | O69777 | Peroxiredoxin | 2.23e-12 | 1.38e-20 | NA | 0.7273 |
| 2. PF | Q5HKZ3 | Glutathione peroxidase homolog BsaA | 7.98e-09 | 1.71e-11 | NA | 0.5789 |
| 2. PF | Q9TSX9 | Peroxiredoxin-6 | 6.48e-13 | 1.68e-04 | NA | 0.745 |
| 2. PF | P28714 | Epididymal secretory glutathione peroxidase | 1.06e-06 | 8.64e-06 | NA | 0.6185 |
| 2. PF | Q8Z7A8 | Thiol peroxidase | 4.24e-12 | 7.19e-16 | NA | 0.7373 |
| 2. PF | P0A0T4 | Glutathione peroxidase homolog | 1.37e-07 | 8.11e-12 | NA | 0.577 |
| 2. PF | P54178 | SCO1 protein homolog | 1.81e-08 | 2.91e-08 | NA | 0.676 |
| 2. PF | O32770 | Glutathione peroxidase | 7.10e-09 | 5.13e-13 | NA | 0.6237 |
| 2. PF | O46607 | Epididymal secretory glutathione peroxidase | 1.70e-06 | 5.37e-06 | NA | 0.5675 |
| 2. PF | Q8SS85 | Putative thioredoxin peroxidase | 2.93e-14 | 3.36e-22 | NA | 0.7288 |
| 2. PF | P56578 | Putative peroxiredoxin (Fragment) | 4.51e-13 | 6.66e-18 | NA | 0.7628 |
| 2. PF | Q8FQH8 | Thiol peroxidase | 1.53e-12 | 1.62e-16 | NA | 0.7424 |
| 2. PF | Q5HGC7 | Glutathione peroxidase homolog BsaA | 1.39e-08 | 2.49e-12 | NA | 0.5889 |
| 2. PF | P26830 | Alkyl hydroperoxide reductase C (Fragment) | 6.33e-12 | 9.32e-05 | NA | 0.7673 |
| 2. PF | Q8CMQ2 | Alkyl hydroperoxide reductase C | 1.04e-12 | 2.62e-21 | NA | 0.7765 |
| 2. PF | Q9PPE0 | Thiol peroxidase | 2.63e-12 | 1.51e-22 | NA | 0.7772 |
| 2. PF | P52574 | Probable 1-Cys peroxiredoxin | 4.24e-13 | 5.33e-05 | NA | 0.7816 |
| 2. PF | Q71Z84 | Thiol peroxidase | 1.07e-11 | 3.49e-18 | NA | 0.7034 |
| 2. PF | Q9Z9N7 | Glutathione peroxidase homolog BsaA | 7.65e-09 | 2.91e-12 | NA | 0.6123 |
| 2. PF | P0A0T5 | Glutathione peroxidase homolog | 1.28e-07 | 8.11e-12 | NA | 0.5768 |
| 2. PF | P0A4M6 | Thiol peroxidase | 1.89e-11 | 1.04e-17 | NA | 0.7663 |
| 2. PF | Q148E0 | Peroxiredoxin-like 2C | 1.07e-09 | 3.00e-07 | NA | 0.7605 |
| 2. PF | Q4L376 | Alkyl hydroperoxide reductase C | 8.09e-13 | 6.52e-21 | NA | 0.7767 |
| 2. PF | B5X9L9 | Prostamide/prostaglandin F synthase | 4.79e-10 | 2.53e-14 | NA | 0.7284 |
| 2. PF | Q5ZJF4 | Peroxiredoxin-6 | 7.04e-13 | 4.38e-04 | NA | 0.7934 |
| 3. BF | A8A9P0 | Peroxiredoxin | 1.19e-11 | NA | 0.032 | 0.7572 |
| 3. BF | A2BJD9 | Peroxiredoxin | 9.19e-12 | NA | 0.038 | 0.7773 |
| 3. BF | Q6QPJ6 | Peroxiredoxin Q, chloroplastic | 2.11e-14 | NA | 5.71e-13 | 0.8441 |
| 3. BF | O24364 | 2-Cys peroxiredoxin BAS1, chloroplastic | 5.55e-11 | NA | 6.20e-05 | 0.7644 |
| 3. BF | Q6UBI3 | Peroxiredoxin Q, chloroplastic | 6.22e-15 | NA | 8.37e-09 | 0.8512 |
| 3. BF | P52571 | Probable 1-Cys peroxiredoxin (Fragment) | 3.14e-11 | NA | 0.024 | 0.6815 |
| 3. BF | Q74NC6 | Peroxiredoxin | 2.95e-12 | NA | 0.047 | 0.7719 |
| 3. BF | P35705 | Thioredoxin-dependent peroxide reductase, mitochondrial | 2.45e-11 | NA | 0.004 | 0.7617 |
