Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54599.1
JCVISYN3A_0060

Uncharacterized protein.
M. mycoides homolog: Q6MUG6.
TIGRfam Classification: 1=Unknown.
Category: Quasiessential.

Statistics

Total GO Annotation: 23
Unique PROST Go: 23
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 174
Unique PROST Homologs: 172
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Farnesyl diphosphate synthase
Antczak et al. [3]: Transmembrane protein, likely an anion transporter
Zhang et al. [4]: GO:0006418|tRNA aminoacylation for protein translation
Bianchi et al. [5]: Unclear

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q9CN97 (Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ) with a FATCAT P-Value: 1.11e-05 and RMSD of 3.09 angstrom. The sequence alignment identity is 22.7%.
Structural alignment shown in left. Query protein AVX54599.1 colored as red in alignment, homolog Q9CN97 colored as blue. Query protein AVX54599.1 is also shown in right top, homolog Q9CN97 showed in right bottom. They are colored based on secondary structures. 

  AVX54599.1 MKKYFCNLKTSISQNKKQYLIRLGCLLIGLYLFSLS-IALY-VPTAVGAS------H-VDFTNFSILALFKDWAKVNEKTVEGLVAATNYKL---ALMSL 88
      Q9CN97 ----------MLSLFR--IIIHVCCL--G-PVAWLAWVLLSGDESQLGADPIKEIQHFLGFSALTILLIMFILGKVFY-----LLKQPQLQVLRRAL-GL 79

  AVX54599.1 YG-FLLLVSV-VFLVLSIIREYKVTKDKKLWLQLIPLIVLDVIINVGLSYVIDGQIEMLKVIGYLDWMFNQSTAYQFRTIFFTIAFVLYI-AGLTFW--I 183
      Q9CN97 WAWFYVVLHVYAYLALEL--GY----DFSLFVQ-------E-LVNRG--YLIIGAIAFL--I--LTLMALSSWSY------------LKLKMG-KWWFYL 146

  AVX54599.1 HS-GW---LLGS--YN-SINTNFMRLTKLPFNVSRVLMDVLIIVPGVIMLLVNPISWDIKAKFLLNYVNIGTIGFLFL--AG----PMLGKTLGLLNKIT 270
      Q9CN97 HQLGYYALLLGAIHYVWSVK-N---VT---F--SSMLY--LIL---SIMIL-----CD--A--L--Y---G----LFIKRKGRSTSAHTGKD-------- 206

  AVX54599.1 KIYQ 274
      Q9CN97 ---- 206

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
5. P GO:0031969 chloroplast membrane
5. P GO:0009372 quorum sensing
5. P GO:0030091 protein repair
5. P GO:0016653 oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor
5. P GO:0005887 integral component of plasma membrane
5. P GO:0016021 integral component of membrane
5. P GO:0005886 plasma membrane
5. P GO:0015116 sulfate transmembrane transporter activity
5. P GO:0019344 cysteine biosynthetic process
5. P GO:0009055 electron transfer activity
5. P GO:0007602 phototransduction
5. P GO:0006276 plasmid maintenance
5. P GO:0046872 metal ion binding
5. P GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors
5. P GO:0020037 heme binding
5. P GO:0018298 protein-chromophore linkage
5. P GO:0009881 photoreceptor activity
5. P GO:0006784 heme A biosynthetic process
5. P GO:0005216 ion channel activity
5. P GO:0010181 FMN binding
5. P GO:0005215 transporter activity
5. P GO:0009675 high-affinity sulfate:proton symporter activity
5. P GO:0000103 sulfate assimilation

