Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54609.1

JCVISYN3A_0081

tRNA uridine(34) 5-carboxymethylaminomethyl synthesis GTPase.
M. mycoides homolog: Q6MUE7.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 28
Unique PROST Go: 2
Unique BLAST Go: 4
Unique Foldseek Go: 0

Total Homologs: 2283
Unique PROST Homologs: 546
Unique BLAST Homologs: 492
Unique Foldseek Homologs: 1

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: trmE; tRNA modification GTPase
Zhang et al. [4]: GO:0002098|tRNA wobble uridine modification
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B0T6E0 (tRNA modification GTPase MnmE) with a FATCAT P-Value: 0 and RMSD of 3.08 angstrom. The sequence alignment identity is 30.1%.
Structural alignment shown in left. Query protein AVX54609.1 colored as red in alignment, homolog B0T6E0 colored as blue. Query protein AVX54609.1 is also shown in right top, homolog B0T6E0 showed in right bottom. They are colored based on secondary structures.

  AVX54609.1 MLINDTVVAPATNISTQAIALIRVSGSEAFLIVNKLIKDKKLEEKRGLFLRKLYFENELIDEVVLSCFVAPNSFTGENVVEIACHGG--ILNTNKIINIL 98
      B0T6E0 M--NDTIYAPATGAGAAAVAVVRISGARSADIVRGLAGD--LPKPRRAVLRQLTRDGVALDDALVLWFQGPASYTGEDAAEFHVHGGRAVVEA--VLEAL 94

  AVX54609.1 IQSGARMALRGEFSQRSFLNGKIDLIQAEGINNLIHAKNDLALKIGVANMSGS-NNKAIIELKDNLL-DIISRIQVSIDYPDYDDVEGSSIEDLTNL--- 193
      B0T6E0 AAEGLRLAEPGEFTRRAFENGKLDLTQAEGVADLIDAETEAQRRQALGQLGGALSQR--YEAWRGLLVQALAMLEAAVDFPD-EELP----EDVAARARP 187

  AVX54609.1 -LEVINDQINKLLMRSKMAFKNSEGIKTAIIGQTNVGKSSILNALINEDKAIVTDIPGTTRDIVEGQINLENV-SLNLIDTAGIRKTSDVVENLGILKSK 291
      B0T6E0 GLEALEAEIGAALVDASRGRRVRDGYRIALVGAPNAGKSTLLNALVERDAAIVTSTPGTTRDIIEVPLTLGGYKTL-LADTAGLRKTEDTIEAEGVRRAR 286

  AVX54609.1 NLINEADLVLFVVNKE--NINDSDNQEIFELLK--DKTYILIVNKAE-----KLSQ---T-EKQNLEKKYENIV---------FTSAIN-HDIDQL---- 364
      B0T6E0 AWAAGADLRLWVIDAAMFHVKQDD--EL-AVIQRGD--WAVI-NKIDLVDAGRLAELRATFSEQGL-KVVE-LAARKPGGAEPARAALSTHVIDALSGAE 378

  AVX54609.1 ---VLRINQMFLNEEISKNDELILIGLNQITLVEQIKNKLSTALSVIKSGMPIDIVNVDLYDAWNLLNELIG-VEYEDEIIDNIFRKYCLGK 452
      B0T6E0 FPAATRIR----HAE---------------SLTE-ARTYLQRALSDV--GLEVELVAEDVRLAARALSRITGRIDPED-VLDRVFSSFCIGK 447

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0043022	ribosome binding
1. PBF	GO:0000027	ribosomal large subunit assembly
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0030488	tRNA methylation
1. PBF	GO:0002098	tRNA wobble uridine modification
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0042254	ribosome biogenesis
1. PBF	GO:0006400	tRNA modification
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0019843	rRNA binding
1. PBF	GO:0005525	GTP binding
3. BF	GO:0000028	ribosomal small subunit assembly
3. BF	GO:0070181	small ribosomal subunit rRNA binding
3. BF	GO:0042274	ribosomal small subunit biogenesis
3. BF	GO:0043024	ribosomal small subunit binding
4. PB	GO:0070899	mitochondrial tRNA wobble uridine modification
4. PB	GO:0005886	plasma membrane
4. PB	GO:0005634	nucleus
4. PB	GO:0009507	chloroplast
4. PB	GO:0097216	guanosine tetraphosphate binding
4. PB	GO:0000287	magnesium ion binding
5. P	GO:0005524	ATP binding
5. P	GO:0005829	cytosol
7. B	GO:0005654	nucleoplasm
7. B	GO:0000917	division septum assembly
7. B	GO:0042644	chloroplast nucleoid
7. B	GO:0016021	integral component of membrane

Uniprot GO Annotations

GO	Description
GO:0008033	tRNA processing
GO:0003924	GTPase activity
GO:0005737	cytoplasm
GO:0006400	tRNA modification
GO:0046872	metal ion binding
GO:0016787	hydrolase activity
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	A6Q4R8	GTPase Der	9.75e-04	9.55e-05	1.88e-12	0.6785
1. PBF	Q8DDI1	tRNA modification GTPase MnmE	0.00e+00	6.76e-63	5.95e-61	0.7311
1. PBF	Q98RC1	GTPase Der	3.45e-04	3.82e-05	1.72e-13	0.6298
1. PBF	C5D3F4	GTPase Der	6.94e-04	5.32e-05	7.32e-16	0.7117
1. PBF	Q8CX13	tRNA modification GTPase MnmE	0.00e+00	5.03e-74	5.79e-103	0.8316
1. PBF	Q11CN2	tRNA modification GTPase MnmE	0.00e+00	7.24e-50	7.90e-54	0.7656
1. PBF	A0KUJ9	GTPase Der	1.64e-04	2.97e-02	4.61e-13	0.397
1. PBF	A8Z5X0	tRNA modification GTPase MnmE	0.00e+00	2.42e-61	2.24e-57	0.7801
1. PBF	B1KX71	GTPase Der	2.96e-03	8.40e-05	1.68e-15	0.5766
1. PBF	Q5WSF0	tRNA modification GTPase MnmE	0.00e+00	1.41e-68	4.58e-64	0.7552
1. PBF	B5Z0Y0	GTPase Der	4.29e-03	3.05e-02	4.58e-17	0.3055
1. PBF	A0LJ92	GTPase Der	7.61e-03	2.84e-04	1.20e-11	0.5235
1. PBF	Q07VS7	tRNA modification GTPase MnmE	2.14e-13	1.81e-63	3.41e-55	0.7516
1. PBF	B3CR58	GTPase Der	1.89e-04	3.94e-05	3.76e-07	0.5113
1. PBF	B7UGV7	GTPase Der	5.73e-04	3.52e-02	4.18e-17	0.345
1. PBF	P43730	tRNA modification GTPase MnmE	3.57e-12	1.09e-65	1.00e-55	0.7448
1. PBF	A1VZU7	tRNA modification GTPase MnmE	0.00e+00	6.01e-68	1.14e-68	0.8542
1. PBF	Q7VM29	GTPase Der	3.55e-04	7.17e-05	1.05e-14	0.5069
1. PBF	Q8EC36	GTPase Der	3.27e-04	2.08e-02	6.56e-13	0.48
1. PBF	P0C8P1	tRNA modification GTPase MnmE	5.00e-15	2.86e-73	2.97e-80	0.7798
1. PBF	B0UJI9	tRNA modification GTPase MnmE	3.73e-13	3.99e-54	8.76e-53	0.7642
1. PBF	A5I816	tRNA modification GTPase MnmE	0.00e+00	1.82e-81	2.17e-100	0.8354
1. PBF	Q8D3I9	tRNA modification GTPase MnmE	0.00e+00	1.77e-66	1.11e-49	0.7828
1. PBF	Q5M4H3	tRNA modification GTPase MnmE	0.00e+00	6.76e-75	1.80e-105	0.8311
1. PBF	Q2SR47	tRNA modification GTPase MnmE	0.00e+00	7.24e-106	0.0	0.9954
1. PBF	B1L9N6	tRNA modification GTPase MnmE	0.00e+00	6.24e-63	1.22e-94	0.8068
1. PBF	A1AXX6	tRNA modification GTPase MnmE	1.11e-16	1.57e-42	1.57e-45	0.7717
1. PBF	Q8P161	tRNA modification GTPase MnmE	0.00e+00	3.81e-72	1.79e-105	0.8276
1. PBF	Q834T4	GTPase Der	6.52e-04	2.96e-06	1.41e-13	0.5835
1. PBF	A5CFM7	tRNA modification GTPase MnmE	0.00e+00	4.94e-64	9.94e-55	0.8254
1. PBF	A1UQU6	tRNA modification GTPase MnmE	4.65e-13	2.66e-52	7.85e-44	0.7419
1. PBF	P53364	tRNA modification GTPase MnmE	3.62e-14	8.31e-73	6.13e-63	0.7879
1. PBF	A5N7W7	GTPase Der	1.03e-02	4.14e-05	6.56e-15	0.73
1. PBF	Q2GC37	tRNA modification GTPase MnmE	2.22e-16	1.55e-46	6.53e-40	0.764
1. PBF	A7NCL5	tRNA modification GTPase MnmE	5.85e-12	8.03e-66	2.28e-55	0.7004
1. PBF	Q8XH30	tRNA modification GTPase MnmE	0.00e+00	8.27e-77	3.35e-92	0.8422
1. PBF	Q601N0	tRNA modification GTPase MnmE	0.00e+00	3.12e-62	1.50e-77	0.8356
1. PBF	A8EZV9	tRNA modification GTPase MnmE	0.00e+00	1.41e-59	8.26e-49	0.8462
1. PBF	Q8P340	tRNA modification GTPase MnmE	0.00e+00	4.53e-62	1.76e-56	0.8496
1. PBF	A9IZY1	tRNA modification GTPase MnmE	0.00e+00	7.93e-58	1.44e-49	0.7658
1. PBF	A1TM31	GTPase Der	6.96e-04	1.10e-04	2.06e-13	0.6632
1. PBF	A3QJT0	tRNA modification GTPase MnmE	3.94e-14	2.34e-65	1.02e-54	0.7492
1. PBF	B1IX32	tRNA modification GTPase MnmE	9.81e-14	1.50e-61	8.81e-58	0.7217
1. PBF	Q8FBV3	tRNA modification GTPase MnmE	3.17e-13	1.40e-62	3.10e-57	0.726
1. PBF	A4SGR9	tRNA modification GTPase MnmE	0.00e+00	8.16e-68	3.21e-64	0.7979
1. PBF	B5Z7J9	GTPase Der	1.15e-03	5.06e-05	4.48e-10	0.3105
1. PBF	P57132	tRNA modification GTPase MnmE	0.00e+00	1.86e-68	2.12e-50	0.7811
1. PBF	B4SYB2	tRNA modification GTPase MnmE	1.88e-13	8.03e-64	2.52e-55	0.7578
1. PBF	B3PS53	tRNA modification GTPase MnmE	0.00e+00	2.99e-49	2.65e-45	0.7994
1. PBF	C3P591	GTPase Der	8.21e-04	6.33e-06	2.94e-13	0.6202
1. PBF	A1BCU6	tRNA modification GTPase MnmE	0.00e+00	1.91e-64	2.97e-65	0.7781
1. PBF	Q3YT72	tRNA modification GTPase MnmE	2.22e-16	3.56e-58	7.62e-58	0.7804
1. PBF	B1YGA8	tRNA modification GTPase MnmE	0.00e+00	4.31e-76	4.05e-94	0.8454
1. PBF	Q0BND2	GTPase Der	3.77e-03	1.72e-03	1.64e-14	0.6288
1. PBF	A4XN51	tRNA modification GTPase MnmE	0.00e+00	5.84e-75	1.70e-82	0.8291
1. PBF	Q1G7Z4	tRNA modification GTPase MnmE	0.00e+00	2.19e-76	2.32e-103	0.8595
1. PBF	Q72D51	tRNA modification GTPase MnmE	0.00e+00	4.99e-69	1.38e-60	0.7789
1. PBF	Q3SF39	tRNA modification GTPase MnmE	1.07e-10	1.35e-61	4.24e-56	0.7298
1. PBF	Q7MVZ2	tRNA modification GTPase MnmE	0.00e+00	3.18e-69	4.02e-76	0.8448
1. PBF	A3N2D8	tRNA modification GTPase MnmE	3.77e-14	7.60e-66	1.01e-52	0.7416
1. PBF	B2IRW4	GTPase Der	9.68e-04	5.13e-06	1.28e-16	0.6126
1. PBF	B1ZWP5	tRNA modification GTPase MnmE	0.00e+00	6.36e-67	4.65e-66	0.8805
1. PBF	Q28VZ6	tRNA modification GTPase MnmE	0.00e+00	5.32e-49	5.54e-41	0.7881
1. PBF	A7Z636	GTPase Der	6.59e-04	4.49e-05	7.95e-13	0.5331
1. PBF	Q8FF59	GTPase Der	6.57e-04	3.10e-02	4.30e-17	0.4409
1. PBF	B1JRQ1	tRNA modification GTPase MnmE	1.01e-13	6.47e-64	1.75e-56	0.725
1. PBF	Q4L2Z2	tRNA modification GTPase MnmE	0.00e+00	1.08e-74	9.27e-107	0.8283
1. PBF	Q0SNY5	tRNA modification GTPase MnmE	0.00e+00	1.21e-72	4.97e-64	0.7949
1. PBF	Q1LTV8	tRNA modification GTPase MnmE	4.48e-12	1.37e-68	1.23e-49	0.714
1. PBF	Q8PEH9	tRNA modification GTPase MnmE	1.11e-14	3.33e-61	2.73e-49	0.7791
1. PBF	C0QXH9	tRNA modification GTPase MnmE	0.00e+00	3.01e-67	9.46e-58	0.8251
1. PBF	A0RLR2	tRNA modification GTPase MnmE	0.00e+00	1.57e-74	3.59e-110	0.8365
1. PBF	A4Y199	tRNA modification GTPase MnmE	6.12e-14	2.33e-66	2.27e-57	0.7363
1. PBF	B1LL33	tRNA modification GTPase MnmE	2.15e-13	3.38e-62	1.12e-57	0.723
1. PBF	B0CJG2	tRNA modification GTPase MnmE	1.11e-16	2.51e-45	9.89e-51	0.7418
1. PBF	Q7VSR5	tRNA modification GTPase MnmE	9.05e-13	2.50e-63	3.39e-54	0.7297
1. PBF	A5UY19	tRNA modification GTPase MnmE	0.00e+00	4.07e-62	4.44e-67	0.81
1. PBF	Q8Z9U2	tRNA modification GTPase MnmE	1.91e-13	1.42e-64	2.16e-56	0.7239
1. PBF	Q8EQA8	GTPase Der	5.72e-04	4.14e-05	5.72e-16	0.6027
1. PBF	B1AJ22	GTPase Der	8.97e-03	1.16e-05	1.55e-11	0.6647
1. PBF	Q21CM0	tRNA modification GTPase MnmE	5.81e-12	4.59e-55	4.11e-51	0.7297
1. PBF	B1IHR9	tRNA modification GTPase MnmE	0.00e+00	1.82e-81	2.17e-100	0.8354
1. PBF	Q9HT07	tRNA modification GTPase MnmE	1.92e-13	2.27e-66	1.24e-56	0.7441
1. PBF	Q0HKV5	GTPase Der	1.58e-04	2.97e-02	4.61e-13	0.3773
1. PBF	Q6MFA3	tRNA modification GTPase MnmE	0.00e+00	5.81e-64	6.00e-66	0.7895
1. PBF	P47254	tRNA modification GTPase MnmE	0.00e+00	8.19e-55	9.88e-73	0.8021
1. PBF	B7J1B2	tRNA modification GTPase MnmE	3.53e-14	8.31e-73	6.13e-63	0.7855
1. PBF	Q2JSU8	tRNA modification GTPase MnmE	0.00e+00	2.58e-70	7.44e-77	0.8009
1. PBF	Q02VP7	tRNA modification GTPase MnmE	0.00e+00	4.58e-77	2.45e-102	0.8408
1. PBF	Q1GXL7	tRNA modification GTPase MnmE	0.00e+00	1.09e-65	5.87e-49	0.7691