| 3. BF | Q9BGI2 | Peroxiredoxin-4 | 3.73e-11 | NA | 0.002 | 0.7563 |
| 3. BF | Q5REY3 | Thioredoxin-dependent peroxide reductase, mitochondrial | 3.01e-11 | NA | 0.005 | 0.7614 |
| 3. BF | Q9Y9L0 | Peroxiredoxin | 2.56e-11 | NA | 0.027 | 0.7762 |
| 3. BF | Q5S1S6 | Peroxiredoxin Q, chloroplastic | 1.29e-13 | NA | 4.10e-11 | 0.8358 |
| 3. BF | Q75SY5 | Peroxiredoxin Q, chloroplastic | 1.49e-14 | NA | 4.23e-11 | 0.8495 |
| 3. BF | P0C5D4 | Putative peroxiredoxin Q, chloroplastic | 2.11e-14 | NA | 1.88e-11 | 0.8465 |
| 3. BF | Q55060 | Peroxiredoxin 1 | 1.00e-12 | NA | 0.010 | 0.7689 |
| 4. PB | P35704 | Peroxiredoxin-2 | 4.41e-13 | 2.19e-12 | 1.43e-05 | NA |
| 4. PB | Q21824 | Probable peroxiredoxin prdx-3 | 3.50e-12 | 1.85e-11 | 5.70e-07 | NA |
| 4. PB | P0C5D1 | 1-Cys peroxiredoxin B | 8.60e-13 | 1.74e-04 | 2.76e-04 | NA |
| 4. PB | A0A0K3AUJ9 | Peroxiredoxin prdx-2 | 7.14e-13 | 3.23e-14 | 0.030 | NA |
| 4. PB | Q61171 | Peroxiredoxin-2 | 4.68e-13 | 6.05e-12 | 1.26e-05 | NA |
| 4. PB | P0AE08 | Alkyl hydroperoxide reductase C | 6.27e-13 | 3.02e-17 | 0.004 | NA |
| 4. PB | A2SZW8 | 1-Cys peroxiredoxin PER1 | 9.89e-13 | 2.29e-02 | 5.53e-04 | NA |
| 4. PB | Q9V3P0 | Peroxiredoxin 1 | 5.59e-13 | 3.10e-12 | 1.21e-04 | NA |
| 4. PB | P0C5C9 | 1-Cys peroxiredoxin A | 9.56e-13 | 6.68e-03 | 0.004 | NA |
| 4. PB | P0A0B7 | Alkyl hydroperoxide reductase C | 8.82e-13 | 4.17e-21 | 4.84e-04 | NA |
| 4. PB | Q06830 | Peroxiredoxin-1 | 6.06e-13 | 4.38e-13 | 0.019 | NA |
| 4. PB | Q63716 | Peroxiredoxin-1 | 6.27e-13 | 1.25e-12 | 0.003 | NA |
| 4. PB | P52552 | Peroxiredoxin-2 (Fragment) | NA | 7.35e-06 | 1.18e-04 | NA |
| 4. PB | P9WID9 | Putative peroxiredoxin Rv1608c | 0.00e+00 | 7.96e-38 | 1.09e-10 | NA |
| 4. PB | Q555L5 | Peroxiredoxin-4 | 1.56e-11 | 3.60e-02 | 0.001 | NA |
| 4. PB | P9WQB7 | Alkyl hydroperoxide reductase C | 7.94e-13 | 8.49e-24 | 2.22e-06 | NA |
| 4. PB | P9WIE1 | Putative peroxiredoxin Rv2521 | 4.10e-14 | 6.20e-35 | 3.28e-18 | NA |
| 4. PB | P32119 | Peroxiredoxin-2 | 4.66e-13 | 8.32e-12 | 1.34e-04 | NA |
| 4. PB | P9WIE3 | Alkyl hydroperoxide reductase E | 1.12e-12 | 2.09e-37 | 7.19e-07 | NA |
| 4. PB | P35700 | Peroxiredoxin-1 | 6.30e-13 | 7.81e-13 | 7.40e-04 | NA |
| 4. PB | P0AE52 | Peroxiredoxin Bcp | 0.00e+00 | 4.93e-44 | 1.15e-14 | NA |
| 5. P | P0A862 | Thiol peroxidase | 4.83e-12 | 3.75e-15 | NA | NA |
| 5. P | Q731D9 | UPF0403 protein BCE_4227 | 2.23e-04 | 3.48e-02 | NA | NA |
| 5. P | Q865R2 | Glutathione peroxidase 1 | NA | 1.39e-09 | NA | NA |
| 5. P | Q9CYH2 | Peroxiredoxin-like 2A | 3.41e-08 | 1.07e-09 | NA | NA |
| 5. P | Q5ZI34 | Peroxiredoxin-like 2A | NA | 1.28e-06 | NA | NA |
| 5. P | Q0EFA0 | Glutathione peroxidase 1 | NA | 1.46e-10 | NA | NA |