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
5. P Q92QE8 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.46e-04 3.49e-02 NA NA
5. P Q1RAH0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.39e-05 4.02e-02 NA NA
5. P A6TES0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.75e-05 4.69e-02 NA NA
5. P Q8ZEH4 UPF0259 membrane protein YPO2199/y2042/YP_1997 4.01e-05 1.00e-04 NA NA
5. P B2K3V8 UPF0259 membrane protein YPTS_2193 3.01e-05 1.00e-04 NA NA
5. P B6I9W9 UPF0259 membrane protein YciC 4.43e-05 1.37e-03 NA NA
5. P A7ZZJ1 UPF0259 membrane protein YciC 4.36e-05 1.37e-03 NA NA
5. P A9MWQ5 UPF0259 membrane protein YciC 4.15e-05 4.76e-04 NA NA
5. P Q1CJ34 UPF0259 membrane protein YPN_1667 2.96e-05 1.00e-04 NA NA
5. P B7ML08 UPF0259 membrane protein YciC 4.68e-05 1.07e-03 NA NA
5. P Q9A4T3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.30e-04 9.32e-06 NA NA
5. P Q8ZAX0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.55e-05 1.55e-02 NA NA
5. P Q5UXY6 Bacteriorhodopsin-I 2.08e-05 1.81e-02 NA NA
5. P Q8D2I9 UPF0259 membrane protein WIGBR3650 1.11e-04 7.43e-04 NA NA
5. P Q0TGM2 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 4.53e-05 1.95e-02 NA NA
5. P B4TJL6 UPF0259 membrane protein YciC 4.25e-05 4.76e-04 NA NA
5. P B1JKF9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.00e-04 1.55e-02 NA NA
5. P A1JQ02 UPF0259 membrane protein YE2218 1.20e-05 4.52e-02 NA NA
5. P P75603 Uncharacterized protein MPN_090 1.98e-04 3.57e-03 NA NA
5. P Q9UTP5 Meiotically up-regulated gene 162 protein 2.99e-05 7.18e-03 NA NA
5. P Q8ER78 Heme A synthase 6.85e-04 4.02e-02 NA NA
5. P O05249 Uncharacterized membrane protein YufK 1.30e-05 3.75e-02 NA NA
5. P A9MNV6 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.37e-04 1.91e-02 NA NA
5. P Q665E9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.24e-05 1.55e-02 NA NA
5. P D2BJS8 Sec-independent protein translocase protein TatC 5.88e-04 2.83e-02 NA NA
5. P P76343 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.11e-04 4.21e-02 NA NA
5. P B0RUW5 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.10e-05 1.46e-02 NA NA
5. P A4TJ73 UPF0259 membrane protein YPDSF_0935 3.04e-05 1.00e-04 NA NA
5. P A9MPE1 UPF0259 membrane protein YciC 4.91e-05 1.44e-03 NA NA
5. P A9MCR7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 5.09e-04 3.54e-03 NA NA
5. P Q322R9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.33e-05 1.66e-02 NA NA
5. P A8GK69 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.29e-04 4.64e-02 NA NA
5. P Q6D4T5 UPF0259 membrane protein ECA2305 1.66e-05 4.63e-03 NA NA
5. P Q7N475 UPF0259 membrane protein plu2479 1.66e-05 2.88e-04 NA NA
5. P A6WYN0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.69e-04 4.40e-02 NA NA
5. P B1X6C1 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.31e-05 4.21e-02 NA NA
5. P A7MMH2 UPF0259 membrane protein ESA_01554 1.84e-05 1.38e-03 NA NA
5. P Q87RJ6 Sulfate transporter CysZ 9.90e-04 4.36e-02 NA NA
5. P Q32GT9 UPF0259 membrane protein YciC 3.76e-05 2.70e-03 NA NA
5. P Q2RWU7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.47e-04 2.26e-03 NA NA
5. P B5R6L7 UPF0259 membrane protein YciC 2.13e-05 4.76e-04 NA NA
5. P C0Q399 UPF0259 membrane protein YciC 1.89e-05 5.06e-04 NA NA