1. PBF	P0A175	tRNA modification GTPase MnmE	6.58e-13	2.62e-67	6.16e-55	0.7374
1. PBF	Q5FHQ5	tRNA modification GTPase MnmE	0.00e+00	5.29e-76	6.14e-93	0.8437
1. PBF	P97043	tRNA modification GTPase MnmE	0.00e+00	6.73e-67	2.38e-60	0.783
1. PBF	Q2W7M7	GTPase Der	3.51e-04	1.79e-04	2.78e-10	0.7795
1. PBF	B6JM65	GTPase Der	9.87e-04	6.00e-05	4.79e-10	0.3259
1. PBF	B1AI04	tRNA modification GTPase MnmE	0.00e+00	7.93e-62	4.09e-104	0.8881
1. PBF	Q1J154	tRNA modification GTPase MnmE	0.00e+00	8.57e-58	5.83e-58	0.817
1. PBF	Q8CMN5	tRNA modification GTPase MnmE	0.00e+00	1.89e-76	6.99e-106	0.8395
1. PBF	P73839	tRNA modification GTPase MnmE	0.00e+00	5.71e-73	4.94e-79	0.7913
1. PBF	Q0I0Z2	tRNA modification GTPase MnmE	1.35e-11	1.08e-66	2.41e-58	0.7272
1. PBF	A5G169	tRNA modification GTPase MnmE	0.00e+00	2.91e-55	3.78e-48	0.8036
1. PBF	Q7U344	tRNA modification GTPase MnmE	6.87e-13	5.45e-63	9.11e-55	0.7149
1. PBF	Q2JIE6	tRNA modification GTPase MnmE	0.00e+00	1.69e-71	5.36e-79	0.7989
1. PBF	Q1QS99	tRNA modification GTPase MnmE	0.00e+00	7.94e-67	1.15e-58	0.7734
1. PBF	A7FW89	GTPase Der	9.21e-04	1.11e-04	1.02e-15	0.5281
1. PBF	O84709	GTPase Der	1.53e-03	1.66e-08	2.62e-13	0.4769
1. PBF	B5BIL9	tRNA modification GTPase MnmE	3.38e-13	5.45e-63	3.28e-55	0.7206
1. PBF	Q92UK6	GTPase Der	2.05e-03	4.69e-03	1.93e-14	0.7444
1. PBF	B9L7G9	GTPase Der	3.87e-03	3.78e-05	1.06e-15	0.5471
1. PBF	B0BR82	tRNA modification GTPase MnmE	0.00e+00	7.60e-66	4.87e-53	0.7371
1. PBF	B7NF24	tRNA modification GTPase MnmE	1.14e-13	1.21e-61	2.77e-56	0.7232
1. PBF	A3NPX5	tRNA modification GTPase MnmE	1.11e-16	5.17e-62	1.05e-47	0.7606
1. PBF	A1RQE8	tRNA modification GTPase MnmE	0.00e+00	1.54e-66	6.61e-61	0.7805
1. PBF	Q88RX5	tRNA modification GTPase MnmE	0.00e+00	5.65e-74	1.11e-107	0.828
1. PBF	A4GAN2	tRNA modification GTPase MnmE	2.42e-12	5.18e-66	8.04e-49	0.7265
1. PBF	Q6LW56	tRNA modification GTPase MnmE	1.59e-13	9.71e-64	7.33e-59	0.7484
1. PBF	Q07UP2	tRNA modification GTPase MnmE	1.39e-11	3.72e-57	3.24e-47	0.706
1. PBF	Q0ATU5	tRNA modification GTPase MnmE	0.00e+00	3.77e-75	5.47e-85	0.8373
1. PBF	Q4FPR8	tRNA modification GTPase MnmE	0.00e+00	1.07e-62	1.53e-58	0.7854
1. PBF	Q5GTT5	tRNA modification GTPase MnmE	0.00e+00	3.86e-62	8.01e-50	0.8009
1. PBF	Q3IYH3	tRNA modification GTPase MnmE	0.00e+00	8.96e-53	2.83e-46	0.7836
1. PBF	B1I766	GTPase Der	1.12e-03	5.13e-06	1.28e-16	0.5737
1. PBF	Q16CZ5	tRNA modification GTPase MnmE	0.00e+00	1.31e-51	2.36e-51	0.7949
1. PBF	C3LT16	GTPase Der	1.69e-03	2.01e-03	1.04e-16	0.5706
1. PBF	A5N451	tRNA modification GTPase MnmE	0.00e+00	1.10e-77	1.56e-92	0.8503
1. PBF	Q8CX54	tRNA modification GTPase MnmE	0.00e+00	3.07e-74	1.79e-112	0.8551
1. PBF	A4WVZ0	tRNA modification GTPase MnmE	0.00e+00	8.17e-50	2.70e-49	0.7972
1. PBF	B7N211	tRNA modification GTPase MnmE	6.74e-14	3.38e-62	1.12e-57	0.7192
1. PBF	B2IJQ3	tRNA modification GTPase MnmE	0.00e+00	6.24e-43	1.01e-53	0.7298
1. PBF	A8ZU05	GTPase Der	4.27e-04	3.76e-02	1.26e-13	0.6793
1. PBF	Q814F6	tRNA modification GTPase MnmE	0.00e+00	1.02e-74	4.41e-108	0.8444
1. PBF	Q8R6K8	tRNA modification GTPase MnmE	0.00e+00	1.26e-69	1.01e-84	0.8426
1. PBF	Q058F5	tRNA modification GTPase MnmE	0.00e+00	1.51e-65	1.67e-49	0.7827
1. PBF	C5BES7	GTPase Der	1.08e-02	9.10e-03	4.32e-16	0.4008
1. PBF	B5YXB0	tRNA modification GTPase MnmE	7.95e-14	1.28e-61	8.44e-58	0.72
1. PBF	Q2RFI8	tRNA modification GTPase MnmE	0.00e+00	6.15e-77	2.82e-95	0.8732
1. PBF	B2SUV8	tRNA modification GTPase MnmE	0.00e+00	8.82e-62	2.30e-50	0.7939
1. PBF	B5RL05	tRNA modification GTPase MnmE	1.12e-14	1.72e-74	2.18e-67	0.7748
1. PBF	Q2FGW7	GTPase Der	6.37e-04	1.31e-04	6.43e-14	0.5889
1. PBF	Q9ZCI1	tRNA modification GTPase MnmE	0.00e+00	3.75e-55	4.68e-53	0.8427
1. PBF	Q662I5	tRNA modification GTPase MnmE	1.02e-14	3.03e-72	3.73e-59	0.7896
1. PBF	Q3JXI0	tRNA modification GTPase MnmE	0.00e+00	3.66e-62	8.85e-45	0.7692
1. PBF	Q4UK70	tRNA modification GTPase MnmE	0.00e+00	6.11e-46	1.24e-50	0.8273
1. PBF	A3MS17	tRNA modification GTPase MnmE	1.11e-16	5.17e-62	1.05e-47	0.7571
1. PBF	A8YTQ7	tRNA modification GTPase MnmE	0.00e+00	1.18e-74	5.39e-95	0.854
1. PBF	B3QLF4	GTPase Der	1.94e-03	1.68e-06	6.44e-15	0.7148
1. PBF	A5GJ79	GTPase Der	1.72e-03	2.81e-03	1.36e-16	0.4415
1. PBF	C1CSX0	GTPase Der	4.02e-03	5.13e-06	1.28e-16	0.5775
1. PBF	A8EV95	tRNA modification GTPase MnmE	0.00e+00	7.84e-71	1.33e-75	0.8763
1. PBF	A6M3M5	tRNA modification GTPase MnmE	0.00e+00	4.49e-75	1.07e-89	0.8293
1. PBF	Q5PNI6	GTPase Der	6.03e-04	2.53e-02	4.00e-17	0.3022
1. PBF	B7M7L5	GTPase Der	8.90e-04	3.05e-02	4.58e-17	0.3036
1. PBF	A6TXE5	tRNA modification GTPase MnmE	0.00e+00	1.72e-74	1.23e-95	0.8409
1. PBF	Q74JL6	GTPase Der	2.53e-03	2.39e-06	1.04e-11	0.6239
1. PBF	Q5LZW3	tRNA modification GTPase MnmE	0.00e+00	3.66e-75	1.42e-105	0.8387
1. PBF	A5IIK3	tRNA modification GTPase MnmE	0.00e+00	1.49e-68	3.84e-63	0.7568
1. PBF	A1U7J3	tRNA modification GTPase MnmE	6.73e-12	9.21e-66	2.23e-61	0.7332
1. PBF	Q820T0	tRNA modification GTPase MnmE	0.00e+00	9.79e-72	2.16e-103	0.8364
1. PBF	B9KRT2	GTPase Der	3.38e-04	2.84e-03	3.05e-11	0.5906
1. PBF	Q7VDI8	GTPase Der	2.20e-03	4.18e-03	8.84e-15	0.414
1. PBF	B0B8S4	tRNA modification GTPase MnmE	0.00e+00	3.46e-67	1.80e-74	0.8016
1. PBF	B4RRB9	tRNA modification GTPase MnmE	6.49e-12	1.91e-68	5.42e-59	0.7362
1. PBF	B0TAB6	tRNA modification GTPase MnmE	0.00e+00	7.38e-69	3.46e-78	0.8566
1. PBF	A8GPN6	tRNA modification GTPase MnmE	0.00e+00	1.48e-59	9.80e-55	0.8418
1. PBF	Q3ANQ3	tRNA modification GTPase MnmE	0.00e+00	7.40e-66	7.96e-65	0.8045
1. PBF	Q8RHA2	tRNA modification GTPase MnmE	0.00e+00	4.97e-79	6.83e-89	0.7943
1. PBF	Q63DM8	GTPase Der	5.50e-04	6.33e-06	2.94e-13	0.5963
1. PBF	Q9RVL1	tRNA modification GTPase MnmE	0.00e+00	5.67e-58	5.78e-66	0.8142
1. PBF	Q83PL3	tRNA modification GTPase MnmE	1.07e-13	1.76e-61	2.39e-57	0.7234
1. PBF	Q6GD92	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	0.8443
1. PBF	A1AHP0	tRNA modification GTPase MnmE	1.55e-13	1.40e-62	3.10e-57	0.7246
1. PBF	Q1MA18	tRNA modification GTPase MnmE	0.00e+00	2.42e-51	3.58e-47	0.8008
1. PBF	Q5L8K8	GTPase Der	9.15e-04	7.40e-06	4.42e-15	0.7253
1. PBF	Q72WU3	tRNA modification GTPase MnmE	0.00e+00	1.93e-74	2.68e-109	0.8368
1. PBF	Q02DE1	tRNA modification GTPase MnmE	7.84e-14	1.58e-66	6.18e-58	0.7395
1. PBF	Q3KKZ6	tRNA modification GTPase MnmE	0.00e+00	4.44e-67	2.00e-74	0.7887
1. PBF	B9E1C8	GTPase Der	6.36e-04	4.14e-05	6.56e-15	0.7275
1. PBF	Q8Y5W8	GTPase Der	3.29e-03	2.80e-06	1.93e-19	0.5731
1. PBF	Q30T75	tRNA modification GTPase MnmE	0.00e+00	3.45e-63	1.20e-77	0.8682
1. PBF	B2V5W6	GTPase Der	4.02e-03	1.61e-04	1.02e-16	0.5845
1. PBF	A5UD71	tRNA modification GTPase MnmE	1.92e-12	1.34e-66	4.43e-56	0.7361
1. PBF	B8GW34	tRNA modification GTPase MnmE	0.00e+00	2.75e-58	2.11e-57	0.7845
1. PBF	Q5FF19	tRNA modification GTPase MnmE	1.11e-16	5.05e-56	2.19e-57	0.7739
1. PBF	B4RV85	GTPase Der	3.93e-04	1.39e-02	2.08e-16	0.6445
1. PBF	A8FM10	tRNA modification GTPase MnmE	0.00e+00	3.44e-68	3.02e-68	0.8544
1. PBF	C4LC41	GTPase Der	2.50e-04	8.29e-04	1.42e-16	0.739
1. PBF	Q8Y3H5	tRNA modification GTPase MnmE	1.58e-12	2.55e-60	3.18e-49	0.7367
1. PBF	Q81SW9	GTPase Der	8.12e-04	6.33e-06	2.94e-13	0.6059
1. PBF	Q5FS11	tRNA modification GTPase MnmE	0.00e+00	1.74e-47	1.74e-45	0.7631
1. PBF	Q8ZCT9	GTPase Der	6.48e-04	2.58e-02	1.93e-14	0.5935
1. PBF	B0BAF3	tRNA modification GTPase MnmE	0.00e+00	3.46e-67	1.80e-74	0.7948
1. PBF	B0K5N4	tRNA modification GTPase MnmE	0.00e+00	1.31e-73	4.71e-89	0.8404
1. PBF	B0JVV0	tRNA modification GTPase MnmE	0.00e+00	1.38e-71	1.44e-85	0.7887
1. PBF	Q7UJI3	tRNA modification GTPase MnmE	7.42e-14	3.95e-58	7.38e-32	0.5782
1. PBF	B9DTQ3	GTPase Der	9.83e-04	1.95e-05	2.88e-14	0.5725
1. PBF	A4YCM1	tRNA modification GTPase MnmE	5.90e-14	1.05e-66	7.58e-61	0.7467
1. PBF	A8FJG0	tRNA modification GTPase MnmE	0.00e+00	7.38e-75	1.91e-106	0.8286
1. PBF	A1WSU0	tRNA modification GTPase MnmE	1.18e-12	2.60e-54	1.09e-49	0.7553
1. PBF	A9M9E5	tRNA modification GTPase MnmE	1.11e-16	9.13e-44	5.95e-52	0.7453
1. PBF	Q65CN1	tRNA modification GTPase MnmE	0.00e+00	6.69e-76	2.73e-105	0.8277
1. PBF	A5VT20	tRNA modification GTPase MnmE	1.11e-16	7.93e-45	4.68e-52	0.741
1. PBF	A4XY28	GTPase Der	7.73e-04	2.76e-02	2.59e-15	0.5794
1. PBF	P57812	GTPase Der	3.01e-04	2.30e-05	2.09e-15	0.3232
1. PBF	Q6HL51	GTPase Der	7.83e-04	6.33e-06	2.94e-13	0.6051
1. PBF	A9KLK7	GTPase Der	1.01e-03	4.72e-05	5.88e-11	0.7164
1. PBF	Q2STM2	tRNA modification GTPase MnmE	0.00e+00	1.98e-62	4.54e-47	0.7667
1. PBF	Q7M901	tRNA modification GTPase MnmE	0.00e+00	1.35e-65	4.94e-75	0.8528
1. PBF	Q9EWW8	GTPase Der	2.61e-03	1.72e-03	8.21e-10	0.7253
1. PBF	A7ZPV4	GTPase Der	3.84e-04	3.05e-02	4.58e-17	0.2923
1. PBF	Q68VZ0	tRNA modification GTPase MnmE	0.00e+00	1.26e-54	9.72e-53	0.8412
1. PBF	Q4FNR7	tRNA modification GTPase MnmE	1.62e-13	5.92e-60	4.11e-57	0.7365
1. PBF	A0M2N6	tRNA modification GTPase MnmE	0.00e+00	2.92e-69	3.68e-75	0.8331
1. PBF	Q181S7	tRNA modification GTPase MnmE	0.00e+00	1.78e-76	2.89e-97	0.8351
1. PBF	A8G2J5	tRNA modification GTPase MnmE	0.00e+00	8.00e-70	1.05e-75	0.8033
1. PBF	A6LMN4	tRNA modification GTPase MnmE	0.00e+00	1.14e-66	2.56e-90	0.8424
1. PBF	Q9KVY5	tRNA modification GTPase MnmE	2.32e-13	3.27e-63	1.79e-61	0.7427
1. PBF	Q931E1	tRNA modification GTPase MnmE	0.00e+00	1.33e-76	3.50e-98	0.8437
1. PBF	A5I4V0	GTPase Der	9.31e-04	1.11e-04	1.02e-15	0.6465
1. PBF	B5XZP4	tRNA modification GTPase MnmE	2.06e-13	2.64e-63	7.64e-57	0.7262
1. PBF	B5FAX6	GTPase Der	4.55e-04	1.01e-04	1.54e-15	0.6116
1. PBF	A8F732	tRNA modification GTPase MnmE	0.00e+00	1.46e-70	5.00e-90	0.763
1. PBF	Q4QLQ9	tRNA modification GTPase MnmE	3.51e-12	1.31e-66	3.41e-56	0.7349
1. PBF	Q746Q3	tRNA modification GTPase MnmE	0.00e+00	2.33e-68	4.25e-76	0.8223
1. PBF	A8A6G8	tRNA modification GTPase MnmE	2.13e-13	1.72e-61	5.02e-57	0.723
1. PBF	A1KW66	tRNA modification GTPase MnmE	2.68e-12	2.55e-67	1.22e-59	0.7264
1. PBF	B1KQ64	tRNA modification GTPase MnmE	1.10e-12	2.33e-66	2.50e-52	0.751
1. PBF	Q10VJ7	tRNA modification GTPase MnmE	0.00e+00	8.26e-69	2.21e-76	0.7988
1. PBF	Q7M7W8	GTPase Der	1.81e-03	3.62e-03	1.42e-11	0.6188