| 5. P | Q8Y6U8 | Thiol peroxidase | 9.26e-12 | 5.66e-19 | NA | NA |
| 5. P | P83645 | Glutathione peroxidase 2 | NA | 2.76e-10 | NA | NA |
| 5. P | Q8TED1 | Probable glutathione peroxidase 8 | 6.10e-08 | 9.47e-03 | NA | NA |
| 5. P | P11909 | Glutathione peroxidase 1 | NA | 8.33e-10 | NA | NA |
| 5. P | P99146 | Thiol peroxidase | 6.71e-12 | 1.98e-16 | NA | NA |
| 5. P | Q4AEH0 | Phospholipid hydroperoxide glutathione peroxidase | NA | 7.05e-04 | NA | NA |
| 5. P | Q4AEH5 | Glutathione peroxidase 3 | NA | 4.48e-05 | NA | NA |
| 5. P | Q81E36 | UPF0403 protein BC_2157 | 2.38e-04 | 1.42e-03 | NA | NA |
| 5. P | Q6AXX6 | Peroxiredoxin-like 2A | 3.90e-08 | 1.16e-06 | NA | NA |
| 5. P | Q9LEF0 | Probable phospholipid hydroperoxide glutathione peroxidase | 3.84e-09 | 2.52e-12 | NA | NA |
| 5. P | O62327 | Glutathione peroxidase 2 | 1.47e-08 | 2.26e-15 | NA | NA |
| 5. P | Q9N2J2 | Phospholipid hydroperoxide glutathione peroxidase | NA | 5.08e-04 | NA | NA |
| 5. P | Q95003 | Glutathione peroxidase 3 | 7.91e-06 | 3.32e-06 | NA | NA |
| 5. P | Q04120 | Peroxiredoxin TSA2 | 6.46e-13 | 1.56e-12 | NA | NA |
| 5. P | Q5VZ03 | Nucleoredoxin-like protein 2 | 3.95e-05 | 2.88e-16 | NA | NA |
| 5. P | Q9JHC0 | Glutathione peroxidase 2 | NA | 8.84e-10 | NA | NA |
| 5. P | Q98234 | Glutathione peroxidase | NA | 2.94e-07 | NA | NA |
| 5. P | Q8CS58 | Thiol peroxidase | 1.31e-11 | 2.79e-18 | NA | NA |
| 5. P | O22711 | Peroxiredoxin-2D | 7.03e-12 | 8.02e-21 | NA | NA |
| 5. P | Q99LJ6 | Glutathione peroxidase 7 | 5.45e-09 | 1.27e-07 | NA | NA |
| 5. P | D3ZVR7 | Prostamide/prostaglandin F synthase | 1.50e-09 | 1.62e-10 | NA | NA |
| 5. P | P9WG34 | Thiol peroxidase | 1.13e-11 | 3.14e-16 | NA | NA |
| 5. P | Q96SL4 | Glutathione peroxidase 7 | 1.51e-08 | 2.17e-07 | NA | NA |
| 5. P | Q9SRZ4 | Peroxiredoxin-2C | 6.59e-12 | 7.53e-21 | NA | NA |
| 5. P | P36970 | Phospholipid hydroperoxide glutathione peroxidase | NA | 2.81e-04 | NA | NA |
| 5. P | P39187 | Uncharacterized protein YtfJ | 9.78e-05 | 8.93e-03 | NA | NA |
| 5. P | P38143 | Glutathione peroxidase-like peroxiredoxin 2 | 8.92e-09 | 1.05e-13 | NA | NA |
| 5. P | O04922 | Probable glutathione peroxidase 2 | 4.07e-09 | 1.85e-12 | NA | NA |
| 5. P | Q81R83 | UPF0403 protein BA_2173/GBAA_2173/BAS2019 | 2.39e-04 | 2.07e-03 | NA | NA |
| 5. P | O04005 | 1-Cys peroxiredoxin PER1 | 2.67e-12 | 1.16e-02 | NA | NA |
| 5. P | Q06652 | Probable phospholipid hydroperoxide glutathione peroxidase | 1.26e-09 | 8.82e-14 | NA | NA |
| 5. P | O23814 | Probable phospholipid hydroperoxide glutathione peroxidase | 2.74e-09 | 5.89e-12 | NA | NA |
| 5. P | P34760 | Peroxiredoxin TSA1 | 7.74e-13 | 7.03e-13 | NA | NA |
| 5. P | Q8EPB7 | Thiol peroxidase | 3.54e-13 | 4.23e-17 | NA | NA |
| 5. P | Q6G8L4 | Thiol peroxidase | 4.68e-12 | 2.72e-16 | NA | NA |