5. P Q3BUZ5 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.68e-05 6.35e-03 NA NA
5. P Q9KTD3 Sulfate transporter CysZ 3.11e-04 3.36e-02 NA NA
5. P B7N468 UPF0259 membrane protein YciC 5.30e-05 1.07e-03 NA NA
5. P A8AQF0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.38e-05 2.09e-02 NA NA
5. P G8QM60 Probable anti-sigma-F factor NrsF 5.67e-04 9.35e-03 NA NA
5. P B5BIB3 UPF0259 membrane protein YciC 1.90e-05 4.76e-04 NA NA
5. P Q57685 Uncharacterized protein MJ0233 1.37e-05 2.40e-02 NA NA
5. P Q1RCH9 UPF0259 membrane protein YciC 3.74e-05 1.07e-03 NA NA
5. P B5R3N6 UPF0259 membrane protein YciC 1.76e-05 4.76e-04 NA NA
5. P C6DGZ0 UPF0259 membrane protein PC1_1998 1.56e-05 1.73e-02 NA NA
5. P Q7VSE8 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.36e-05 1.41e-03 NA NA
5. P Q8FV59 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.93e-04 3.54e-03 NA NA
5. P B5F4L6 UPF0259 membrane protein YciC 1.88e-05 4.76e-04 NA NA
5. P B7MU43 UPF0259 membrane protein YciC 3.77e-05 1.07e-03 NA NA
5. P O67008 Uncharacterized protein aq_836 1.24e-03 4.86e-03 NA NA
5. P P0DMH7 Halorhodopsin 5.77e-05 5.19e-03 NA NA
5. P Q2NT67 UPF0259 membrane protein SG1383 5.11e-05 3.18e-02 NA NA
5. P B1ITK0 UPF0259 membrane protein YciC 3.66e-05 1.37e-03 NA NA
5. P B5FU58 UPF0259 membrane protein YciC 1.90e-05 4.76e-04 NA NA
5. P A4WF68 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.01e-04 3.58e-02 NA NA
5. P Q83LC9 UPF0259 membrane protein YciC 3.72e-05 2.86e-03 NA NA
5. P B7NRB0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.26e-04 4.63e-03 NA NA
5. P B7MCM5 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.48e-05 4.02e-02 NA NA
5. P Q53496 Cruxrhodopsin-2 3.05e-05 2.03e-05 NA NA
5. P Q0T3F9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 6.18e-05 3.57e-03 NA NA
5. P Q9K9M8 Heme A synthase 5.96e-04 2.20e-03 NA NA
5. P Q3Z0Y3 UPF0259 membrane protein YciC 4.33e-05 1.37e-03 NA NA
5. P Q1C7P8 UPF0259 membrane protein YPA_1558 2.95e-05 1.00e-04 NA NA
5. P Q8XCB7 UPF0259 membrane protein YciC 4.32e-05 1.70e-03 NA NA
5. P A9WW03 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.97e-04 3.54e-03 NA NA
5. P B2TWL3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.42e-05 4.64e-02 NA NA
5. P A8AG56 UPF0259 membrane protein CKO_01332 2.04e-05 4.81e-03 NA NA
5. P A4G9Q2 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.46e-05 4.21e-03 NA NA
5. P Q9RRF5 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 9.58e-05 6.91e-03 NA NA
5. P O67662 Uncharacterized protein aq_1793 5.28e-05 3.16e-02 NA NA
5. P B1LH37 UPF0259 membrane protein YciC 3.30e-05 1.20e-03 NA NA
5. P Q5PD19 UPF0259 membrane protein YciC 2.07e-05 4.76e-04 NA NA
5. P Q8FHW3 UPF0259 membrane protein YciC 4.60e-05 8.82e-04 NA NA
5. P Q579K4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.85e-04 3.54e-03 NA NA
5. P B7LY11 UPF0259 membrane protein YciC 3.65e-05 1.37e-03 NA NA
5. P Q83KM2 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.21e-05 7.96e-03 NA NA
5. P Q8Z7E3 UPF0259 membrane protein YciC 2.76e-05 4.86e-04 NA NA
5. P A8A1H1 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.10e-04 4.64e-02 NA NA
5. P Q8YD73 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.85e-04 7.53e-03 NA NA
5. P B1XBK4 UPF0259 membrane protein YciC 4.80e-05 1.23e-03 NA NA