1. PBF	Q5NFF3	tRNA modification GTPase MnmE	3.57e-12	7.40e-66	8.27e-56	0.7017
1. PBF	A7GN41	GTPase Der	4.92e-04	1.41e-05	2.07e-13	0.5705
1. PBF	B5RQZ8	tRNA modification GTPase MnmE	2.05e-14	6.92e-74	6.06e-66	0.7706
1. PBF	B1X9T5	tRNA modification GTPase MnmE	2.97e-13	1.50e-61	8.81e-58	0.7229
1. PBF	A4STS4	tRNA modification GTPase MnmE	0.00e+00	1.59e-67	7.12e-58	0.7659
1. PBF	Q49UI4	tRNA modification GTPase MnmE	0.00e+00	6.76e-75	9.41e-101	0.8472
1. PBF	B7MYE6	GTPase Der	8.22e-04	2.90e-02	4.22e-17	0.4412
1. PBF	Q2NX54	tRNA modification GTPase MnmE	0.00e+00	4.91e-62	1.19e-49	0.7924
1. PBF	Q5QZJ5	tRNA modification GTPase MnmE	5.47e-13	1.68e-65	9.68e-63	0.7456
1. PBF	A8EZN9	GTPase Der	4.62e-04	8.92e-05	3.63e-10	0.5153
1. PBF	A8FKH3	GTPase Der	1.70e-03	1.84e-04	1.74e-11	0.6176
1. PBF	Q0BW92	tRNA modification GTPase MnmE	0.00e+00	4.37e-53	1.52e-47	0.7949
1. PBF	A6U595	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	0.8373
1. PBF	Q21DG1	tRNA modification GTPase MnmE	0.00e+00	3.16e-61	2.07e-61	0.7788
1. PBF	A8GUF3	tRNA modification GTPase MnmE	0.00e+00	5.77e-59	1.31e-61	0.8664
1. PBF	A8LPC2	tRNA modification GTPase MnmE	0.00e+00	7.25e-51	2.59e-49	0.7854
1. PBF	A6QKK2	tRNA modification GTPase MnmE	0.00e+00	4.32e-77	6.65e-103	0.8413
1. PBF	B0BV57	tRNA modification GTPase MnmE	0.00e+00	4.55e-60	7.15e-59	0.8444
1. PBF	Q1IWI7	GTPase Der	7.03e-04	2.05e-04	1.21e-20	0.7463
1. PBF	B6I3T9	tRNA modification GTPase MnmE	2.33e-13	1.50e-61	8.81e-58	0.7241
1. PBF	B3EMI7	GTPase Der	5.15e-04	1.45e-07	8.05e-16	0.7171
1. PBF	B9KZ43	GTPase Der	5.27e-03	1.69e-05	2.03e-17	0.3014
1. PBF	Q12HM9	tRNA modification GTPase MnmE	6.47e-13	3.62e-65	3.27e-56	0.749
1. PBF	B1IWF0	GTPase Der	6.22e-04	3.05e-02	4.58e-17	0.4554
1. PBF	B9DNV9	GTPase Der	6.53e-04	3.05e-06	2.16e-14	0.5952
1. PBF	A5WBB6	tRNA modification GTPase MnmE	0.00e+00	2.62e-67	6.16e-55	0.7619
1. PBF	Q6KH82	tRNA modification GTPase MnmE	0.00e+00	7.11e-59	2.19e-90	0.8593
1. PBF	Q1IHC2	tRNA modification GTPase MnmE	0.00e+00	3.33e-66	4.35e-75	0.8609
1. PBF	B2S9M3	GTPase Der	1.35e-03	4.29e-04	3.72e-12	0.7615
1. PBF	Q9PLM9	tRNA modification GTPase MnmE	0.00e+00	6.45e-66	8.69e-78	0.7794
1. PBF	B4RD04	tRNA modification GTPase MnmE	3.85e-14	3.99e-60	1.85e-53	0.7731
1. PBF	B3QZ96	GTPase Der	6.74e-04	4.11e-07	1.42e-12	0.5019
1. PBF	Q05FY9	tRNA modification GTPase MnmE	5.71e-14	7.44e-57	8.15e-18	0.7018
1. PBF	Q3M929	GTPase Der	1.41e-03	5.46e-03	2.65e-14	0.5819
1. PBF	A6W3V0	tRNA modification GTPase MnmE	0.00e+00	4.76e-65	6.59e-57	0.775
1. PBF	Q03SA1	GTPase Der	5.96e-03	1.50e-05	9.65e-17	0.6323
1. PBF	Q2KTI2	tRNA modification GTPase MnmE	6.60e-13	5.46e-62	2.60e-52	0.7455
1. PBF	Q46HI4	tRNA modification GTPase MnmE	0.00e+00	8.16e-67	8.70e-69	0.8045
1. PBF	Q7MAX1	tRNA modification GTPase MnmE	3.13e-13	1.68e-62	3.67e-57	0.7231
1. PBF	Q11TG8	tRNA modification GTPase MnmE	0.00e+00	1.04e-70	8.07e-72	0.8057
1. PBF	B1IIN2	GTPase Der	1.18e-03	4.27e-05	1.82e-15	0.6352
1. PBF	Q5HUK3	tRNA modification GTPase MnmE	0.00e+00	3.76e-67	1.22e-68	0.8389
1. PBF	Q4K6V3	GTPase Der	4.03e-03	2.66e-02	3.65e-17	0.7377
1. PBF	Q8YZH7	GTPase Der	3.52e-03	5.66e-03	1.00e-14	0.5766
1. PBF	A1WWE4	tRNA modification GTPase MnmE	0.00e+00	6.30e-61	4.73e-56	0.798
1. PBF	B3ETH9	tRNA modification GTPase MnmE	0.00e+00	1.17e-75	1.01e-73	0.8114
1. PBF	B8ZMH4	GTPase Der	4.17e-03	5.13e-06	1.28e-16	0.6105
1. PBF	Q6LU45	GTPase Der	3.54e-03	2.23e-04	3.35e-15	0.6152
1. PBF	Q6G5W4	tRNA modification GTPase MnmE	0.00e+00	8.53e-75	1.13e-97	0.8448
1. PBF	Q44633	tRNA modification GTPase MnmE	0.00e+00	5.31e-65	9.18e-48	0.7411
1. PBF	B7MGC8	tRNA modification GTPase MnmE	2.18e-13	1.40e-62	3.10e-57	0.7248
1. PBF	Q8KPU2	tRNA modification GTPase MnmE	0.00e+00	5.09e-73	6.75e-82	0.8037
1. PBF	A7FPC2	tRNA modification GTPase MnmE	5.82e-14	2.19e-64	4.58e-56	0.7285
1. PBF	Q663S6	tRNA modification GTPase MnmE	2.23e-13	1.38e-63	8.85e-57	0.7213
1. PBF	Q57AJ6	tRNA modification GTPase MnmE	1.11e-16	1.12e-44	1.81e-51	0.7423
1. PBF	A8I264	tRNA modification GTPase MnmE	2.22e-16	1.25e-47	1.10e-49	0.7692
1. PBF	Q9JWB7	tRNA modification GTPase MnmE	9.33e-12	8.63e-67	6.97e-58	0.721
1. PBF	A9MX84	tRNA modification GTPase MnmE	7.39e-14	8.03e-64	2.52e-55	0.7227
1. PBF	Q6YPI0	tRNA modification GTPase MnmE	0.00e+00	3.45e-74	9.57e-93	0.8471
1. PBF	A0KR31	tRNA modification GTPase MnmE	6.81e-14	2.10e-65	3.61e-59	0.7584
1. PBF	Q040F3	tRNA modification GTPase MnmE	0.00e+00	5.67e-75	2.09e-91	0.8491
1. PBF	P64065	GTPase Der	1.08e-03	9.70e-06	3.24e-14	0.6195
1. PBF	Q8UD28	GTPase Der	7.73e-04	3.22e-03	1.00e-12	0.7613
1. PBF	Q30YQ7	tRNA modification GTPase MnmE	0.00e+00	6.43e-65	6.58e-77	0.819
1. PBF	Q0HPE7	tRNA modification GTPase MnmE	3.87e-13	7.60e-66	1.23e-58	0.7464
1. PBF	C0Q2L4	tRNA modification GTPase MnmE	0.00e+00	2.37e-64	7.18e-55	0.7251
1. PBF	Q74H94	tRNA modification GTPase MnmE	0.00e+00	3.45e-75	1.38e-89	0.8516
1. PBF	A7MZE5	GTPase Der	3.05e-04	8.06e-04	3.19e-17	0.6854
1. PBF	B2UPK5	tRNA modification GTPase MnmE	0.00e+00	3.24e-66	1.47e-73	0.8789
1. PBF	Q1J8C9	GTPase Der	3.38e-03	5.76e-06	1.47e-14	0.5768
1. PBF	A1JT87	tRNA modification GTPase MnmE	8.25e-14	1.17e-63	2.04e-57	0.7264
1. PBF	Q31CZ2	tRNA modification GTPase MnmE	0.00e+00	6.18e-68	2.66e-70	0.7873
1. PBF	Q13SH7	tRNA modification GTPase MnmE	0.00e+00	5.38e-68	1.98e-52	0.7589
1. PBF	Q30TK8	GTPase Der	1.63e-03	6.81e-04	8.05e-13	0.5837
1. PBF	Q2WBH0	tRNA modification GTPase MnmE	0.00e+00	3.63e-56	2.60e-38	0.8188
1. PBF	Q11QK1	GTPase Der	1.35e-03	7.94e-07	3.06e-13	0.7113
1. PBF	A3CNB0	tRNA modification GTPase MnmE	0.00e+00	1.89e-76	5.86e-103	0.8226
1. PBF	Q72VY6	tRNA modification GTPase MnmE	0.00e+00	4.51e-66	1.68e-60	0.8032
1. PBF	A0LE48	tRNA modification GTPase MnmE	0.00e+00	1.07e-56	3.77e-60	0.8132
1. PBF	Q7URJ8	GTPase Der	1.53e-03	5.00e-03	1.15e-12	0.5826
1. PBF	B7JGY9	GTPase Der	8.12e-04	6.33e-06	2.94e-13	0.6197
1. PBF	A8GHW1	GTPase Der	1.19e-03	1.90e-02	1.46e-16	0.7236
1. PBF	Q3IK56	tRNA modification GTPase MnmE	5.50e-13	7.40e-66	3.56e-61	0.7531
1. PBF	Q92KW1	tRNA modification GTPase MnmE	0.00e+00	7.73e-58	1.96e-50	0.7694
1. PBF	Q3MBM5	tRNA modification GTPase MnmE	0.00e+00	5.27e-69	3.94e-88	0.7841
1. PBF	Q2IXA7	GTPase Der	3.74e-04	1.09e-05	1.57e-10	0.6789
1. PBF	A6U1U3	GTPase Der	7.01e-04	1.40e-04	7.16e-14	0.5812
1. PBF	B0S3V2	tRNA modification GTPase MnmE	0.00e+00	1.05e-74	1.17e-89	0.7822
1. PBF	A3DHY8	tRNA modification GTPase MnmE	0.00e+00	7.84e-73	2.39e-91	0.8354
1. PBF	Q5M1D9	GTPase Der	8.29e-04	4.67e-05	1.42e-15	0.5721
1. PBF	Q4UMV9	GTPase Der	8.51e-04	7.31e-05	1.16e-11	0.6397
1. PBF	A1VYA6	GTPase Der	1.58e-03	1.72e-04	1.63e-11	0.6017
1. PBF	Q3AG56	tRNA modification GTPase MnmE	0.00e+00	1.05e-74	6.19e-92	0.8133
1. PBF	C1FSU2	GTPase Der	2.10e-03	6.00e-05	1.82e-15	0.6435
1. PBF	A4ITX1	tRNA modification GTPase MnmE	0.00e+00	2.19e-76	2.07e-111	0.8446
1. PBF	Q2LSF6	tRNA modification GTPase MnmE	0.00e+00	2.58e-75	4.32e-74	0.821
1. PBF	Q1MPF1	tRNA modification GTPase MnmE	0.00e+00	7.10e-68	9.51e-61	0.7929
1. PBF	A9N205	GTPase Der	4.45e-03	1.60e-02	4.14e-17	0.3097
1. PBF	A5GW82	tRNA modification GTPase MnmE	0.00e+00	9.21e-66	1.32e-72	0.7865
1. PBF	A9BE09	GTPase Der	1.37e-03	3.28e-03	9.60e-16	0.4469
1. PBF	Q4K396	tRNA modification GTPase MnmE	2.62e-12	8.96e-66	2.24e-58	0.7509
1. PBF	Q24VA2	GTPase Der	1.02e-03	1.31e-04	4.25e-13	0.7113
1. PBF	A7N0X8	tRNA modification GTPase MnmE	1.97e-14	5.17e-62	4.13e-58	0.7194
1. PBF	Q87TS2	tRNA modification GTPase MnmE	1.53e-13	6.10e-66	2.76e-52	0.7333
1. PBF	Q5N638	tRNA modification GTPase MnmE	0.00e+00	2.94e-72	7.79e-80	0.8073
1. PBF	A5IXJ1	tRNA modification GTPase MnmE	0.00e+00	4.39e-72	1.26e-90	0.8215
1. PBF	Q1LH94	tRNA modification GTPase MnmE	9.55e-15	1.78e-62	2.96e-49	0.7717
1. PBF	Q9WYA4	tRNA modification GTPase MnmE	0.00e+00	6.76e-63	6.91e-95	0.8091
1. PBF	A5CDT2	GTPase Der	3.09e-04	6.87e-04	2.14e-07	0.7235
1. PBF	A0KBN1	tRNA modification GTPase MnmE	1.11e-16	9.67e-65	1.38e-53	0.77
1. PBF	Q9KTW7	GTPase Der	2.62e-04	2.01e-03	1.04e-16	0.5723
1. PBF	Q119L7	GTPase Der	6.90e-03	4.61e-03	7.16e-16	0.4453
1. PBF	Q17ZA7	tRNA modification GTPase MnmE	0.00e+00	9.63e-67	5.77e-57	0.8499
1. PBF	Q2NQ72	tRNA modification GTPase MnmE	3.45e-13	3.93e-65	3.70e-48	0.7043
1. PBF	B0TQH0	tRNA modification GTPase MnmE	9.76e-13	4.77e-66	3.52e-51	0.7541
1. PBF	A4VWD1	tRNA modification GTPase MnmE	0.00e+00	1.25e-74	3.43e-101	0.8171
1. PBF	Q03KR8	tRNA modification GTPase MnmE	0.00e+00	3.66e-75	1.42e-105	0.813
1. PBF	A7GVP7	tRNA modification GTPase MnmE	0.00e+00	1.31e-75	2.62e-110	0.8425
1. PBF	P74120	GTPase Der	1.63e-03	8.34e-03	5.39e-16	0.466
1. PBF	Q0SPQ3	tRNA modification GTPase MnmE	0.00e+00	2.94e-77	1.51e-92	0.8409
1. PBF	Q5NKZ8	tRNA modification GTPase MnmE	0.00e+00	6.52e-56	3.78e-48	0.7286
1. PBF	P64061	GTPase Der	6.35e-04	1.40e-04	7.16e-14	0.5841
1. PBF	C3MG60	GTPase Der	5.32e-04	4.14e-03	1.27e-13	0.7473
1. PBF	O83561	tRNA modification GTPase MnmE	0.00e+00	4.99e-54	5.98e-62	0.7862
1. PBF	Q5HFU8	GTPase Der	2.65e-03	1.40e-04	7.16e-14	0.5995
1. PBF	Q879S5	tRNA modification GTPase MnmE	0.00e+00	1.55e-62	1.22e-50	0.8073
1. PBF	A9IK66	GTPase Der	6.11e-04	4.85e-04	4.06e-13	0.6072
1. PBF	Q3K429	tRNA modification GTPase MnmE	2.24e-13	6.54e-67	3.43e-55	0.7456
1. PBF	B6J7Q3	GTPase Der	8.46e-04	6.02e-04	2.89e-15	0.5796
1. PBF	Q5WAG3	tRNA modification GTPase MnmE	0.00e+00	5.51e-75	8.23e-102	0.8448
1. PBF	A0RQK2	GTPase Der	3.44e-03	1.59e-03	2.52e-16	0.525
1. PBF	A5IWD7	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	0.8422
1. PBF	Q0HD65	tRNA modification GTPase MnmE	2.12e-13	6.81e-66	2.15e-59	0.756
1. PBF	Q8XB41	tRNA modification GTPase MnmE	1.06e-13	1.28e-61	8.44e-58	0.7175
1. PBF	A7NN19	tRNA modification GTPase MnmE	0.00e+00	1.47e-62	4.44e-67	0.8221
1. PBF	Q9RS19	GTPase Der	1.54e-03	3.67e-05	1.26e-20	0.7248
1. PBF	A4WUI6	GTPase Der	4.08e-04	1.47e-03	2.95e-11	0.5825
1. PBF	Q9Z768	tRNA modification GTPase MnmE	0.00e+00	3.15e-70	4.16e-75	0.7914
1. PBF	Q04KR8	tRNA modification GTPase MnmE	0.00e+00	2.00e-77	3.41e-102	0.8093
1. PBF	Q64X55	tRNA modification GTPase MnmE	0.00e+00	4.58e-77	1.64e-76	0.826
1. PBF	A4WGH1	tRNA modification GTPase MnmE	8.02e-14	3.74e-63	8.33e-56	0.7155