| 5. P | Q9DB60 | Prostamide/prostaglandin F synthase | 1.01e-09 | 1.80e-10 | NA | NA |
| 5. P | P83564 | Glutathione peroxidase 1, mitochondrial | NA | 1.69e-03 | NA | NA |
| 5. P | O59858 | Glutathione peroxidase-like peroxiredoxin gpx1 | 5.51e-09 | 9.09e-12 | NA | NA |
| 5. P | P30708 | Probable phospholipid hydroperoxide glutathione peroxidase | 5.84e-09 | 4.89e-11 | NA | NA |
| 5. P | O22850 | Probable glutathione peroxidase 3, mitochondrial | 1.27e-08 | 9.08e-03 | NA | NA |
| 5. P | P66954 | Thiol peroxidase | 6.98e-12 | 1.98e-16 | NA | NA |
| 5. P | Q7ZV14 | Probable glutathione peroxidase 8 | 1.79e-07 | 3.53e-03 | NA | NA |
| 5. P | P36969 | Phospholipid hydroperoxide glutathione peroxidase | NA | 4.07e-04 | NA | NA |
| 5. P | Q4L754 | Thiol peroxidase | 8.89e-12 | 1.03e-17 | NA | NA |
| 5. P | Q5U583 | Probable glutathione peroxidase 8-B | 3.84e-08 | 4.06e-02 | NA | NA |
| 5. P | A6QLY2 | Glutathione peroxidase 7 | 1.12e-08 | 1.47e-07 | NA | NA |
| 5. P | Q32QL6 | Phospholipid hydroperoxide glutathione peroxidase | NA | 7.94e-04 | NA | NA |
| 5. P | Q4AEI2 | Glutathione peroxidase 1 | NA | 2.50e-11 | NA | NA |
| 5. P | O08709 | Peroxiredoxin-6 | 4.55e-13 | 4.89e-04 | NA | NA |
| 5. P | Q5WGC5 | UPF0403 protein ABC2045 | 1.57e-04 | 4.77e-02 | NA | NA |
| 5. P | Q81M74 | UPF0403 protein BA_4378/GBAA_4378/BAS4061 | 2.20e-04 | 3.48e-02 | NA | NA |
| 5. P | O14313 | Peroxisomal membrane associated protein 20 | 8.56e-12 | 5.35e-29 | NA | NA |
| 5. P | Q9FXS3 | Probable phospholipid hydroperoxide glutathione peroxidase | 6.94e-09 | 4.68e-12 | NA | NA |
| 5. P | Q9FR35 | Peroxiredoxin-2C | 2.06e-12 | 9.49e-23 | NA | NA |
| 5. P | Q2NL01 | Probable glutathione peroxidase 8 | 5.71e-08 | 1.08e-02 | NA | NA |
| 5. P | Q9D1A0 | Peroxiredoxin-like 2C | 9.33e-10 | 5.16e-10 | NA | NA |
| 5. P | P36014 | Glutathione peroxidase-like peroxiredoxin 1 | 4.43e-09 | 8.13e-14 | NA | NA |
| 5. P | Q8NW51 | Thiol peroxidase | 4.15e-12 | 2.72e-16 | NA | NA |
| 5. P | Q8MJ14 | Glutathione peroxidase 1 | NA | 6.19e-11 | NA | NA |
| 5. P | Q4AEI1 | Glutathione peroxidase 1 | NA | 6.80e-10 | NA | NA |
| 5. P | O23970 | Glutathione peroxidase 1 | 5.21e-09 | 1.92e-12 | NA | NA |
| 5. P | P67878 | Cuticular glutathione peroxidase | 3.45e-05 | 1.14e-04 | NA | NA |
| 5. P | O75715 | Epididymal secretory glutathione peroxidase | 8.37e-07 | 2.41e-06 | NA | NA |
| 5. P | P46412 | Glutathione peroxidase 3 | NA | 1.92e-05 | NA | NA |
| 5. P | Q4AEH3 | Glutathione peroxidase 3 | NA | 1.25e-04 | NA | NA |
| 5. P | Q4AEH9 | Glutathione peroxidase 2 | NA | 4.92e-10 | NA | NA |
| 5. P | Q5HP38 | UPF0403 protein SERP1075 | 2.62e-04 | 3.81e-02 | NA | NA |
| 5. P | Q9L3Q5 | Selenocysteine-containing peroxiredoxin PrxU | NA | 5.00e-06 | NA | NA |