5. P Q9TLS5 Uncharacterized tatC-like protein ycf43 1.35e-04 1.17e-02 NA NA
5. P A5VVQ3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.92e-04 3.54e-03 NA NA
5. P B9EB26 Heme A synthase 3.60e-04 4.77e-02 NA NA
5. P Q04443 Heme A synthase 5.19e-04 1.56e-03 NA NA
5. P Q2YIK1 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.97e-04 3.54e-03 NA NA
5. P Q8XK42 Putative AgrB-like protein 2 1.36e-04 9.00e-03 NA NA
5. P Q8PA99 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.06e-05 1.42e-02 NA NA
5. P Q4UTC7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.06e-05 1.42e-02 NA NA
5. P B7MW36 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.05e-05 3.02e-02 NA NA
5. P Q3Z0L7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.16e-05 3.75e-02 NA NA
5. P B5XT15 UPF0259 membrane protein KPK_3195 4.08e-05 1.54e-03 NA NA
5. P A7FDQ9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 5.20e-05 6.85e-03 NA NA
5. P A1AAI0 UPF0259 membrane protein YciC 3.99e-05 1.07e-03 NA NA
5. P B7M3B0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 4.50e-05 4.64e-02 NA NA
5. P Q6D8S7 Sulfate transporter CysZ 1.03e-03 6.98e-03 NA NA
5. P Q57101 Cruxrhodopsin-1 1.67e-05 7.74e-03 NA NA
5. P B7USY2 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.19e-05 6.47e-03 NA NA
5. P P21365 UPF0259 membrane protein YciC 4.89e-05 1.23e-03 NA NA
5. P Q8ST97 UPF0328 protein ECU01_0070/ECU01_1540/ECU02_1570/ECU04_0080/ECU08_2100 2.10e-04 9.85e-04 NA NA
5. P B0R2U4 Halorhodopsin 5.72e-05 5.19e-03 NA NA
5. P A7MNR0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.25e-04 1.81e-02 NA NA
5. P B7UQE6 UPF0259 membrane protein YciC 4.41e-05 3.88e-04 NA NA
5. P B1JKS6 UPF0259 membrane protein YPK_2050 3.52e-05 1.00e-04 NA NA
5. P B4SUC3 UPF0259 membrane protein YciC 1.91e-05 4.76e-04 NA NA
5. P A1ACB7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.36e-05 4.02e-02 NA NA
5. P A6T7V8 UPF0259 membrane protein KPN78578_12180 3.90e-05 2.15e-03 NA NA
5. P O29398 Uncharacterized protein AF_0863 1.66e-05 1.94e-04 NA NA
5. P O28703 Uncharacterized protein AF_1569 3.76e-05 2.42e-02 NA NA
5. P Q57NS5 UPF0259 membrane protein YciC 1.88e-05 4.76e-04 NA NA
5. P B2SD40 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.87e-04 3.54e-03 NA NA
5. P C6DIK6 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.87e-05 4.99e-02 NA NA
5. P C0RMD3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.50e-04 7.53e-03 NA NA
5. P Q66AK9 UPF0259 membrane protein YPTB2121 2.94e-05 1.00e-04 NA NA
5. P Q31ZU9 UPF0259 membrane protein YciC 3.73e-05 2.86e-03 NA NA
5. P P75314 Uncharacterized protein MG323.1 homolog 1.33e-04 3.64e-03 NA NA
5. P B8D7H3 UPF0259 membrane protein BUAPTUC7_273 3.67e-05 3.30e-09 NA NA
5. P C4ZTU8 UPF0259 membrane protein YciC 4.69e-05 1.23e-03 NA NA
5. P Q2P352 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.10e-05 7.31e-03 NA NA
5. P Q32HK6 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.10e-04 4.21e-02 NA NA
5. P A7ZN93 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.33e-05 4.64e-02 NA NA
5. P A8GF86 UPF0259 membrane protein Spro_2675 4.96e-05 1.75e-03 NA NA
5. P B7LRM9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.42e-05 1.11e-02 NA NA
5. P P44056 Uncharacterized protein HI_0825 4.53e-06 6.02e-06 NA NA