1. PBF	Q2N6I9	tRNA modification GTPase MnmE	1.11e-16	5.45e-49	1.95e-46	0.7691
1. PBF	B2TUS2	tRNA modification GTPase MnmE	1.14e-13	1.50e-61	8.81e-58	0.7207
1. PBF	Q7V491	tRNA modification GTPase MnmE	0.00e+00	1.60e-62	8.40e-62	0.7874
1. PBF	A6TCD0	GTPase Der	1.07e-03	1.10e-02	3.81e-18	0.5004
1. PBF	Q0I6N5	tRNA modification GTPase MnmE	1.05e-14	1.09e-65	2.55e-80	0.7657
1. PBF	A6VQS6	tRNA modification GTPase MnmE	1.11e-16	4.96e-67	1.02e-56	0.7637
1. PBF	B0C1P2	GTPase Der	8.07e-04	5.04e-03	2.16e-15	0.588
1. PBF	Q5P9B1	tRNA modification GTPase MnmE	0.00e+00	7.92e-53	8.56e-66	0.7881
1. PBF	Q8DY73	GTPase Der	2.36e-03	2.06e-05	2.23e-15	0.5674
1. PBF	Q1D5X5	GTPase Der	1.53e-03	2.48e-04	2.55e-13	0.5693
1. PBF	P9WNL2	GTPase Der	2.88e-03	6.89e-05	8.47e-06	0.6941
1. PBF	A3PJF0	GTPase Der	4.18e-04	2.84e-03	3.05e-11	0.6086
1. PBF	A0Q7G4	tRNA modification GTPase MnmE	8.64e-12	2.47e-65	8.45e-56	0.7013
1. PBF	A7HYV8	GTPase Der	1.17e-04	7.76e-05	3.23e-11	0.5475
1. PBF	A1VUS4	tRNA modification GTPase MnmE	2.28e-12	1.74e-59	1.61e-54	0.7462
1. PBF	A7MN03	tRNA modification GTPase MnmE	1.10e-13	3.56e-64	5.00e-60	0.7283
1. PBF	A4J9S1	tRNA modification GTPase MnmE	0.00e+00	3.60e-72	1.12e-93	0.8337
1. PBF	Q828Y7	GTPase Der	3.20e-03	4.71e-04	2.56e-10	0.7276
1. PBF	Q02RV3	GTPase Der	1.23e-03	3.79e-02	4.83e-14	0.4816
1. PBF	Q1Q7V4	tRNA modification GTPase MnmE	0.00e+00	4.78e-62	8.49e-59	0.7817
1. PBF	A5CY46	tRNA modification GTPase MnmE	0.00e+00	2.51e-70	4.60e-103	0.8242
1. PBF	A2REM7	tRNA modification GTPase MnmE	0.00e+00	1.48e-72	9.48e-106	0.8305
1. PBF	B2A470	tRNA modification GTPase MnmE	0.00e+00	4.70e-71	6.45e-85	0.8395
1. PBF	B5E756	GTPase Der	3.72e-03	5.13e-06	1.28e-16	0.6199
1. PBF	Q89Z26	tRNA modification GTPase MnmE	0.00e+00	1.43e-75	1.46e-78	0.7923
1. PBF	A8F2P7	tRNA modification GTPase MnmE	0.00e+00	3.16e-61	8.28e-58	0.8449
1. PBF	A3N480	tRNA modification GTPase MnmE	0.00e+00	5.17e-62	1.05e-47	0.7639
1. PBF	Q6ND14	tRNA modification GTPase MnmE	4.63e-11	1.03e-51	3.73e-46	0.7434
1. PBF	Q97ID7	GTPase Der	8.25e-04	1.39e-04	8.64e-14	0.6008
1. PBF	Q9TLX6	Probable tRNA modification GTPase MnmE	8.77e-15	1.95e-70	1.09e-58	0.7625
1. PBF	Q7VE01	tRNA modification GTPase MnmE	1.06e-13	7.91e-60	1.80e-69	0.7639
1. PBF	A5UID5	tRNA modification GTPase MnmE	1.33e-12	6.73e-67	4.29e-55	0.7102
1. PBF	B5RFY2	tRNA modification GTPase MnmE	2.64e-13	1.11e-63	4.78e-55	0.7222
1. PBF	Q3B1B4	tRNA modification GTPase MnmE	7.93e-14	4.65e-62	4.98e-70	0.7555
1. PBF	O51830	tRNA modification GTPase MnmE	0.00e+00	2.90e-66	1.27e-54	0.7585
1. PBF	Q97R24	tRNA modification GTPase MnmE	0.00e+00	1.32e-77	2.18e-101	0.827
1. PBF	Q4ZL12	tRNA modification GTPase MnmE	7.88e-14	5.50e-64	1.17e-54	0.7394
1. PBF	Q07LA7	GTPase Der	2.66e-04	5.82e-05	1.39e-10	0.6367
1. PBF	A2SMI8	tRNA modification GTPase MnmE	3.33e-16	4.73e-58	3.22e-54	0.7683
1. PBF	B1YQJ5	tRNA modification GTPase MnmE	2.22e-16	6.79e-65	2.90e-51	0.7673
1. PBF	Q1CVG4	tRNA modification GTPase MnmE	0.00e+00	4.07e-62	1.77e-40	0.8138
1. PBF	B5R578	GTPase Der	6.89e-04	1.18e-02	4.26e-17	0.2985
1. PBF	Q2Y6F9	GTPase Der	4.31e-03	4.09e-02	5.82e-13	0.3831
1. PBF	Q2GI42	tRNA modification GTPase MnmE	0.00e+00	1.20e-55	6.67e-59	0.7789
1. PBF	Q7U3V6	tRNA modification GTPase MnmE	2.82e-13	2.24e-61	3.54e-72	0.7537
1. PBF	C4K7P4	tRNA modification GTPase MnmE	2.22e-12	3.24e-66	1.29e-55	0.7435
1. PBF	Q5L4W4	GTPase Der	3.49e-04	5.76e-06	3.09e-15	0.4709
1. PBF	A5IZG5	GTPase Der	3.48e-03	1.10e-07	5.09e-15	0.6183
1. PBF	A1URU0	GTPase Der	7.38e-04	1.02e-05	1.41e-12	0.3494
1. PBF	Q5E8Z9	tRNA modification GTPase MnmE	4.64e-14	1.58e-63	1.15e-55	0.7556
1. PBF	A6T4D6	tRNA modification GTPase MnmE	1.33e-12	7.72e-68	5.85e-48	0.7193
1. PBF	A4YJT5	tRNA modification GTPase MnmE	7.84e-13	3.93e-46	5.08e-46	0.7463
1. PBF	Q72K85	tRNA modification GTPase MnmE	0.00e+00	1.77e-58	1.13e-69	0.7881
1. PBF	Q0BLL9	tRNA modification GTPase MnmE	8.70e-12	7.36e-65	1.55e-54	0.6886
1. PBF	Q81JD9	tRNA modification GTPase MnmE	0.00e+00	2.82e-74	4.36e-110	0.8392
1. PBF	Q8Z2N8	tRNA modification GTPase MnmE	2.11e-13	3.36e-63	2.20e-55	0.7537
1. PBF	B8HSJ3	tRNA modification GTPase MnmE	3.33e-16	3.07e-71	5.16e-72	0.7931
1. PBF	Q02A42	tRNA modification GTPase MnmE	0.00e+00	2.14e-66	2.63e-63	0.8741
1. PBF	Q0KFG6	tRNA modification GTPase MnmE	4.61e-14	3.09e-59	4.42e-51	0.7404
1. PBF	A5VJK4	GTPase Der	6.42e-04	6.50e-04	5.88e-13	0.7355
1. PBF	A1AV43	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	3.41e-70	0.8401
1. PBF	P66972	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	0.8443
1. PBF	Q8DTT8	tRNA modification GTPase MnmE	0.00e+00	1.83e-76	6.78e-103	0.8375
1. PBF	Q9ZCP6	GTPase Der	7.37e-04	1.09e-05	4.35e-11	0.6174
1. PBF	Q740D6	GTPase Der	4.87e-03	1.22e-03	8.75e-10	0.7042
1. PBF	Q135K8	GTPase Der	9.48e-03	2.94e-05	1.24e-11	0.6701
1. PBF	B0JFL6	GTPase Der	5.04e-03	6.94e-04	7.54e-15	0.709
1. PBF	A4TMT3	GTPase Der	3.63e-03	2.58e-02	1.93e-14	0.592
1. PBF	A1VER5	tRNA modification GTPase MnmE	0.00e+00	2.92e-69	1.12e-60	0.7783
1. PBF	B1M0E0	tRNA modification GTPase MnmE	0.00e+00	6.34e-53	3.08e-48	0.7688
1. PBF	A8MKR9	tRNA modification GTPase MnmE	0.00e+00	5.90e-71	5.75e-93	0.8387
1. PBF	Q3AGU7	tRNA modification GTPase MnmE	1.82e-14	4.01e-59	5.45e-71	0.7696
1. PBF	B4F0U0	tRNA modification GTPase MnmE	3.16e-14	1.42e-64	7.48e-57	0.7569
1. PBF	P0DA91	GTPase Der	2.20e-03	1.05e-05	3.01e-14	0.6138
1. PBF	B2K868	tRNA modification GTPase MnmE	2.48e-13	1.38e-63	8.85e-57	0.7262
1. PBF	Q73GH3	tRNA modification GTPase MnmE	1.24e-10	1.25e-36	3.21e-48	0.7682
1. PBF	A8HVL5	GTPase Der	2.07e-04	2.31e-02	9.56e-12	0.6839
1. PBF	B4TN11	tRNA modification GTPase MnmE	3.46e-14	8.03e-64	2.52e-55	0.7243
1. PBF	B1GYZ9	tRNA modification GTPase MnmE	0.00e+00	5.27e-71	1.83e-64	0.8074
1. PBF	Q7V395	tRNA modification GTPase MnmE	0.00e+00	5.84e-68	4.16e-68	0.8335
1. PBF	Q3J6L9	tRNA modification GTPase MnmE	3.75e-13	5.21e-64	1.90e-53	0.7479
1. PBF	A6QAL0	tRNA modification GTPase MnmE	0.00e+00	1.33e-68	6.95e-75	0.8447
1. PBF	B0T6E0	tRNA modification GTPase MnmE	0.00e+00	6.07e-62	4.28e-51	0.7931
1. PBF	A3MK70	GTPase Der	3.19e-03	1.08e-04	5.15e-15	0.7701
1. PBF	O67030	tRNA modification GTPase MnmE	0.00e+00	5.76e-65	1.19e-80	0.8222
1. PBF	Q9CHH6	GTPase Der	8.27e-04	5.35e-06	1.90e-14	0.6116
1. PBF	A7HSK9	tRNA modification GTPase MnmE	2.00e-15	2.22e-48	1.82e-44	0.7921
1. PBF	Q9ZL09	GTPase Der	1.02e-03	4.27e-05	3.39e-10	0.3233
1. PBF	A6WQP3	GTPase Der	1.10e-03	2.45e-02	2.42e-13	0.4497
1. PBF	B0SJ24	tRNA modification GTPase MnmE	0.00e+00	1.06e-65	2.59e-58	0.8081
1. PBF	Q9ZJG6	tRNA modification GTPase MnmE	0.00e+00	2.35e-67	1.83e-56	0.8542
1. PBF	O67749	GTPase Der	1.16e-04	4.57e-03	1.32e-13	0.6495
1. PBF	A7ZAW1	tRNA modification GTPase MnmE	0.00e+00	2.00e-77	1.91e-106	0.8267
1. PBF	Q047F9	tRNA modification GTPase MnmE	0.00e+00	2.19e-76	2.32e-103	0.8598
1. PBF	Q97CW2	tRNA modification GTPase MnmE	0.00e+00	2.36e-75	2.04e-100	0.8271
1. PBF	Q4A647	tRNA modification GTPase MnmE	0.00e+00	5.78e-66	8.46e-75	0.8626
1. PBF	A5IKF4	tRNA modification GTPase MnmE	0.00e+00	6.65e-64	6.74e-96	0.8097
1. PBF	Q8KAS1	tRNA modification GTPase MnmE	2.22e-15	1.54e-64	1.76e-71	0.7794
1. PBF	A8G7P7	tRNA modification GTPase MnmE	3.61e-13	4.90e-63	2.66e-58	0.7087
1. PBF	Q1JLX3	tRNA modification GTPase MnmE	0.00e+00	3.70e-72	1.79e-104	0.8312
1. PBF	Q9CDH8	tRNA modification GTPase MnmE	0.00e+00	7.57e-77	1.20e-103	0.8409
1. PBF	C0R405	tRNA modification GTPase MnmE	0.00e+00	3.14e-49	3.83e-49	0.7677
1. PBF	Q89A14	GTPase Der	5.36e-03	2.35e-02	1.45e-08	0.6282
1. PBF	Q15MS9	tRNA modification GTPase MnmE	4.79e-13	1.81e-64	5.14e-56	0.7456
1. PBF	Q65VC3	tRNA modification GTPase MnmE	2.29e-12	8.47e-70	7.31e-60	0.7184
1. PBF	Q3SWH5	tRNA modification GTPase MnmE	1.26e-12	1.51e-55	1.93e-52	0.7277
1. PBF	Q5FKF4	GTPase Der	5.43e-03	9.50e-06	8.77e-14	0.6257
1. PBF	Q6G1K8	tRNA modification GTPase MnmE	0.00e+00	6.58e-54	1.32e-46	0.7723
1. PBF	A5G9V3	tRNA modification GTPase MnmE	0.00e+00	1.19e-69	8.55e-74	0.8298
1. PBF	Q926U7	tRNA modification GTPase MnmE	0.00e+00	1.45e-76	3.75e-105	0.8513
1. PBF	A2BUG6	tRNA modification GTPase MnmE	0.00e+00	3.85e-68	9.30e-77	0.837
1. PBF	C4ZX86	GTPase Der	8.39e-04	3.05e-02	4.58e-17	0.4438
1. PBF	B7UMH3	tRNA modification GTPase MnmE	2.84e-13	5.75e-63	1.33e-57	0.7226
1. PBF	B1I6S2	tRNA modification GTPase MnmE	0.00e+00	1.42e-67	2.70e-84	0.8303
1. PBF	Q4A8F6	tRNA modification GTPase MnmE	0.00e+00	7.53e-63	1.10e-77	0.8301
1. PBF	P66973	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	0.8431
1. PBF	Q6F2A3	tRNA modification GTPase MnmE	0.00e+00	1.10e-86	0.0	0.927
1. PBF	Q7VWL4	GTPase Der	1.88e-03	3.67e-05	1.28e-15	0.5947
1. PBF	A7GGA7	GTPase Der	1.08e-03	5.82e-05	1.69e-15	0.6472
1. PBF	B2K9P6	GTPase Der	4.31e-03	1.95e-02	2.31e-14	0.371
1. PBF	A7ZCZ1	tRNA modification GTPase MnmE	0.00e+00	7.41e-71	1.42e-64	0.8774
1. PBF	B1ZGG9	tRNA modification GTPase MnmE	1.76e-12	1.99e-55	3.16e-55	0.7361
1. PBF	A0AMD2	tRNA modification GTPase MnmE	0.00e+00	8.48e-74	4.76e-106	0.844
1. PBF	A6UEE9	tRNA modification GTPase MnmE	0.00e+00	3.45e-56	2.95e-52	0.8079
1. PBF	A1T0N0	tRNA modification GTPase MnmE	3.36e-12	4.27e-66	9.95e-55	0.7323
1. PBF	Q5HW81	GTPase Der	1.98e-03	1.99e-04	2.99e-11	0.5532
1. PBF	A8GTM1	tRNA modification GTPase MnmE	0.00e+00	4.55e-60	7.15e-59	0.878
1. PBF	A7FPM0	tRNA modification GTPase MnmE	0.00e+00	1.82e-81	2.17e-100	0.8397
1. PBF	A9NBA7	tRNA modification GTPase MnmE	0.00e+00	2.83e-68	1.08e-62	0.7812
1. PBF	Q92GE8	tRNA modification GTPase MnmE	0.00e+00	5.06e-60	2.72e-58	0.8447
1. PBF	Q5LLM7	tRNA modification GTPase MnmE	0.00e+00	1.20e-46	2.15e-51	0.7879
1. PBF	Q256D0	tRNA modification GTPase MnmE	0.00e+00	8.47e-70	6.30e-77	0.7843
1. PBF	Q821L2	tRNA modification GTPase MnmE	0.00e+00	7.56e-70	9.12e-75	0.7863
1. PBF	A4WD89	GTPase Der	9.24e-04	2.41e-03	5.74e-17	0.2936
1. PBF	B7HL14	GTPase Der	8.80e-04	6.33e-06	2.94e-13	0.6167
1. PBF	C6DK97	tRNA modification GTPase MnmE	1.46e-13	1.42e-63	3.22e-52	0.7204
1. PBF	B8DBY9	GTPase Der	8.14e-04	2.80e-06	1.93e-19	0.4727
1. PBF	A5GPA1	tRNA modification GTPase MnmE	1.25e-14	2.87e-64	3.53e-80	0.7614
1. PBF	Q92GU2	GTPase Der	1.39e-02	6.30e-05	5.77e-10	0.6299