| 5. P | O35244 | Peroxiredoxin-6 | 5.01e-13 | 7.72e-04 | NA | NA |
| 5. P | Q67LR6 | UPF0403 protein STH2395 | 1.37e-04 | 6.92e-04 | NA | NA |
| 5. P | P21765 | Epididymal secretory glutathione peroxidase | 1.20e-06 | 2.78e-06 | NA | NA |
| 5. P | O77404 | Tryparedoxin | 1.31e-06 | 2.34e-11 | NA | NA |
| 5. P | G9JJU2 | Glutathione peroxidase | NA | 1.09e-06 | NA | NA |
| 5. P | P67877 | Cuticular glutathione peroxidase | 3.48e-05 | 1.14e-04 | NA | NA |
| 5. P | Q54SE2 | 1-Cys peroxiredoxin | 6.41e-12 | 1.19e-08 | NA | NA |
| 5. P | Q59WD3 | Glutathione peroxidase-like peroxiredoxin GPX3 | 2.67e-08 | 4.50e-12 | NA | NA |
| 5. P | P9WG35 | Thiol peroxidase | 1.17e-11 | 3.14e-16 | NA | NA |
| 5. P | Q4AEG9 | Phospholipid hydroperoxide glutathione peroxidase | NA | 1.16e-03 | NA | NA |
| 5. P | Q9XEX2 | Peroxiredoxin-2B | 3.84e-12 | 9.66e-22 | NA | NA |
| 5. P | O24031 | Probable phospholipid hydroperoxide glutathione peroxidase | 7.11e-09 | 1.01e-13 | NA | NA |
| 5. P | P18283 | Glutathione peroxidase 2 | NA | 4.92e-10 | NA | NA |
| 5. P | Q9LYB4 | Probable glutathione peroxidase 5 | 6.59e-09 | 1.16e-09 | NA | NA |
| 5. P | Q4AEH7 | Glutathione peroxidase 2 | NA | 1.17e-09 | NA | NA |
| 5. P | P36968 | Phospholipid hydroperoxide glutathione peroxidase | NA | 2.71e-04 | NA | NA |
| 5. P | P37141 | Glutathione peroxidase 3 | NA | 6.10e-05 | NA | NA |
| 5. P | Q635D0 | UPF0403 protein BCE33L3907 | 2.20e-04 | 3.48e-02 | NA | NA |
| 5. P | P22352 | Glutathione peroxidase 3 | NA | 2.32e-05 | NA | NA |
| 5. P | Q5KZ20 | UPF0403 protein GK1781 | 2.91e-04 | 4.46e-03 | NA | NA |
| 5. P | P35666 | Cuticular glutathione peroxidase | 3.41e-05 | 9.59e-05 | NA | NA |
| 5. P | Q91WR8 | Glutathione peroxidase 6 | 7.97e-07 | 1.62e-06 | NA | NA |
| 5. P | Q1IQG9 | UPF0403 protein Acid345_1880 | 3.65e-04 | 3.65e-05 | NA | NA |
| 5. P | Q6PBP3 | Peroxiredoxin-like 2A | NA | 4.79e-09 | NA | NA |
| 5. P | Q8L910 | Probable glutathione peroxidase 4 | 2.87e-09 | 1.52e-12 | NA | NA |
| 5. P | P54170 | UPF0403 protein YphP | 1.92e-04 | 1.16e-02 | NA | NA |
| 5. P | Q4AEI0 | Glutathione peroxidase 2 | NA | 2.86e-10 | NA | NA |
| 5. P | P0CU34 | Peroxiredoxin TSA1-B | 4.36e-13 | 4.93e-12 | NA | NA |
| 5. P | O31430 | Thioredoxin-like protein SkfH | 7.51e-09 | 1.43e-13 | NA | NA |
| 5. P | Q4AEH2 | Phospholipid hydroperoxide glutathione peroxidase | NA | 4.07e-04 | NA | NA |
| 5. P | Q6HJF7 | UPF0403 protein BT9727_1990 | 2.36e-04 | 2.07e-03 | NA | NA |
| 5. P | Q63C03 | UPF0403 protein BCE33L1972 | 2.39e-04 | 2.07e-03 | NA | NA |
| 5. P | Q9Y7F0 | Peroxiredoxin TSA1-A | 4.91e-13 | 4.93e-12 | NA | NA |
| 5. P | P04041 | Glutathione peroxidase 1 | NA | 6.96e-10 | NA | NA |
| 5. P | Q0EF99 | Glutathione peroxidase 1 | NA | 6.80e-10 | NA | NA |