5. P A4WB73 UPF0259 membrane protein Ent638_2284 4.98e-05 2.42e-03 NA NA
5. P P57364 UPF0259 membrane protein BU276 2.47e-05 4.22e-09 NA NA
5. P A4THC5 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.45e-05 1.55e-02 NA NA
5. P A9R9A1 UPF0259 membrane protein YpAngola_A2324 3.02e-05 1.00e-04 NA NA
5. P Q7WD13 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 7.01e-05 3.09e-03 NA NA
5. P B7NVM5 UPF0259 membrane protein YciC 3.81e-05 1.07e-03 NA NA
5. P P58769 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.31e-04 3.26e-04 NA NA
5. P O32241 Immunity protein SdpI 3.37e-05 5.75e-05 NA NA
5. P Q8ZP49 UPF0259 membrane protein YciC 2.09e-05 4.76e-04 NA NA
5. P Q89AL2 UPF0259 membrane protein bbp_256 1.47e-05 4.81e-02 NA NA
5. P Q9CN97 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.11e-05 9.98e-03 NA NA
5. P O94440 Uncharacterized protein C637.03 3.42e-04 2.01e-03 NA NA
5. P P0CS99 UPF0328 protein ECU09_2030 9.21e-05 4.28e-02 NA NA
5. P B7LHK1 UPF0259 membrane protein YciC 4.38e-05 1.37e-03 NA NA
5. P P42396 UPF0259 membrane protein BUsg_265 3.31e-05 1.33e-04 NA NA
5. P Q5H077 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.88e-05 7.31e-03 NA NA
5. P Q887V6 Sulfate transporter CysZ 1.03e-04 3.10e-02 NA NA
5. P B8D969 UPF0259 membrane protein BUAP5A_271 2.05e-05 6.79e-09 NA NA
5. P Q0SSQ8 Putative AgrB-like protein 1.69e-04 3.16e-02 NA NA
5. P P39139 Uncharacterized protein YxxB 5.13e-03 3.72e-04 NA NA
5. P Q8SV55 UPF0328 protein ECU07_0060 4.74e-05 2.63e-02 NA NA
5. P B2K460 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.00e-04 1.55e-02 NA NA
5. P A7FI39 UPF0259 membrane protein YpsIP31758_1942 3.72e-05 1.00e-04 NA NA
5. P A7ZL36 UPF0259 membrane protein YciC 3.93e-05 1.67e-03 NA NA
5. P C4ZQP2 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 8.20e-05 4.21e-02 NA NA
5. P Q0TIB5 UPF0259 membrane protein YciC 3.80e-05 1.07e-03 NA NA
5. P B7LS23 UPF0259 membrane protein YciC 1.27e-04 9.27e-04 NA NA
5. P Q7W5H7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 6.01e-05 3.09e-03 NA NA
5. P P18015 Copy number protein 7.04e-05 9.45e-07 NA NA
5. P B4TX47 UPF0259 membrane protein YciC 4.26e-05 1.91e-03 NA NA
5. P B1IZU0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.09e-04 4.64e-02 NA NA
5. P P94854 Cruxrhodopsin-3 2.01e-05 2.70e-02 NA NA
5. P Q8FGI6 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.35e-04 1.01e-02 NA NA
5. P Q1C1N6 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 3.06e-05 1.55e-02 NA NA
5. P Q1CDU3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.04e-04 1.55e-02 NA NA
5. P A9R1Y3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 9.95e-05 1.55e-02 NA NA
5. P B6I117 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.23e-05 4.64e-02 NA NA
5. P Q8PLY9 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 2.45e-05 2.04e-02 NA NA
5. P Q6DAJ0 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 9.09e-05 3.30e-02 NA NA
5. P Q0T5E1 UPF0259 membrane protein YciC 3.72e-05 2.86e-03 NA NA
5. P Q5V0R5 Bacteriorhodopsin-II 1.04e-04 1.38e-02 NA NA
5. P Q6B8S9 Uncharacterized tatC-like protein ycf43 2.13e-04 3.18e-02 NA NA
6. F P37505 Uncharacterized protein YyaS 3.33e-16 NA NA 0.7484
6. F O34927 Uncharacterized membrane protein YczE 1.82e-12 NA NA 0.6746