1. PBF	Q6FYB8	tRNA modification GTPase MnmE	2.05e-13	3.86e-53	6.24e-42	0.7392
1. PBF	A8MH56	GTPase Der	8.63e-04	7.17e-06	3.38e-13	0.5182
1. PBF	B1XU78	GTPase Der	1.73e-03	1.13e-03	2.31e-11	0.6489
1. PBF	C4K2K1	GTPase Der	9.24e-04	6.82e-05	6.08e-10	0.6249
1. PBF	Q8Y3M4	tRNA modification GTPase MnmE	0.00e+00	3.30e-76	5.90e-105	0.8511
1. PBF	A5IT03	GTPase Der	6.28e-04	1.40e-04	7.16e-14	0.5874
1. PBF	A8Z454	GTPase Der	6.75e-04	1.31e-04	6.43e-14	0.5851
1. PBF	A6Q3D6	tRNA modification GTPase MnmE	0.00e+00	1.65e-56	1.61e-74	0.8453
1. PBF	A8FP41	tRNA modification GTPase MnmE	1.33e-12	2.84e-61	1.86e-55	0.7551
1. PBF	Q0T208	GTPase Der	3.78e-03	3.23e-02	4.42e-17	0.2974
1. PBF	A5EY43	tRNA modification GTPase MnmE	3.00e-15	7.15e-70	5.85e-65	0.7833
1. PBF	O25991	tRNA modification GTPase MnmE	0.00e+00	7.72e-68	3.69e-54	0.8617
1. PBF	A6TG09	tRNA modification GTPase MnmE	3.42e-13	6.24e-62	3.24e-56	0.7248
1. PBF	Q7U8G2	GTPase Der	7.28e-04	6.14e-04	2.11e-17	0.4415
1. PBF	Q9PNX9	tRNA modification GTPase MnmE	0.00e+00	1.99e-67	2.00e-68	0.8478
1. PBF	A9MJT6	tRNA modification GTPase MnmE	6.96e-14	1.06e-61	1.52e-53	0.7183
1. PBF	Q5HCD7	tRNA modification GTPase MnmE	1.11e-16	8.68e-57	4.11e-59	0.7861
1. PBF	Q3BLZ9	tRNA modification GTPase MnmE	0.00e+00	1.01e-61	3.53e-50	0.7912
1. PBF	Q477Q5	tRNA modification GTPase MnmE	3.16e-11	2.27e-66	1.41e-59	0.725
1. PBF	Q7VJY2	tRNA modification GTPase MnmE	0.00e+00	5.27e-71	1.41e-62	0.8577
1. PBF	Q1JH22	tRNA modification GTPase MnmE	0.00e+00	3.81e-72	1.79e-105	0.8305
1. PBF	Q46H20	GTPase Der	2.79e-03	6.29e-03	4.46e-14	0.4278
1. PBF	Q0BWA8	tRNA modification GTPase MnmE	0.00e+00	1.01e-52	7.72e-54	0.7876
1. PBF	Q7NGF9	GTPase Der	7.15e-04	2.98e-04	3.72e-11	0.5668
1. PBF	B9JZQ5	GTPase Der	2.24e-04	4.89e-04	1.07e-12	0.7384
1. PBF	Q47U36	tRNA modification GTPase MnmE	1.65e-12	8.95e-64	6.10e-52	0.7445
1. PBF	Q39BQ4	tRNA modification GTPase MnmE	2.22e-16	3.20e-64	3.41e-54	0.7657
1. PBF	B0SAE4	tRNA modification GTPase MnmE	0.00e+00	1.06e-65	2.59e-58	0.8393
1. PBF	B7NR09	tRNA modification GTPase MnmE	1.58e-13	8.16e-63	1.38e-57	0.7197
1. PBF	Q3K1I2	tRNA modification GTPase MnmE	0.00e+00	5.03e-74	5.79e-103	0.839
1. PBF	P0DG22	tRNA modification GTPase MnmE	0.00e+00	2.94e-72	1.20e-105	0.8309
1. PBF	B1HPM3	tRNA modification GTPase MnmE	0.00e+00	1.62e-74	6.91e-109	0.8384
1. PBF	A1APR9	GTPase Der	1.35e-03	5.33e-04	4.00e-08	0.52
1. PBF	A2C0J7	GTPase Der	2.12e-03	4.03e-03	4.27e-14	0.4283
1. PBF	C1ANY6	GTPase Der	1.73e-03	6.89e-05	8.47e-06	0.5678
1. PBF	Q1I2H5	tRNA modification GTPase MnmE	3.14e-13	5.94e-66	1.49e-53	0.735
1. PBF	B9K8E0	GTPase Der	1.33e-03	2.42e-06	1.10e-15	0.7043
1. PBF	B9IVM6	GTPase Der	8.91e-04	6.33e-06	2.94e-13	0.6205
1. PBF	A0RNG2	tRNA modification GTPase MnmE	0.00e+00	3.32e-60	4.15e-58	0.8669
1. PBF	Q5LG80	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	2.16e-76	0.8251
1. PBF	A4T0N1	tRNA modification GTPase MnmE	1.43e-13	8.96e-66	8.98e-51	0.7882
1. PBF	A2C018	tRNA modification GTPase MnmE	0.00e+00	3.66e-67	4.18e-68	0.787
1. PBF	P25811	tRNA modification GTPase MnmE	0.00e+00	5.98e-77	5.45e-106	0.8306
1. PBF	Q630B8	tRNA modification GTPase MnmE	0.00e+00	2.90e-74	5.65e-110	0.8394
1. PBF	Q7VQV3	tRNA modification GTPase MnmE	3.75e-12	8.36e-62	1.34e-48	0.7415
1. PBF	B1IBH5	tRNA modification GTPase MnmE	0.00e+00	9.81e-78	1.78e-102	0.8252
1. PBF	A9M8F4	GTPase Der	7.58e-04	5.53e-04	3.53e-12	0.6993
1. PBF	C1D094	GTPase Der	6.38e-04	2.44e-04	1.02e-20	0.6621
1. PBF	Q98RJ5	tRNA modification GTPase MnmE	0.00e+00	9.52e-72	1.22e-80	0.8987
1. PBF	A5FGE0	tRNA modification GTPase MnmE	0.00e+00	1.64e-71	1.71e-71	0.8441
1. PBF	B2TXT6	GTPase Der	6.57e-04	4.95e-02	4.30e-17	0.4424
1. PBF	Q5SJS7	tRNA modification GTPase MnmE	0.00e+00	5.34e-59	1.89e-69	0.8016
1. PBF	Q2GIJ8	tRNA modification GTPase MnmE	0.00e+00	2.42e-60	1.98e-57	0.7466
1. PBF	Q0AKE8	tRNA modification GTPase MnmE	0.00e+00	7.84e-52	1.01e-49	0.809
1. PBF	Q1CCJ3	tRNA modification GTPase MnmE	1.14e-13	1.34e-63	1.42e-56	0.7233
1. PBF	Q8RGV7	GTPase Der	2.72e-03	8.20e-07	9.27e-14	0.5756
1. PBF	Q2YZB8	tRNA modification GTPase MnmE	0.00e+00	7.13e-77	3.22e-97	0.8439
1. PBF	A4J3P1	GTPase Der	1.24e-03	4.02e-06	3.59e-14	0.5937
1. PBF	A4SNZ8	GTPase Der	5.29e-04	1.11e-04	1.64e-16	0.7138
1. PBF	Q5X0M3	tRNA modification GTPase MnmE	0.00e+00	8.74e-69	4.26e-63	0.7514
1. PBF	Q2FDE8	tRNA modification GTPase MnmE	0.00e+00	4.32e-77	6.65e-103	0.8399
1. PBF	A7I145	tRNA modification GTPase MnmE	0.00e+00	1.73e-45	3.26e-55	0.8416
1. PBF	A6QH24	GTPase Der	8.27e-04	1.40e-04	7.16e-14	0.5811
1. PBF	B3DXK2	GTPase Der	5.62e-04	2.80e-02	1.65e-12	0.6896
1. PBF	B7L851	tRNA modification GTPase MnmE	1.54e-13	1.72e-61	5.02e-57	0.7276
1. PBF	B0V5S5	tRNA modification GTPase MnmE	2.36e-13	3.33e-70	1.33e-66	0.7524
1. PBF	A9M0N5	tRNA modification GTPase MnmE	7.84e-12	2.55e-67	7.44e-59	0.7318
1. PBF	Q7NAD9	tRNA modification GTPase MnmE	0.00e+00	3.35e-68	6.65e-85	0.8118
1. PBF	Q31KP9	GTPase Der	1.79e-03	4.99e-02	1.42e-15	0.5974
1. PBF	Q5F529	tRNA modification GTPase MnmE	4.30e-12	1.91e-68	5.42e-59	0.7339
1. PBF	A2SHB1	GTPase Der	6.43e-04	3.67e-05	1.12e-12	0.6999
1. PBF	Q5XCB7	tRNA modification GTPase MnmE	0.00e+00	8.80e-73	5.06e-105	0.8305
1. PBF	A4W2N6	tRNA modification GTPase MnmE	0.00e+00	1.25e-74	3.43e-101	0.8282
1. PBF	B2S3E2	tRNA modification GTPase MnmE	0.00e+00	4.99e-54	5.98e-62	0.7889
1. PBF	A9IJ97	tRNA modification GTPase MnmE	3.95e-13	1.58e-63	3.13e-54	0.7303
1. PBF	Q8YJS6	tRNA modification GTPase MnmE	0.00e+00	8.89e-45	6.46e-52	0.7478
1. PBF	Q602M5	tRNA modification GTPase MnmE	1.11e-16	1.28e-65	1.21e-53	0.7276
1. PBF	C0QT02	GTPase Der	2.59e-04	1.22e-04	7.67e-19	0.5726
1. PBF	Q9RCA7	tRNA modification GTPase MnmE	0.00e+00	9.31e-77	6.03e-108	0.8253
1. PBF	A4YUE1	GTPase Der	4.25e-03	1.23e-05	4.34e-11	0.6506
1. PBF	B1Y0F6	tRNA modification GTPase MnmE	7.30e-13	1.81e-64	7.45e-50	0.7638
1. PBF	Q13X32	GTPase Der	2.88e-03	7.24e-05	3.08e-15	0.5925
1. PBF	Q39FR3	GTPase Der	1.19e-03	7.46e-05	1.18e-15	0.7612
1. PBF	C1C8U6	GTPase Der	5.12e-03	5.13e-06	1.28e-16	0.6108
1. PBF	A1V7D3	tRNA modification GTPase MnmE	1.11e-16	5.17e-62	1.05e-47	0.7623
1. PBF	A9KLX9	tRNA modification GTPase MnmE	0.00e+00	3.79e-78	1.23e-91	0.8847
1. PBF	Q1C0B3	tRNA modification GTPase MnmE	5.23e-14	1.34e-63	1.42e-56	0.727
1. PBF	Q1GP64	tRNA modification GTPase MnmE	4.44e-16	4.41e-46	6.57e-37	0.7456
1. PBF	Q62EM6	tRNA modification GTPase MnmE	1.11e-16	5.17e-62	1.05e-47	0.762
1. PBF	Q7V8X0	GTPase Der	1.44e-03	3.28e-03	1.56e-17	0.4504
1. PBF	Q71VV0	tRNA modification GTPase MnmE	0.00e+00	2.25e-76	4.60e-105	0.8537
1. PBF	C1D6H7	tRNA modification GTPase MnmE	7.17e-11	2.21e-69	5.58e-66	0.7226
1. PBF	B3ETF1	GTPase Der	4.33e-02	3.66e-06	1.72e-13	0.7032
1. PBF	P0CAX2	tRNA modification GTPase MnmE	0.00e+00	2.75e-58	2.11e-57	0.7807
1. PBF	Q89WP4	tRNA modification GTPase MnmE	5.63e-13	8.40e-55	1.71e-48	0.7202
1. PBF	A8GT93	GTPase Der	1.05e-02	1.28e-04	4.58e-10	0.7163
1. PBF	A1S1G4	tRNA modification GTPase MnmE	2.84e-13	1.18e-65	1.05e-60	0.7495
1. PBF	A8LHW1	GTPase Der	3.04e-04	1.85e-03	6.36e-11	0.5891
1. PBF	A5E8G7	tRNA modification GTPase MnmE	1.22e-11	5.61e-48	3.76e-46	0.7226
1. PBF	A8ACL8	tRNA modification GTPase MnmE	2.77e-13	2.24e-63	6.48e-56	0.728
1. PBF	Q8CX52	tRNA modification GTPase MnmE	6.71e-14	8.82e-62	2.20e-60	0.7501
1. PBF	A4XHX9	GTPase Der	5.21e-04	6.67e-06	4.75e-17	0.5314
1. PBF	B2UVJ7	tRNA modification GTPase MnmE	0.00e+00	1.88e-67	1.74e-55	0.8497
1. PBF	P94612	tRNA modification GTPase MnmE	1.97e-13	2.83e-68	1.08e-62	0.7664
1. PBF	P64059	GTPase Der	6.22e-04	1.40e-04	7.16e-14	0.5887
1. PBF	Q48BF3	tRNA modification GTPase MnmE	4.76e-14	2.85e-67	1.38e-53	0.7371
1. PBF	Q8KBK3	GTPase Der	2.07e-03	1.62e-06	7.69e-16	0.6364
1. PBF	A2BV51	GTPase Der	3.52e-03	2.73e-02	3.03e-11	0.4422
1. PBF	A3M8Y8	tRNA modification GTPase MnmE	1.84e-13	1.69e-70	1.61e-66	0.7513
1. PBF	Q0BAQ4	tRNA modification GTPase MnmE	0.00e+00	1.20e-64	2.04e-51	0.7696
1. PBF	A8YYS1	tRNA modification GTPase MnmE	0.00e+00	4.32e-77	6.65e-103	0.8421
1. PBF	A7GJN9	tRNA modification GTPase MnmE	0.00e+00	1.52e-81	2.86e-99	0.8467
1. PBF	A9NE34	tRNA modification GTPase MnmE	0.00e+00	1.10e-71	1.01e-96	0.8279
1. PBF	A3PAQ7	tRNA modification GTPase MnmE	0.00e+00	2.41e-67	1.39e-74	0.791
1. PBF	Q2S6H2	tRNA modification GTPase MnmE	0.00e+00	2.14e-62	8.15e-66	0.8222
1. PBF	A9R5S1	tRNA modification GTPase MnmE	1.62e-13	1.34e-63	1.42e-56	0.7216
1. PBF	A7HK07	tRNA modification GTPase MnmE	0.00e+00	3.03e-64	1.87e-86	0.7982
1. PBF	Q2Y5A9	tRNA modification GTPase MnmE	0.00e+00	1.62e-69	5.31e-59	0.777
1. PBF	A3D6V5	GTPase Der	2.84e-04	2.55e-02	2.51e-13	0.5074
1. PBF	B0K8H9	tRNA modification GTPase MnmE	0.00e+00	6.79e-73	6.09e-89	0.8366
1. PBF	A7H372	tRNA modification GTPase MnmE	0.00e+00	8.23e-70	3.69e-67	0.8503
1. PBF	Q1QRZ0	tRNA modification GTPase MnmE	5.55e-12	1.62e-54	2.47e-48	0.709
1. PBF	Q0A4L6	tRNA modification GTPase MnmE	1.31e-12	2.25e-59	3.18e-48	0.7442
1. PBF	A5G692	GTPase Der	4.21e-04	3.71e-05	1.11e-14	0.4165
1. PBF	Q73KN7	tRNA modification GTPase MnmE	0.00e+00	1.01e-61	2.74e-69	0.7765
1. PBF	A9CHB2	tRNA modification GTPase MnmE	0.00e+00	6.06e-57	4.82e-49	0.7818
1. PBF	Q7NPT9	tRNA modification GTPase MnmE	3.20e-11	8.96e-66	1.37e-60	0.73
1. PBF	B1JFV3	tRNA modification GTPase MnmE	5.01e-13	1.24e-66	2.05e-54	0.7412
1. PBF	A6VF44	tRNA modification GTPase MnmE	2.73e-13	4.09e-67	1.47e-55	0.739
1. PBF	A9KBS9	tRNA modification GTPase MnmE	0.00e+00	2.83e-68	1.08e-62	0.7815
1. PBF	B5QUQ5	tRNA modification GTPase MnmE	6.21e-14	8.03e-64	2.52e-55	0.7183
1. PBF	B3R1J8	GTPase Der	1.10e-03	5.16e-05	5.10e-15	0.7552
1. PBF	A8AD75	GTPase Der	7.57e-04	1.61e-02	2.73e-17	0.7169
1. PBF	Q3AVY3	tRNA modification GTPase MnmE	0.00e+00	3.66e-64	1.83e-69	0.7578
1. PBF	Q121L2	tRNA modification GTPase MnmE	4.22e-13	1.67e-60	3.21e-58	0.7388
1. PBF	B2VCE7	tRNA modification GTPase MnmE	1.07e-13	1.43e-62	5.18e-57	0.7236
1. PBF	Q5P4P5	tRNA modification GTPase MnmE	6.23e-11	3.10e-67	1.82e-61	0.7227
1. PBF	B0RMM4	tRNA modification GTPase MnmE	0.00e+00	2.80e-62	2.54e-56	0.8152
1. PBF	A6L6E8	tRNA modification GTPase MnmE	7.44e-15	5.71e-49	9.88e-74	0.75