| 5. P | Q00277 | Glutathione peroxidase | NA | 6.85e-13 | NA | NA |
| 5. P | Q4AEI3 | Glutathione peroxidase 1 | NA | 1.85e-10 | NA | NA |
| 5. P | Q11WG7 | UPF0403 protein CHU_0972 | 1.69e-04 | 2.28e-02 | NA | NA |
| 5. P | Q6GFZ4 | Thiol peroxidase | 6.41e-12 | 4.01e-16 | NA | NA |
| 5. P | Q9D7B7 | Probable glutathione peroxidase 8 | 1.94e-07 | 4.97e-02 | NA | NA |
| 5. P | Q5RFG3 | Glutathione peroxidase 3 | NA | 2.64e-05 | NA | NA |
| 5. P | P30041 | Peroxiredoxin-6 | 5.41e-13 | 1.83e-04 | NA | NA |
| 5. P | P07203 | Glutathione peroxidase 1 | NA | 1.45e-11 | NA | NA |
| 5. P | Q739A9 | UPF0403 protein BCE_2233 | 2.27e-04 | 6.63e-03 | NA | NA |
| 5. P | Q0EF98 | Glutathione peroxidase 2 | NA | 6.25e-10 | NA | NA |
| 5. P | Q64625 | Glutathione peroxidase 6 | 5.26e-07 | 3.57e-06 | NA | NA |
| 5. P | P31308 | Thiol peroxidase | 1.58e-11 | 3.28e-16 | NA | NA |
| 5. P | P66953 | Thiol peroxidase | 1.09e-11 | 3.14e-16 | NA | NA |
| 5. P | O70325 | Phospholipid hydroperoxide glutathione peroxidase | NA | 2.18e-04 | NA | NA |
| 5. P | O02621 | Glutathione peroxidase 1 | 9.34e-09 | 7.30e-16 | NA | NA |
| 5. P | Q5HNJ2 | Thiol peroxidase | 1.10e-11 | 2.79e-18 | NA | NA |
| 5. P | P59796 | Glutathione peroxidase 6 | NA | 1.11e-05 | NA | NA |
| 5. P | Q4AEH8 | Glutathione peroxidase 2 | NA | 2.44e-10 | NA | NA |
| 5. P | Q49YE4 | Thiol peroxidase | 1.18e-11 | 3.05e-16 | NA | NA |
| 5. P | P00435 | Glutathione peroxidase 1 | NA | 1.89e-10 | NA | NA |
| 5. P | Q8TBF2 | Prostamide/prostaglandin F synthase | 1.57e-09 | 7.13e-13 | NA | NA |
| 5. P | P23764 | Glutathione peroxidase 3 | NA | 9.09e-06 | NA | NA |
| 5. P | Q4AEH1 | Phospholipid hydroperoxide glutathione peroxidase | NA | 1.30e-03 | NA | NA |
| 5. P | Q9D531 | Nucleoredoxin-like protein 2 | 4.86e-05 | 4.18e-16 | NA | NA |
| 5. P | O49069 | Probable phospholipid hydroperoxide glutathione peroxidase | 6.97e-09 | 3.86e-11 | NA | NA |
| 5. P | Q4AEH4 | Glutathione peroxidase 3 | NA | 7.26e-05 | NA | NA |
| 5. P | O23968 | Probable phospholipid hydroperoxide glutathione peroxidase | 6.68e-09 | 4.87e-08 | NA | NA |
| 5. P | P30710 | Epididymal secretory glutathione peroxidase | 1.22e-06 | 5.10e-06 | NA | NA |
| 5. P | P06610 | Thioredoxin/glutathione peroxidase BtuE | 9.47e-08 | 6.56e-10 | NA | NA |
| 5. P | Q9BRX8 | Peroxiredoxin-like 2A | 4.83e-08 | 2.73e-06 | NA | NA |
| 5. P | P38013 | Peroxiredoxin AHP1 | 2.17e-10 | 1.38e-20 | NA | NA |
| 5. P | Q8SSH7 | Probable phospholipid hydroperoxide glutathione peroxidase | 6.33e-06 | 8.94e-10 | NA | NA |
| 5. P | P40581 | Glutathione peroxidase-like peroxiredoxin HYR1 | 7.56e-09 | 6.55e-14 | NA | NA |
| 5. P | Q8DZH0 | Thiol peroxidase | 2.82e-11 | 2.61e-17 | NA | NA |
| 5. P | Q6IRC8 | Probable glutathione peroxidase 8-A | 4.46e-08 | 8.13e-03 | NA | NA |