1. PBF	P59569	tRNA modification GTPase MnmE	0.00e+00	2.44e-71	4.17e-51	0.8118
1. PBF	A9HE16	tRNA modification GTPase MnmE	0.00e+00	2.27e-50	5.70e-47	0.789
1. PBF	A9WKE3	tRNA modification GTPase MnmE	0.00e+00	1.93e-65	9.38e-62	0.798
1. PBF	B7N699	GTPase Der	7.67e-04	2.60e-02	4.22e-17	0.4418
1. PBF	Q88VZ6	GTPase Der	7.08e-04	1.74e-04	1.73e-15	0.5815
1. PBF	B8CKR5	GTPase Der	1.63e-04	3.70e-02	1.36e-13	0.4533
1. PBF	Q2NIG1	tRNA modification GTPase MnmE	0.00e+00	5.90e-71	5.90e-93	0.84
1. PBF	A2BNY4	tRNA modification GTPase MnmE	0.00e+00	3.35e-68	2.57e-73	0.7988
1. PBF	B0URU2	tRNA modification GTPase MnmE	9.38e-13	4.96e-67	7.12e-59	0.763
1. PBF	A6WUK3	tRNA modification GTPase MnmE	5.74e-14	3.07e-66	1.68e-57	0.7481
1. PBF	Q8ZKY3	tRNA modification GTPase MnmE	2.04e-13	6.13e-64	1.47e-55	0.7229
1. PBF	Q39ZT0	tRNA modification GTPase MnmE	0.00e+00	9.52e-72	7.40e-74	0.815
1. PBF	P64063	GTPase Der	5.73e-03	5.13e-06	1.28e-16	0.6109
1. PBF	O51461	GTPase Der	5.51e-04	1.01e-03	7.31e-10	0.7062
1. PBF	Q8CY34	tRNA modification GTPase MnmE	1.52e-11	4.51e-44	1.40e-51	0.7347
1. PBF	A5WI36	tRNA modification GTPase MnmE	0.00e+00	6.42e-69	6.93e-54	0.7815
1. PBF	Q1WVH7	tRNA modification GTPase MnmE	0.00e+00	1.16e-71	4.51e-109	0.8426
1. PBF	A3DAS7	tRNA modification GTPase MnmE	4.71e-13	1.03e-65	4.20e-57	0.7451
1. PBF	Q494C0	tRNA modification GTPase MnmE	0.00e+00	3.79e-60	5.43e-45	0.7504
1. PBF	A4JJ44	tRNA modification GTPase MnmE	1.11e-16	2.37e-64	8.18e-51	0.7579
1. PBF	Q39PQ9	tRNA modification GTPase MnmE	0.00e+00	3.93e-73	1.12e-76	0.8471
1. PBF	Q1QMP4	GTPase Der	2.63e-03	6.69e-05	7.67e-11	0.7695
1. PBF	Q8YFH2	GTPase Der	4.02e-04	4.41e-04	3.20e-12	0.7605
1. PBF	B5ZBM9	GTPase Der	1.36e-02	7.32e-06	1.84e-11	0.5549
1. PBF	Q5HS36	tRNA modification GTPase MnmE	0.00e+00	1.89e-76	6.99e-106	0.841
1. PBF	A2S8D8	tRNA modification GTPase MnmE	2.22e-16	5.17e-62	1.05e-47	0.7627
1. PBF	Q82XA1	tRNA modification GTPase MnmE	2.20e-13	2.18e-70	2.81e-66	0.7139
1. PBF	Q7W2J0	tRNA modification GTPase MnmE	8.82e-13	2.18e-63	9.67e-55	0.7354
1. PBF	Q1R4M8	tRNA modification GTPase MnmE	2.90e-13	1.40e-62	3.10e-57	0.722
1. PBF	Q0TEX4	GTPase Der	2.39e-03	3.10e-02	4.30e-17	0.595
1. PBF	Q24M98	tRNA modification GTPase MnmE	0.00e+00	2.94e-73	7.15e-88	0.8623
1. PBF	C4K4J2	GTPase Der	1.36e-03	1.15e-04	1.30e-14	0.3044
1. PBF	Q28QC6	GTPase Der	6.30e-04	9.59e-03	3.00e-10	0.3618
1. PBF	Q6G0H5	GTPase Der	8.57e-04	1.58e-05	8.06e-13	0.7436
1. PBF	Q48TS5	tRNA modification GTPase MnmE	0.00e+00	6.05e-73	2.24e-103	0.8336
1. PBF	Q03D59	tRNA modification GTPase MnmE	0.00e+00	8.99e-74	3.27e-98	0.834
1. PBF	Q0VKU8	tRNA modification GTPase MnmE	6.28e-12	4.76e-65	1.27e-61	0.7136
1. PBF	A1QYX4	tRNA modification GTPase MnmE	6.99e-15	2.27e-72	8.34e-65	0.7787
1. PBF	Q2RIV4	GTPase Der	1.14e-03	4.87e-06	7.50e-18	0.5733
1. PBF	A9KX19	tRNA modification GTPase MnmE	2.15e-12	2.67e-66	3.44e-57	0.7473
1. PBF	Q9PRC7	tRNA modification GTPase MnmE	0.00e+00	7.93e-62	4.09e-104	0.8888
1. PBF	A3PNS7	tRNA modification GTPase MnmE	0.00e+00	3.95e-53	5.54e-46	0.796
1. PBF	A9NDV6	GTPase Der	2.92e-03	6.02e-04	2.89e-15	0.5327
1. PBF	Q13E22	tRNA modification GTPase MnmE	7.77e-16	1.58e-55	6.58e-50	0.7534
1. PBF	B7M559	tRNA modification GTPase MnmE	5.04e-14	1.50e-61	8.81e-58	0.7228
1. PBF	B0S1N2	GTPase Der	5.05e-04	1.14e-06	1.55e-14	0.559
1. PBF	Q46VM0	tRNA modification GTPase MnmE	1.73e-14	1.12e-61	1.74e-51	0.7497
1. PBF	A1TWI4	tRNA modification GTPase MnmE	1.36e-10	5.75e-63	4.94e-51	0.7342
1. PBF	Q1RKJ6	tRNA modification GTPase MnmE	0.00e+00	3.34e-59	2.16e-61	0.8251
1. PBF	B0KRC0	tRNA modification GTPase MnmE	3.03e-13	7.20e-66	4.01e-55	0.7379
1. PBF	Q6N586	GTPase Der	2.77e-03	3.28e-04	2.72e-10	0.6644
1. PBF	Q8E3T9	GTPase Der	6.16e-03	2.65e-05	1.37e-15	0.6064
1. PBF	B7LCQ1	GTPase Der	4.66e-04	3.05e-02	4.58e-17	0.4621
1. PBF	A0KQZ6	tRNA modification GTPase MnmE	5.58e-14	6.01e-68	9.02e-57	0.7642
1. PBF	A8HAH9	tRNA modification GTPase MnmE	8.02e-14	2.67e-66	1.90e-50	0.7249
1. PBF	Q67J33	tRNA modification GTPase MnmE	0.00e+00	2.76e-69	3.34e-83	0.8049
1. PBF	A1R5C7	GTPase Der	6.72e-04	1.46e-04	2.56e-10	0.5797
1. PBF	Q5KU57	tRNA modification GTPase MnmE	0.00e+00	6.89e-76	4.06e-108	0.8439
1. PBF	P0DG23	tRNA modification GTPase MnmE	0.00e+00	2.94e-72	1.20e-105	0.8332
1. PBF	A6LDT9	tRNA modification GTPase MnmE	0.00e+00	1.29e-69	4.42e-79	0.7561
1. PBF	P0C8N9	tRNA modification GTPase MnmE	0.00e+00	2.86e-73	2.97e-80	0.8004
1. PBF	A8F7S2	GTPase Der	5.71e-03	2.97e-05	7.94e-19	0.6785
1. PBF	Q6MUE7	tRNA modification GTPase MnmE	0.00e+00	1.65e-105	0.0	0.9927
1. PBF	Q8EUV6	tRNA modification GTPase MnmE	0.00e+00	2.03e-72	1.10e-91	0.864
1. PBF	B3CMJ7	tRNA modification GTPase MnmE	0.00e+00	2.69e-50	7.59e-50	0.7744
1. PBF	A4X692	GTPase Der	7.30e-03	3.64e-04	1.73e-09	0.6787
1. PBF	B1KUB2	tRNA modification GTPase MnmE	0.00e+00	3.45e-81	3.60e-100	0.8398
1. PBF	O25505	GTPase Der	8.60e-04	8.74e-05	3.27e-10	0.3286
1. PBF	Q85FG3	Probable tRNA modification GTPase MnmE	0.00e+00	1.50e-66	4.26e-63	0.8012
1. PBF	Q0AE55	tRNA modification GTPase MnmE	0.00e+00	1.60e-70	3.29e-62	0.768
1. PBF	Q9RL97	tRNA modification GTPase MnmE	0.00e+00	5.53e-68	2.03e-90	0.8286
1. PBF	B1XKC3	tRNA modification GTPase MnmE	0.00e+00	6.21e-70	8.36e-85	0.7968
1. PBF	Q0SYP6	tRNA modification GTPase MnmE	6.89e-13	1.76e-61	2.39e-57	0.7205
1. PBF	B3Q8A8	tRNA modification GTPase MnmE	4.57e-11	3.24e-51	4.40e-46	0.7431
1. PBF	A2RP37	tRNA modification GTPase MnmE	0.00e+00	4.72e-77	2.82e-102	0.8419
1. PBF	A1KCP8	tRNA modification GTPase MnmE	1.95e-14	2.61e-69	4.25e-55	0.7443
1. PBF	Q899S2	tRNA modification GTPase MnmE	0.00e+00	2.32e-77	3.34e-99	0.8178
1. PBF	Q256C5	GTPase Der	4.15e-03	9.74e-05	9.63e-15	0.6072
1. PBF	Q2YR11	tRNA modification GTPase MnmE	1.11e-16	1.12e-44	1.81e-51	0.7411
1. PBF	Q04W28	tRNA modification GTPase MnmE	0.00e+00	2.19e-64	1.72e-53	0.813
1. PBF	Q03N64	tRNA modification GTPase MnmE	0.00e+00	8.99e-74	8.61e-108	0.841
1. PBF	Q5ZR82	tRNA modification GTPase MnmE	0.00e+00	1.29e-68	6.30e-63	0.7321
1. PBF	Q7WDI4	tRNA modification GTPase MnmE	4.85e-13	1.38e-63	5.21e-54	0.7355
1. PBF	Q03WN4	GTPase Der	7.25e-04	5.41e-07	4.78e-15	0.6184
1. PBF	A5CVJ3	tRNA modification GTPase MnmE	0.00e+00	1.46e-71	6.86e-57	0.7834
1. PBF	A3DE77	GTPase Der	5.71e-03	3.82e-05	1.08e-18	0.5718
1. PBF	Q0ICK8	GTPase Der	6.96e-04	2.18e-03	1.98e-16	0.444
1. PBF	Q04XE4	tRNA modification GTPase MnmE	0.00e+00	2.19e-64	1.72e-53	0.8176
1. PBF	Q329B1	tRNA modification GTPase MnmE	9.41e-14	1.76e-61	2.65e-57	0.722
1. PBF	Q31DJ0	tRNA modification GTPase MnmE	5.02e-13	8.39e-68	4.29e-64	0.7295
1. PBF	Q8E5T7	tRNA modification GTPase MnmE	0.00e+00	5.99e-74	6.24e-103	0.8326
1. PBF	Q5HCI3	tRNA modification GTPase MnmE	0.00e+00	4.32e-77	6.65e-103	0.8401
1. PBF	Q21QM5	tRNA modification GTPase MnmE	3.93e-12	2.64e-64	3.17e-58	0.7608
1. PBF	Q1BSF9	tRNA modification GTPase MnmE	1.11e-16	9.67e-65	1.38e-53	0.7699
1. PBF	Q98DZ0	tRNA modification GTPase MnmE	0.00e+00	4.80e-60	6.24e-46	0.8009
1. PBF	Q6F6L1	tRNA modification GTPase MnmE	0.00e+00	1.67e-60	1.63e-65	0.7663
1. PBF	Q31UW0	tRNA modification GTPase MnmE	1.86e-13	1.50e-61	8.81e-58	0.7241
1. PBF	Q2A342	tRNA modification GTPase MnmE	6.13e-12	8.03e-66	2.28e-55	0.6989
1. PBF	Q2RN77	tRNA modification GTPase MnmE	1.67e-15	4.35e-52	3.66e-38	0.7929
1. PBF	A7ZTR2	tRNA modification GTPase MnmE	4.11e-13	1.81e-61	5.54e-56	0.7252
1. PBF	Q0TLZ4	tRNA modification GTPase MnmE	0.00e+00	8.27e-77	3.35e-92	0.8408
1. PBF	Q4UNL0	tRNA modification GTPase MnmE	1.41e-14	4.53e-62	1.76e-56	0.7734
1. PBF	B7LKC7	GTPase Der	1.91e-04	2.62e-02	4.58e-17	0.4408
1. PBF	A5F3E6	GTPase Der	1.96e-03	2.01e-03	1.04e-16	0.4245
1. PBF	Q8DPZ8	tRNA modification GTPase MnmE	0.00e+00	2.00e-77	3.41e-102	0.8197
1. PBF	A7GYZ1	tRNA modification GTPase MnmE	0.00e+00	1.86e-64	5.12e-63	0.8558
1. PBF	Q6F1R7	GTPase Der	8.35e-04	8.57e-05	2.42e-18	0.6524
1. PBF	Q4AAC5	tRNA modification GTPase MnmE	0.00e+00	5.46e-62	2.55e-77	0.8351
1. PBF	Q033L0	tRNA modification GTPase MnmE	0.00e+00	1.38e-70	5.99e-103	0.8506
1. PBF	A7X7A8	tRNA modification GTPase MnmE	0.00e+00	1.33e-76	3.50e-98	0.8453
1. PBF	Q6CYQ9	tRNA modification GTPase MnmE	9.02e-14	2.50e-63	1.58e-51	0.721
1. PBF	A4IX14	tRNA modification GTPase MnmE	4.98e-12	1.43e-65	7.53e-56	0.7103
1. PBF	Q2S6M6	tRNA modification GTPase MnmE	3.09e-14	3.93e-66	2.41e-57	0.7433
1. PBF	A4VS81	tRNA modification GTPase MnmE	5.34e-12	1.18e-65	1.66e-54	0.7389
1. PBF	A2CDC4	tRNA modification GTPase MnmE	0.00e+00	2.71e-63	4.46e-62	0.7903
1. PBF	Q2GD53	tRNA modification GTPase MnmE	5.66e-15	3.57e-26	1.93e-51	0.7556
1. PBF	Q87TR6	tRNA modification GTPase MnmE	8.16e-14	1.05e-63	2.55e-58	0.7408
1. PBF	Q3SR12	GTPase Der	3.74e-03	4.67e-04	6.15e-10	0.7646
1. PBF	B0K3E4	GTPase Der	9.72e-04	7.17e-06	1.37e-14	0.7003
1. PBF	Q8YN91	tRNA modification GTPase MnmE	1.11e-16	2.44e-71	3.31e-89	0.7715
1. PBF	Q5L4W0	tRNA modification GTPase MnmE	0.00e+00	4.30e-70	9.80e-76	0.7956
1. PBF	Q6MGL5	tRNA modification GTPase MnmE	0.00e+00	3.93e-65	1.09e-68	0.8078
1. PBF	B7LK49	tRNA modification GTPase MnmE	2.10e-13	3.38e-62	1.12e-57	0.7181
1. PBF	A8AXP0	tRNA modification GTPase MnmE	0.00e+00	2.61e-77	3.20e-103	0.8208
1. PBF	B7NQW0	GTPase Der	5.71e-04	3.10e-02	4.30e-17	0.4413
1. PBF	B7IP82	GTPase Der	9.20e-04	1.12e-05	4.13e-14	0.5908
1. PBF	A6WX76	tRNA modification GTPase MnmE	1.11e-16	2.94e-53	3.05e-49	0.7415
1. PBF	Q14GV5	tRNA modification GTPase MnmE	7.66e-12	7.40e-66	8.27e-56	0.6921
1. PBF	Q1CRH7	tRNA modification GTPase MnmE	0.00e+00	9.37e-67	2.60e-57	0.8713
1. PBF	Q9CLQ1	tRNA modification GTPase MnmE	2.59e-12	7.51e-68	1.78e-55	0.7157
1. PBF	A6GXB2	tRNA modification GTPase MnmE	0.00e+00	2.94e-72	1.25e-74	0.8419
1. PBF	B0CBB0	tRNA modification GTPase MnmE	0.00e+00	2.90e-71	1.69e-76	0.7622
1. PBF	Q6HAF2	tRNA modification GTPase MnmE	0.00e+00	2.82e-74	4.36e-110	0.8368
1. PBF	A5F485	tRNA modification GTPase MnmE	7.92e-13	2.50e-63	6.17e-62	0.7395
1. PBF	Q3AAU6	GTPase Der	8.97e-04	5.35e-06	4.24e-17	0.6887
1. PBF	Q5GTQ0	tRNA modification GTPase MnmE	0.00e+00	1.11e-51	8.25e-50	0.7994
1. PBF	Q1GCM0	tRNA modification GTPase MnmE	0.00e+00	1.89e-44	1.45e-55	0.7894
1. PBF	B1K0Y2	tRNA modification GTPase MnmE	1.11e-16	4.15e-65	1.85e-53	0.7648