| 5. P | O74887 | Peroxiredoxin tpx1 | 3.64e-13 | 2.86e-13 | NA | NA |
| 5. P | Q6NV24 | Prostamide/prostaglandin F synthase | 8.02e-10 | 8.29e-15 | NA | NA |
| 5. P | P52033 | Glutathione peroxidase | 3.85e-05 | 6.21e-04 | NA | NA |
| 5. P | P34227 | Peroxiredoxin PRX1, mitochondrial | 2.38e-10 | 1.52e-06 | NA | NA |
| 5. P | Q4RSM6 | Probable glutathione peroxidase 8 | 2.60e-08 | 6.92e-03 | NA | NA |
| 5. P | P42366 | Thiol peroxidase | 1.61e-11 | 3.47e-16 | NA | NA |
| 5. P | Q5HF61 | Thiol peroxidase | 4.32e-12 | 2.72e-16 | NA | NA |
| 5. P | Q7RTV5 | Peroxiredoxin-like 2C | 1.13e-09 | 4.92e-08 | NA | NA |
| 5. P | Q8LBU2 | Probable glutathione peroxidase 8 | 5.24e-09 | 3.67e-12 | NA | NA |
| 5. P | P11352 | Glutathione peroxidase 1 | NA | 5.55e-10 | NA | NA |
| 6. F | Q9ZCW7 | SCO2-like protein RP587 | 5.52e-09 | NA | NA | 0.6998 |
| 6. F | Q8U218 | Peroxiredoxin | 1.33e-12 | NA | NA | 0.7553 |
| 6. F | A6H784 | Protein SCO2 homolog, mitochondrial | 3.12e-08 | NA | NA | 0.7171 |
| 6. F | Q9ZEB4 | SCO2-like protein RP031 | 7.96e-09 | NA | NA | 0.723 |
| 6. F | Q81SZ9 | Thiol-disulfide oxidoreductase ResA | 3.51e-11 | NA | NA | 0.7036 |
| 6. F | Q92JM5 | SCO2-like protein RC0042 | 1.31e-08 | NA | NA | 0.6648 |
| 6. F | Q73B22 | Thiol-disulfide oxidoreductase ResA | 2.98e-11 | NA | NA | 0.7068 |
| 6. F | P9WG64 | Soluble secreted antigen MPT53 | 1.08e-09 | NA | NA | 0.6656 |
| 6. F | P9WG62 | Protein DipZ | 5.84e-04 | NA | NA | 0.6082 |
| 6. F | Q63DQ8 | Thiol-disulfide oxidoreductase ResA | 3.59e-11 | NA | NA | 0.7053 |
| 6. F | B3EWI1 | Glutathione amide-dependent peroxidase | 1.04e-09 | NA | NA | 0.7912 |
| 6. F | Q92H76 | SCO2-like protein RC0895 | 2.82e-09 | NA | NA | 0.7459 |
| 6. F | Q81FU5 | Thiol-disulfide oxidoreductase ResA | 3.67e-11 | NA | NA | 0.7053 |
| 6. F | Q5KXL9 | Thiol-disulfide oxidoreductase ResA | 2.74e-11 | NA | NA | 0.7173 |
| 6. F | Q9HKX0 | Peroxiredoxin 1 | 1.49e-11 | NA | NA | 0.7688 |
| 6. F | Q68WF1 | SCO2-like protein RT0576 | 2.13e-09 | NA | NA | 0.7406 |
| 6. F | Q1RIN4 | SCO2-like protein RBE_0699 | 1.39e-09 | NA | NA | 0.7366 |
| 6. F | Q5WGY8 | Probable thiol-disulfide oxidoreductase ResA | 8.00e-10 | NA | NA | 0.6944 |
| 6. F | Q9KCJ4 | Thiol-disulfide oxidoreductase ResA | 3.92e-11 | NA | NA | 0.6873 |
| 6. F | Q65HX8 | Thiol-disulfide oxidoreductase ResA | 2.27e-11 | NA | NA | 0.697 |
| 6. F | O31820 | Thioredoxin-like protein YneN | 6.84e-10 | NA | NA | 0.6684 |
| 6. F | P30343 | Mercury resistance operon ORF3 | 1.67e-08 | NA | NA | 0.6381 |
| 6. F | Q6HL81 | Thiol-disulfide oxidoreductase ResA | 2.96e-11 | NA | NA | 0.7066 |
| 6. F | A0RBT0 | Thiol-disulfide oxidoreductase ResA | 3.61e-11 | NA | NA | 0.7061 |
| 6. F | P44758 | Hybrid peroxiredoxin hyPrx5 | 1.26e-10 | NA | NA | 0.7857 |