1. PBF	Q63YV9	tRNA modification GTPase MnmE	0.00e+00	5.17e-62	1.05e-47	0.752
1. PBF	A5U372	GTPase Der	1.47e-03	6.89e-05	8.47e-06	0.6945
1. PBF	A5EI59	GTPase Der	3.90e-03	8.57e-05	2.29e-11	0.7453
1. PBF	Q9KCD4	GTPase Der	7.83e-04	1.73e-06	1.80e-15	0.5993
1. PBF	Q6APY7	tRNA modification GTPase MnmE	0.00e+00	5.70e-70	1.86e-65	0.8159
1. PBF	Q9JXL4	tRNA modification GTPase MnmE	1.69e-12	4.64e-66	5.09e-59	0.7596
1. PBF	B9LBT6	GTPase Der	8.62e-03	2.45e-05	5.71e-16	0.6851
1. PBF	A0LLH5	tRNA modification GTPase MnmE	0.00e+00	6.75e-70	5.83e-69	0.8169
1. PBF	Q5PKU1	tRNA modification GTPase MnmE	9.04e-14	2.58e-62	2.20e-55	0.7277
1. PBF	B0TYD1	tRNA modification GTPase MnmE	5.12e-12	5.21e-64	8.18e-61	0.7329
1. PBF	C4ZYY4	tRNA modification GTPase MnmE	2.53e-13	1.50e-61	8.81e-58	0.7209
1. PBF	A4Y8T6	GTPase Der	2.13e-04	3.58e-02	3.31e-13	0.3986
1. PBF	B0BTQ8	GTPase Der	4.87e-04	9.65e-05	1.47e-15	0.5615
1. PBF	A9VTM0	tRNA modification GTPase MnmE	0.00e+00	1.02e-74	1.20e-108	0.8424
1. PBF	Q7NHT3	tRNA modification GTPase MnmE	0.00e+00	4.49e-75	1.27e-78	0.7821
1. PBF	A5VA82	tRNA modification GTPase MnmE	3.33e-16	3.63e-37	6.08e-33	0.7616
1. PBF	Q48V63	GTPase Der	4.87e-03	1.15e-05	3.27e-14	0.6174
1. PBF	Q99ZU0	tRNA modification GTPase MnmE	0.00e+00	4.79e-72	3.51e-106	0.8326
1. PBF	A1AXR3	tRNA modification GTPase MnmE	0.00e+00	2.82e-71	6.29e-53	0.7393
1. PBF	B2GC35	GTPase Der	6.75e-04	1.74e-04	2.13e-14	0.6247
1. PBF	A8AVL8	GTPase Der	4.63e-04	5.88e-06	1.83e-15	0.576
1. PBF	A3NVW6	GTPase Der	3.70e-04	1.08e-04	5.15e-15	0.7702
1. PBF	A9BHZ7	tRNA modification GTPase MnmE	0.00e+00	1.57e-74	3.95e-89	0.7655
1. PBF	Q7MQK6	tRNA modification GTPase MnmE	2.03e-13	5.91e-63	3.84e-60	0.7502
1. PBF	Q57LJ0	GTPase Der	3.98e-04	2.19e-02	4.07e-17	0.3033
1. PBF	Q2J357	tRNA modification GTPase MnmE	1.11e-16	7.59e-56	2.57e-48	0.7451
1. PBF	Q38UE9	tRNA modification GTPase MnmE	0.00e+00	3.77e-75	8.61e-102	0.8522
1. PBF	O84704	tRNA modification GTPase MnmE	0.00e+00	3.46e-67	1.80e-74	0.7921
1. PBF	B3H0R7	GTPase Der	2.73e-04	1.03e-04	1.59e-15	0.5221
1. PBF	Q0TB01	tRNA modification GTPase MnmE	3.35e-13	1.40e-62	3.10e-57	0.7258
1. PBF	Q1JDF1	GTPase Der	2.20e-03	9.70e-06	3.24e-14	0.5755
1. PBF	Q9P9U3	tRNA modification GTPase MnmE	0.00e+00	6.58e-62	3.12e-49	0.817
1. PBF	A6H103	GTPase Der	1.37e-03	1.37e-06	1.27e-15	0.6731
1. PBF	P75104	tRNA modification GTPase MnmE	0.00e+00	8.38e-63	5.30e-67	0.7744
1. PBF	A0PX77	tRNA modification GTPase MnmE	0.00e+00	3.41e-77	2.02e-98	0.8257
1. PBF	Q57HZ6	tRNA modification GTPase MnmE	1.99e-13	8.03e-64	2.52e-55	0.7194
1. PBF	A1WDB4	tRNA modification GTPase MnmE	1.03e-10	1.86e-64	5.80e-58	0.7397
1. PBF	Q3B5U3	GTPase Der	7.75e-04	2.66e-06	9.33e-15	0.7064
1. PBF	P0A176	tRNA modification GTPase MnmE	1.02e-12	2.62e-67	6.16e-55	0.7372
1. PBF	A4TSL0	tRNA modification GTPase MnmE	2.47e-13	1.34e-63	1.42e-56	0.7243
1. PBF	Q3YWA7	tRNA modification GTPase MnmE	1.79e-13	4.07e-62	6.13e-57	0.726
1. PBF	Q1J6U1	tRNA modification GTPase MnmE	0.00e+00	1.35e-72	2.91e-104	0.8304
1. PBF	Q2K2S0	tRNA modification GTPase MnmE	0.00e+00	2.41e-52	2.36e-42	0.7948
2. PF	A9H253	GTPase HflX	2.46e-02	4.06e-17	NA	0.3071
2. PF	Q04PB3	GTPase HflX	1.18e-02	2.93e-06	NA	0.3269
2. PF	D9R4W7	GTPase HflX	8.78e-03	9.58e-17	NA	0.3305
3. BF	Q3JCW1	GTPase Der	9.23e-04	NA	1.36e-12	0.2933
3. BF	C1CRT1	GTPase Era	4.94e-04	NA	4.84e-10	0.5765
3. BF	P0C0C0	GTPase Era (Fragment)	9.97e-05	NA	3.43e-09	0.6277
3. BF	A3PBA9	GTPase Der	9.11e-04	NA	8.69e-12	0.7086
3. BF	Q12PT0	GTPase Der	4.16e-04	NA	5.41e-16	0.4775
3. BF	Q9KD52	GTPase Era	4.40e-04	NA	3.08e-15	0.5265
3. BF	B0K708	GTPase Era	4.82e-04	NA	8.20e-14	0.5598
3. BF	B7I5H1	GTPase Der	7.86e-04	NA	5.51e-13	0.7335
3. BF	Q3SL66	GTPase Der	6.27e-03	NA	9.47e-14	0.4266
3. BF	Q6MB45	GTPase Der	3.72e-03	NA	3.79e-16	0.3773
3. BF	B0KPJ1	GTPase Der	1.56e-03	NA	4.62e-16	0.4797
3. BF	Q5HAY9	GTPase Era	5.72e-04	NA	2.91e-05	0.4967
3. BF	B8GTN1	GTPase Der	5.37e-04	NA	2.20e-13	0.6494
3. BF	Q72G11	GTPase Era	1.70e-03	NA	2.78e-08	0.371
3. BF	A5IT95	GTPase Era	3.62e-04	NA	4.45e-11	0.3884
3. BF	B0U489	GTPase Der	3.34e-03	NA	1.30e-14	0.4404
3. BF	B7K414	GTPase Era	8.88e-04	NA	2.75e-10	0.4924
3. BF	B8DQN1	GTPase Era	1.58e-03	NA	0.002	0.5092
3. BF	A3Q264	GTPase Era	8.22e-04	NA	1.33e-05	0.5131
3. BF	B9DNL3	GTPase Era	3.88e-04	NA	3.77e-11	0.3935
3. BF	A8Z4A6	GTPase Era	4.23e-04	NA	4.45e-11	0.3972
3. BF	Q1B6C5	GTPase Era	8.24e-04	NA	1.25e-05	0.4906
3. BF	Q8DYI1	GTPase Era	3.71e-04	NA	9.43e-09	0.5647
3. BF	B1KZM3	GTPase Era	3.82e-04	NA	8.25e-11	0.5609
3. BF	Q1G9W6	GTPase Era	5.52e-04	NA	1.20e-07	0.5244
3. BF	B7M8H9	GTPase Era	9.94e-04	NA	0.010	0.5413
3. BF	Q67NS9	GTPase Der	9.36e-03	NA	1.15e-14	0.695
3. BF	Q2JV46	GTPase Der	1.09e-03	NA	5.02e-16	0.5163
3. BF	Q2SDW8	GTPase Der	3.90e-03	NA	3.93e-17	0.4761
3. BF	Q92R46	GTPase Era	2.00e-04	NA	5.11e-07	0.5372
3. BF	Q6AEC6	GTPase Era	6.29e-04	NA	1.42e-07	0.5028
3. BF	Q92BP8	GTPase Era	4.22e-04	NA	1.91e-09	0.5714
3. BF	Q9PG37	GTPase Der	2.22e-03	NA	9.06e-15	0.4853
3. BF	A8G3A3	GTPase Der	4.88e-03	NA	1.17e-11	0.7125
3. BF	A7GHG2	GTPase Era	3.24e-04	NA	1.97e-10	0.5612
3. BF	B2TMB9	GTPase Era	3.75e-04	NA	9.91e-11	0.5577
3. BF	P42182	GTPase Era	4.37e-04	NA	2.60e-12	0.5397
3. BF	A5WGA8	GTPase Der	9.08e-04	NA	1.72e-14	0.6337
3. BF	A5EKL6	GTPase Era	2.66e-04	NA	5.07e-05	0.5536
3. BF	A1UIQ1	GTPase Era	8.14e-04	NA	1.25e-05	0.5145
3. BF	Q8FTK5	GTPase Der	3.62e-03	NA	6.10e-12	0.5682
3. BF	Q31CE7	GTPase Der	2.43e-03	NA	1.19e-11	0.4499
3. BF	A8GUZ8	GTPase Era	8.19e-04	NA	5.31e-08	0.4901
3. BF	Q83MZ2	GTPase Era	3.67e-04	NA	3.09e-07	0.4739
3. BF	Q03F63	GTPase Era	4.73e-04	NA	8.93e-13	0.5613
3. BF	Q03Y33	GTPase Era	4.55e-04	NA	2.26e-10	0.5408
3. BF	Q9KPB3	GTPase Era	1.20e-03	NA	3.01e-05	0.5284
3. BF	A5I626	GTPase Era	3.83e-04	NA	1.43e-10	0.5688
3. BF	B1JDV4	GTPase Der	8.16e-04	NA	9.86e-17	0.3861
3. BF	A8YVM7	GTPase Era	3.54e-04	NA	1.72e-10	0.5419
3. BF	Q5SM23	GTPase Era	1.41e-03	NA	3.53e-05	0.5066
3. BF	Q9JZY1	GTPase Der	6.00e-03	NA	1.91e-13	0.4489
3. BF	Q1QD14	GTPase Der	1.09e-03	NA	3.45e-15	0.5662
3. BF	A3CP94	GTPase Era	4.51e-04	NA	1.55e-10	0.5283
3. BF	Q3K7C0	GTPase Der	3.39e-03	NA	2.73e-17	0.6489
3. BF	A5IC36	GTPase Der	1.37e-03	NA	2.45e-14	0.6172
3. BF	Q1QTK4	GTPase Der	4.08e-03	NA	3.07e-12	0.3074
3. BF	B9M913	GTPase Era	2.91e-04	NA	1.43e-08	0.5232
3. BF	A0Q1Q0	GTPase Era	4.71e-04	NA	2.76e-08	0.5545
3. BF	B8DE49	GTPase Era	3.87e-04	NA	3.42e-09	0.5705
3. BF	Q5HFJ3	GTPase Era	4.08e-04	NA	4.45e-11	0.3765
3. BF	C6E2H7	GTPase Era	6.46e-04	NA	9.04e-09	0.5617
3. BF	Q2FGF6	GTPase Era	3.76e-04	NA	4.45e-11	0.3896
3. BF	C3L3F3	GTPase Era	3.34e-04	NA	9.13e-11	0.5605
3. BF	Q4UUM0	GTPase Der	2.05e-03	NA	3.82e-11	0.6655
3. BF	B3E422	GTPase Era	1.74e-03	NA	1.04e-07	0.5289
3. BF	Q88PJ3	GTPase Der	7.38e-04	NA	3.96e-16	0.481
3. BF	Q4L6R7	GTPase Era	3.96e-04	NA	1.17e-09	0.385
3. BF	Q5HNY0	GTPase Era	3.93e-04	NA	2.46e-10	0.3929
3. BF	Q98QI1	GTPase Era	7.82e-04	NA	1.64e-06	0.5208
3. BF	B2I7V0	GTPase Der	2.90e-03	NA	2.86e-15	0.6734
3. BF	O24756	GTPase Era	4.63e-04	NA	8.70e-10	0.5281
3. BF	Q2LVR8	GTPase Era	3.96e-04	NA	1.79e-11	0.5745
3. BF	Q1IEH7	GTPase Der	1.05e-03	NA	3.06e-16	0.3876
3. BF	Q5ZV99	GTPase Der	1.49e-03	NA	2.28e-14	0.6262
3. BF	C0MCD8	GTPase Era	4.51e-04	NA	1.14e-08	0.5618
3. BF	Q5WWG8	GTPase Der	1.43e-03	NA	2.30e-14	0.5482
3. BF	Q8EPY0	GTPase Era	4.10e-04	NA	4.71e-11	0.5664
3. BF	B1ILK9	GTPase Era	3.42e-04	NA	8.56e-11	0.5247
3. BF	P64085	GTPase Era	3.59e-04	NA	4.45e-11	0.3881
3. BF	Q97JI5	GTPase Era	3.27e-04	NA	1.58e-07	0.5466
3. BF	Q55526	GTPase Era	7.65e-04	NA	4.49e-10	0.5179
3. BF	A6U239	GTPase Era	4.17e-04	NA	4.45e-11	0.3958
3. BF	Q8RB50	GTPase Era	5.90e-04	NA	7.57e-13	0.3825
3. BF	B8J3P9	GTPase Era	1.46e-03	NA	5.93e-06	0.3803
3. BF	Q5X522	GTPase Der	1.35e-03	NA	2.45e-14	0.7357
4. PB	Q7VFY6	GTPase Der	2.52e-02	5.46e-03	4.63e-14	NA
4. PB	A7ZBS1	GTPase Der	3.70e-03	9.80e-04	6.01e-12	NA
4. PB	Q7N702	GTPase Der	1.86e-03	5.61e-03	3.86e-16	NA
4. PB	Q8A135	GTPase Der	1.23e-03	2.72e-06	7.98e-13	NA
4. PB	A6LEP5	GTPase Der	6.16e-04	8.57e-07	1.18e-14	NA
4. PB	A6KXK1	GTPase Der	5.92e-04	7.17e-06	4.15e-13	NA
4. PB	B1YR40	GTPase Der	2.15e-04	7.03e-05	1.79e-15	NA
4. PB	A9WHH9	GTPase Der	8.64e-03	2.45e-05	5.71e-16	NA
4. PB	B1I462	GTPase Der	3.99e-04	3.90e-06	2.95e-16	NA
4. PB	B2THQ9	GTPase Der	2.09e-03	8.65e-06	4.09e-14	NA
4. PB	Q8G2E8	GTPase Der	2.42e-03	5.53e-04	3.53e-12	NA
4. PB	A1JKS6	GTPase Der	1.46e-03	3.61e-02	1.16e-14	NA
4. PB	A5GR60	GTPase Der	7.94e-04	1.96e-03	1.02e-15	NA
4. PB	Q668A3	GTPase Der	5.79e-04	1.95e-02	2.31e-14	NA
4. PB	A8A317	GTPase Der	4.39e-04	3.05e-02	4.58e-17	NA
4. PB	A3CPT0	GTPase Der	5.28e-04	6.46e-06	2.10e-15	NA
4. PB	A0Q125	GTPase Der	6.06e-03	1.53e-04	3.21e-14	NA
4. PB	B5ZYX3	GTPase Der	4.38e-04	5.75e-04	2.91e-13	NA
4. PB	B3Q9V3	GTPase Der	3.20e-03	3.28e-04	2.72e-10	NA
4. PB	Q4L6I0	GTPase Der	7.07e-04	7.17e-06	8.42e-14	NA
4. PB	Q6GGT6	GTPase Der	6.96e-04	1.40e-04	7.16e-14	NA
4. PB	Q5M5X5	GTPase Der	9.10e-04	4.67e-05	1.42e-15	NA
4. PB	Q5LR04	GTPase Der	3.36e-04	2.90e-04	2.70e-11	NA
4. PB	Q83C83	GTPase Der	1.07e-03	6.02e-04	2.89e-15	NA
4. PB	A0RBV9	GTPase Der	7.71e-04	6.33e-06	2.94e-13	NA
4. PB	A6LNG7	GTPase Der	2.74e-04	1.01e-05	3.56e-11	NA
4. PB	P64058	GTPase Der	1.71e-03	6.89e-05	8.47e-06	NA
4. PB	Q74AX4	GTPase Der	5.27e-04	6.39e-06	2.93e-13	NA
4. PB	Q5NFD2	GTPase Der	2.00e-03	2.14e-03	9.39e-15	NA
4. PB	Q48LZ0	GTPase Der	4.29e-03	2.80e-02	5.06e-17	NA
4. PB	B1JSA4	GTPase Der	4.14e-03	2.58e-02	1.93e-14	NA
4. PB	B0B8S9	GTPase Der	1.20e-03	2.55e-08	2.57e-13	NA
4. PB	Q603B5	GTPase Der	1.44e-03	3.52e-02	2.51e-14	NA
4. PB	A0QH59	GTPase Der	4.94e-03	6.02e-04	8.52e-10	NA
4. PB	P25522	tRNA modification GTPase MnmE	1.87e-13	1.50e-61	8.81e-58	NA
4. PB	C0RH89	GTPase Der	5.71e-04	4.41e-04	3.20e-12	NA
4. PB	B3EFY1	GTPase Der	2.23e-03	4.20e-06	4.65e-12	NA
4. PB	P75309	GTPase Der	8.99e-04	1.15e-03	7.29e-12	NA
4. PB	A6SZW6	GTPase Der	3.84e-03	2.03e-04	3.44e-16	NA
4. PB	A4SYD7	GTPase Der	3.44e-03	1.51e-03	1.05e-11	NA
4. PB	Q2SRR7	GTPase Der	4.79e-04	1.30e-05	1.69e-14	NA
4. PB	Q9PIB6	GTPase Der	2.10e-03	1.99e-04	2.99e-11	NA
4. PB	B3E421	GTPase Der	1.03e-03	4.71e-04	4.57e-11	NA