| 6. F | Q9BGI1 | Peroxiredoxin-5, mitochondrial | 1.09e-10 | NA | NA | 0.7203 |
| 6. F | Q9PAN4 | Thiol:disulfide interchange protein DsbE | 1.22e-08 | NA | NA | 0.6211 |
| 6. F | O67024 | Peroxiredoxin | 7.38e-12 | NA | NA | 0.7561 |
| 6. F | Q8CXF3 | Thiol-disulfide oxidoreductase ResA | 9.20e-10 | NA | NA | 0.7129 |
| 6. F | P43787 | Thioredoxin-like protein HI_1115 | 1.29e-09 | NA | NA | 0.6577 |
| 6. F | P35160 | Thiol-disulfide oxidoreductase ResA | 3.43e-11 | NA | NA | 0.7339 |
| 6. F | Q87BH3 | Thiol:disulfide interchange protein DsbE | 1.11e-08 | NA | NA | 0.6204 |
| 6. F | P0A619 | Soluble secreted antigen MPT53 | 9.10e-10 | NA | NA | 0.665 |
| 6. F | A4IF69 | NHL repeat-containing protein 2 | 1.34e-03 | NA | NA | 0.5309 |
| 6. F | Q9GLW9 | Peroxiredoxin-5, mitochondrial | 1.04e-10 | NA | NA | 0.7809 |
| 6. F | Q9GLW7 | Peroxiredoxin-5, mitochondrial | 9.62e-11 | NA | NA | 0.7779 |
| 6. F | A3DKL1 | Peroxiredoxin | 1.14e-11 | NA | NA | 0.7779 |
| 6. F | Q5ZI67 | NHL repeat-containing protein 2 | 1.05e-03 | NA | NA | 0.53 |
| 6. F | Q52720 | Protein SenC | 1.08e-08 | NA | NA | 0.7115 |
| 6. F | Q4UNH4 | SCO2-like protein RF_0043 | 1.71e-08 | NA | NA | 0.7144 |
| 6. F | Q4UKW2 | SCO2-like protein RF_0960 | 2.11e-09 | NA | NA | 0.7185 |
| 6. F | A1A4J8 | Protein SCO1 homolog, mitochondrial | 4.46e-08 | NA | NA | 0.7222 |
| 6. F | Q1RKK4 | SCO2-like protein RBE_0029 | 1.05e-08 | NA | NA | 0.6846 |
| 6. F | A4IQF5 | Thiol-disulfide oxidoreductase ResA | 1.62e-11 | NA | NA | 0.7225 |
| 6. F | P59960 | Protein DipZ | 5.95e-04 | NA | NA | 0.6067 |
| 7. B | P0C5D5 | Peroxiredoxin Q, chloroplastic | 1.85e-14 | NA | 1.88e-11 | NA |
| 7. B | P20108 | Thioredoxin-dependent peroxide reductase, mitochondrial | 1.94e-11 | NA | 0.007 | NA |
| 7. B | Q58146 | Peroxiredoxin | 2.19e-12 | NA | 0.003 | NA |
| 7. B | O08807 | Peroxiredoxin-4 | 3.78e-11 | NA | 0.005 | NA |
| 7. B | Q6ER94 | 2-Cys peroxiredoxin BAS1, chloroplastic | 3.85e-11 | NA | 1.73e-06 | NA |
| 7. B | Q96291 | 2-Cys peroxiredoxin BAS1, chloroplastic | 6.59e-11 | NA | 8.84e-06 | NA |
| 7. B | P40553 | Peroxiredoxin DOT5 | 1.11e-16 | NA | 4.83e-05 | NA |
| 7. B | Q9LU86 | Peroxiredoxin Q, chloroplastic | 1.20e-14 | NA | 2.89e-09 | NA |
| 7. B | Q9C5R8 | 2-Cys peroxiredoxin BAS1-like, chloroplastic | 8.70e-11 | NA | 2.69e-06 | NA |
| 7. B | Q13162 | Peroxiredoxin-4 | 3.43e-11 | NA | 0.019 | NA |
| 7. B | Q9Z0V5 | Peroxiredoxin-4 | 3.97e-11 | NA | 0.005 | NA |
| 7. B | Q9Z0V6 | Thioredoxin-dependent peroxide reductase, mitochondrial | 2.63e-11 | NA | 0.004 | NA |
| 7. B | O94561 | Peroxiredoxin bcp1 | 5.55e-16 | NA | 3.22e-08 | NA |
| 7. B | P30048 | Thioredoxin-dependent peroxide reductase, mitochondrial | 2.81e-11 | NA | 0.005 | NA |