4. PB	Q47WC5	GTPase Der	8.15e-04	1.69e-03	3.62e-16	NA
4. PB	C1KWN7	GTPase Der	2.14e-03	2.80e-06	1.93e-19	NA
4. PB	Q04ZS1	GTPase Der	5.99e-04	6.62e-04	6.92e-14	NA
4. PB	B1XAY6	GTPase Der	6.55e-04	3.05e-02	4.58e-17	NA
4. PB	A1RHQ7	GTPase Der	1.78e-04	4.67e-02	3.25e-13	NA
4. PB	Q9Z762	GTPase Der	1.47e-03	6.27e-08	8.74e-15	NA
4. PB	Q8KH12	GTPase Der	1.51e-03	1.44e-05	1.09e-10	NA
4. PB	Q986D9	GTPase Der	7.11e-04	2.74e-05	2.18e-11	NA
4. PB	B8D8G4	GTPase Der	4.48e-03	1.83e-02	1.19e-08	NA
4. PB	Q030L6	GTPase Der	8.18e-04	3.86e-06	5.62e-15	NA
4. PB	A0LCZ3	GTPase Obg	1.40e-01	1.67e-04	0.005	NA
4. PB	Q64NV3	GTPase Der	5.17e-03	7.40e-06	4.42e-15	NA
4. PB	Q085U2	GTPase Der	3.23e-04	1.90e-02	9.85e-15	NA
4. PB	Q5P7B7	GTPase Der	3.30e-03	9.65e-05	4.72e-14	NA
4. PB	B1MYB5	GTPase Der	1.25e-03	3.01e-07	1.03e-14	NA
4. PB	C5CXH0	GTPase Der	3.47e-03	1.97e-04	6.32e-13	NA
4. PB	Q9X1F8	GTPase Der	1.64e-03	6.00e-06	1.29e-15	NA
4. PB	P50743	GTPase Der	4.32e-04	5.11e-05	7.88e-13	NA
4. PB	A1B4S0	GTPase Der	1.64e-04	1.28e-03	6.79e-10	NA
4. PB	B9KFN5	GTPase Der	4.72e-03	3.61e-04	4.64e-11	NA
4. PB	A2RGB0	GTPase Der	1.24e-03	1.15e-04	2.24e-13	NA
4. PB	B7VJU2	GTPase Der	6.56e-04	5.43e-04	2.13e-16	NA
4. PB	Q8XJK1	GTPase Der	9.36e-04	3.52e-05	3.60e-16	NA
4. PB	C6DBH0	GTPase Der	5.17e-04	1.28e-02	5.99e-16	NA
4. PB	Q87S12	GTPase Der	3.09e-04	2.74e-03	1.97e-18	NA
4. PB	Q11KI3	GTPase Der	3.74e-04	1.51e-04	3.04e-11	NA
4. PB	C0PYN4	GTPase Der	5.02e-04	2.19e-02	4.07e-17	NA
4. PB	B2SXS6	GTPase Der	1.17e-03	3.01e-04	2.20e-15	NA
4. PB	Q8DKI1	GTPase Der	1.52e-03	1.92e-03	4.53e-17	NA
4. PB	Q0SMZ9	GTPase Der	6.32e-04	6.31e-04	1.93e-10	NA
4. PB	B2V3Z1	GTPase Der	2.16e-03	7.48e-06	8.64e-14	NA
4. PB	A0AK49	GTPase Der	1.68e-03	3.90e-06	2.07e-19	NA
4. PB	Q661B2	GTPase Der	1.68e-03	9.00e-05	2.70e-10	NA
4. PB	A1V9V1	GTPase Der	9.61e-03	1.53e-03	2.17e-12	NA
4. PB	Q3AQ22	GTPase Der	1.50e-03	3.74e-05	2.01e-13	NA
4. PB	Q0VNE4	GTPase Der	9.49e-04	2.27e-02	1.83e-14	NA
4. PB	A7H4Z1	GTPase Der	5.88e-04	5.32e-05	4.18e-10	NA
4. PB	Q3AZ65	GTPase Der	3.04e-03	1.75e-03	1.39e-17	NA
4. PB	O51881	GTPase Der	2.17e-03	1.58e-02	1.02e-10	NA
4. PB	B0K8N3	GTPase Der	1.07e-03	6.95e-06	1.61e-14	NA
4. PB	Q57EY6	GTPase Der	3.05e-04	4.29e-04	3.72e-12	NA
4. PB	B2USZ4	GTPase Der	1.03e-03	3.71e-05	2.83e-10	NA
4. PB	B2SF94	GTPase Der	4.16e-03	1.33e-03	5.83e-15	NA
4. PB	Q04J64	GTPase Der	9.00e-04	5.13e-06	1.28e-16	NA
4. PB	Q5PQQ1	tRNA modification GTPase GTPBP3, mitochondrial	0.00e+00	4.17e-22	2.68e-38	NA
4. PB	P96128	GTPase Der	2.49e-03	4.31e-05	1.60e-12	NA
4. PB	B1KLB1	GTPase Der	3.17e-04	9.26e-03	2.60e-13	NA
4. PB	Q7MNE7	GTPase Der	3.31e-04	1.06e-03	1.44e-17	NA
4. PB	Q5KXT0	GTPase Der	4.81e-04	7.31e-05	3.81e-15	NA
4. PB	A3QCG6	GTPase Der	2.10e-04	1.67e-02	1.27e-13	NA
4. PB	B0TZQ0	GTPase Der	4.31e-03	1.12e-02	2.17e-14	NA
4. PB	B7HHQ7	GTPase Der	8.30e-04	6.33e-06	2.94e-13	NA
4. PB	Q9UTE7	tRNA modification GTPase mss1, mitochondrial	0.00e+00	2.76e-29	6.17e-40	NA
4. PB	Q6D280	GTPase Der	4.38e-04	7.37e-03	2.39e-15	NA
4. PB	Q17WL7	GTPase Der	8.63e-04	8.66e-05	8.52e-10	NA
4. PB	Q73AZ1	GTPase Der	5.87e-04	5.46e-06	3.61e-13	NA
4. PB	P47571	GTPase Der	1.93e-03	7.20e-04	1.11e-14	NA
4. PB	Q46ZI7	GTPase Der	2.94e-03	3.67e-05	3.62e-15	NA
4. PB	A6VV10	GTPase Der	1.45e-03	3.82e-05	1.82e-15	NA
4. PB	Q3KKZ1	GTPase Der	4.45e-04	1.49e-08	2.66e-13	NA
4. PB	B2UMV5	GTPase Der	7.28e-04	8.06e-04	5.20e-11	NA
4. PB	Q725L9	GTPase Der	6.53e-04	2.39e-04	1.75e-12	NA
4. PB	P64060	GTPase Der	6.62e-04	1.40e-04	7.16e-14	NA
4. PB	Q1RK21	GTPase Der	1.95e-02	1.67e-04	1.14e-12	NA
4. PB	B0CK66	GTPase Der	6.74e-04	7.76e-04	1.30e-12	NA
4. PB	B7K1S0	GTPase Der	6.35e-03	9.02e-03	1.99e-16	NA
4. PB	B4SED0	GTPase Der	6.78e-03	3.93e-07	7.36e-13	NA
4. PB	B8GAY7	GTPase Der	9.19e-03	2.82e-05	1.15e-15	NA
4. PB	Q8DF02	GTPase Der	3.06e-04	8.60e-04	4.51e-17	NA
4. PB	Q1CK87	GTPase Der	1.01e-03	2.58e-02	1.93e-14	NA
4. PB	A2RM49	GTPase Der	6.98e-04	3.86e-06	5.62e-15	NA
4. PB	B1X0B0	GTPase Der	1.02e-03	2.81e-03	4.73e-14	NA
4. PB	C3L0M1	GTPase Der	1.59e-03	6.43e-05	1.82e-15	NA
4. PB	C6C0G0	GTPase Der	3.05e-04	1.20e-04	1.45e-15	NA
4. PB	A9AH00	GTPase Der	1.05e-03	4.67e-05	3.60e-16	NA
4. PB	Q3A4Q5	GTPase Der	7.10e-03	8.32e-05	4.40e-12	NA
4. PB	Q0HX53	GTPase Der	2.27e-04	3.00e-02	6.52e-13	NA
4. PB	B8E9T1	GTPase Der	1.86e-04	2.45e-02	2.42e-13	NA
4. PB	Q501Z5	tRNA modification GTPase GTPBP3, mitochondrial	0.00e+00	9.49e-27	1.57e-46	NA
4. PB	P32559	tRNA modification GTPase MSS1, mitochondrial	0.00e+00	5.70e-26	1.33e-54	NA
4. PB	Q895X8	GTPase Der	3.18e-03	1.07e-05	4.31e-13	NA
4. PB	A1W581	GTPase Der	9.64e-04	2.41e-04	3.31e-13	NA
4. PB	B0BUT3	GTPase Der	6.67e-04	9.00e-05	4.79e-10	NA
4. PB	Q72PQ1	GTPase Der	6.10e-04	1.66e-03	1.31e-13	NA
4. PB	A1VNF8	GTPase Der	5.61e-03	1.46e-04	9.56e-13	NA
4. PB	A0KJ48	GTPase Der	6.20e-04	4.86e-05	6.46e-16	NA
4. PB	C4ZD63	GTPase Der	8.04e-04	7.10e-06	2.17e-14	NA
4. PB	Q3ICZ9	GTPase Der	1.41e-04	5.76e-05	1.48e-15	NA
4. PB	Q0TPJ9	GTPase Der	4.32e-03	3.52e-05	3.60e-16	NA
4. PB	Q8Y026	GTPase Der	4.67e-03	6.81e-06	1.12e-14	NA
4. PB	Q7WHN4	GTPase Der	6.40e-04	3.67e-05	1.28e-15	NA
4. PB	Q1MDD6	GTPase Der	3.71e-04	2.62e-03	6.10e-13	NA
4. PB	Q15R60	GTPase Der	3.11e-04	9.18e-03	1.02e-14	NA
4. PB	A7MGU7	GTPase Der	4.58e-03	2.47e-02	3.48e-18	NA
4. PB	Q0BEX1	GTPase Der	3.47e-03	7.24e-05	1.81e-15	NA
4. PB	A4IQA2	GTPase Der	2.42e-03	3.60e-05	3.64e-15	NA
4. PB	B6I583	GTPase Der	7.33e-04	3.05e-02	4.58e-17	NA
4. PB	Q039G4	GTPase Der	1.12e-03	9.18e-05	1.81e-16	NA
4. PB	A4G4K6	GTPase Der	2.49e-04	3.31e-04	6.06e-15	NA
4. PB	A9B567	GTPase Der	1.63e-03	5.23e-04	3.42e-15	NA
4. PB	C1CM45	GTPase Der	5.78e-03	5.13e-06	1.28e-16	NA
4. PB	B1LNG6	GTPase Der	9.63e-04	2.60e-02	4.22e-17	NA
4. PB	A4VX53	GTPase Der	1.09e-03	9.70e-06	8.77e-16	NA
4. PB	B5BAY9	GTPase Der	4.67e-04	2.53e-02	4.00e-17	NA
4. PB	Q5QYB3	GTPase Der	3.81e-04	1.11e-02	3.35e-15	NA
4. PB	Q2K5L2	GTPase Der	4.72e-04	1.49e-03	3.51e-13	NA
4. PB	C4Z0C8	GTPase Der	1.38e-02	2.79e-04	6.70e-15	NA
4. PB	A4JEN6	GTPase Der	3.04e-04	7.76e-05	1.84e-15	NA
4. PB	Q21W32	GTPase Der	3.76e-03	1.84e-03	6.28e-12	NA
4. PB	B4S433	GTPase Der	7.47e-04	1.84e-07	9.50e-15	NA
4. PB	Q9XCI8	GTPase Der	1.30e-03	2.53e-02	4.00e-17	NA
4. PB	A7NAB1	GTPase Der	2.04e-03	1.72e-03	1.64e-14	NA
4. PB	Q9PLM3	GTPase Der	3.79e-04	6.06e-08	2.37e-13	NA
4. PB	C1A8T3	GTPase Der	1.01e-03	1.35e-06	2.24e-14	NA
4. PB	C1EN01	GTPase Der	8.17e-04	6.33e-06	2.94e-13	NA
4. PB	A9R7Z8	GTPase Der	4.60e-04	2.58e-02	1.93e-14	NA
4. PB	B7KHD2	GTPase Der	6.43e-03	4.63e-02	7.40e-15	NA
4. PB	Q4ZX19	GTPase Der	8.84e-04	4.63e-02	4.92e-17	NA
4. PB	Q1LU74	GTPase Der	3.02e-04	2.76e-02	5.87e-15	NA
4. PB	Q2FYG0	GTPase Der	5.71e-04	1.40e-04	7.16e-14	NA
4. PB	B8D8C1	GTPase Der	5.33e-03	2.49e-02	1.19e-08	NA
4. PB	A1BHZ8	GTPase Der	8.52e-04	8.48e-07	1.54e-14	NA
4. PB	A8LYU3	GTPase Der	7.56e-03	4.18e-05	1.01e-09	NA
4. PB	A4W3F7	GTPase Der	2.82e-03	9.70e-06	8.77e-16	NA
4. PB	A1KJD0	GTPase Der	2.22e-03	6.89e-05	8.47e-06	NA
4. PB	Q8EWH6	GTPase Der	4.30e-04	1.06e-04	2.15e-13	NA
4. PB	Q12AC2	GTPase Der	1.30e-03	3.54e-04	4.83e-13	NA
4. PB	A4IXH0	GTPase Der	7.08e-03	2.09e-03	9.06e-15	NA
4. PB	A9BMU9	GTPase Der	2.63e-03	6.43e-05	1.87e-13	NA
4. PB	B2VE93	GTPase Der	2.60e-04	2.05e-02	5.90e-16	NA
4. PB	A5IMD9	GTPase Der	9.41e-04	1.28e-05	9.20e-15	NA
4. PB	B8I442	GTPase Der	8.27e-04	5.01e-05	1.11e-15	NA
4. PB	B7IE34	GTPase Der	2.09e-04	6.31e-07	4.69e-13	NA
4. PB	B5RCY8	GTPase Der	8.74e-04	1.64e-02	4.38e-17	NA
4. PB	Q89MZ0	GTPase Der	2.71e-03	8.65e-06	5.05e-11	NA
4. PB	Q0AE46	GTPase Der	9.18e-04	3.21e-02	7.49e-12	NA
4. PB	C3L9F4	GTPase Der	1.03e-03	6.33e-06	2.94e-13	NA
4. PB	Q38WW3	GTPase Der	5.11e-03	9.18e-05	1.58e-15	NA
4. PB	A0Q534	GTPase Der	3.35e-03	2.46e-03	9.82e-15	NA
4. PB	A0M5P1	GTPase Der	1.33e-03	2.19e-05	7.33e-19	NA
4. PB	Q7NBV2	GTPase Der	3.25e-04	8.26e-03	1.58e-12	NA
4. PB	B4EZS9	GTPase Der	7.65e-03	4.37e-03	1.30e-14	NA
4. PB	C3PPD1	GTPase Der	1.17e-02	1.11e-04	5.56e-10	NA
4. PB	Q2A515	GTPase Der	4.14e-03	1.72e-03	1.64e-14	NA
4. PB	Q8R9J1	GTPase Der	1.33e-03	1.34e-05	1.17e-16	NA
4. PB	Q1JIH4	GTPase Der	5.60e-03	5.76e-06	1.47e-14	NA
4. PB	C6E0Y6	GTPase Der	6.69e-03	8.74e-06	6.68e-13	NA
4. PB	Q1GHZ2	GTPase Der	2.66e-03	3.64e-04	1.62e-11	NA
4. PB	Q7W6Q0	GTPase Der	2.44e-03	3.67e-05	1.28e-15	NA
4. PB	C4XIQ6	GTPase Der	1.44e-04	4.38e-06	1.21e-12	NA
4. PB	B3PVJ6	GTPase Der	3.64e-04	1.32e-03	3.44e-13	NA
4. PB	B2JIU7	GTPase Der	3.62e-03	1.26e-04	1.37e-15	NA
4. PB	B5EE25	GTPase Der	9.08e-04	5.76e-06	1.14e-12	NA
4. PB	B4T0P5	GTPase Der	5.70e-04	2.53e-02	4.00e-17	NA
4. PB	A9KWW9	GTPase Der	2.57e-04	2.45e-02	2.42e-13	NA
4. PB	B2S3S8	GTPase Der	3.80e-03	4.31e-05	1.60e-12	NA
4. PB	B1LBI4	GTPase Der	1.60e-03	1.56e-05	1.00e-15	NA
4. PB	A1SU43	GTPase Der	2.27e-04	2.31e-03	3.34e-15	NA
4. PB	B0TLI8	GTPase Der	1.67e-04	2.49e-02	3.77e-13	NA
4. PB	Q8Z4P6	GTPase Der	2.03e-03	2.19e-02	4.34e-17	NA
4. PB	Q7MT48	GTPase Der	6.41e-03	1.93e-06	7.98e-16	NA
4. PB	Q6AGF6	GTPase Der	5.08e-03	6.40e-03	1.19e-10	NA
4. PB	P0A6P6	GTPase Der	8.68e-04	3.05e-02	4.58e-17	NA
4. PB	Q5E768	GTPase Der	3.17e-04	1.01e-04	1.54e-15	NA
4. PB	Q9PQA7	GTPase Der	8.68e-04	1.16e-05	1.55e-11	NA
4. PB	A5VNV9	GTPase Der	4.72e-04	4.85e-04	3.99e-12	NA
4. PB	C5CIV1	GTPase Der	2.48e-03	7.69e-05	7.58e-20	NA
4. PB	B8F4X7	GTPase Der	2.65e-04	8.21e-04	1.10e-15	NA
4. PB	B0BAF8	GTPase Der	3.40e-04	2.55e-08	2.57e-13	NA
4. PB	A2S2A6	GTPase Der	3.60e-03	1.08e-04	5.15e-15	NA
4. PB	Q04AY6	GTPase Der	4.73e-03	1.44e-05	1.09e-10	NA
4. PB	A7GWZ2	GTPase Der	3.97e-04	8.30e-06	3.03e-11	NA
4. PB	Q0C441	GTPase Der	9.02e-05	3.74e-05	3.44e-11	NA
4. PB	A9IQH4	GTPase Der	2.36e-03	1.67e-04	1.33e-12	NA
4. PB	Q04TV4	GTPase Der	9.18e-04	6.62e-04	6.92e-14	NA
4. PB	B1JT88	GTPase Der	3.41e-04	2.09e-04	1.79e-15	NA
4. PB	A1K3Z3	GTPase Der	4.04e-03	3.54e-04	6.79e-15	NA
4. PB	A7IIE4	GTPase Der	5.36e-04	7.41e-04	2.07e-11	NA
4. PB	Q03MB1	GTPase Der	8.96e-04	3.82e-05	2.11e-15	NA
4. PB	Q49884	GTPase Der	5.56e-03	4.69e-03	9.24e-08	NA
4. PB	A8H249	GTPase Der	2.15e-03	2.39e-02	8.95e-13	NA
4. PB	A9VMB3	GTPase Der	2.70e-03	1.24e-05	3.27e-14	NA
4. PB	Q3J2Y1	GTPase Der	5.72e-04	2.84e-03	3.05e-11	NA
4. PB	Q6G988	GTPase Der	7.72e-04	1.40e-04	7.16e-14	NA
4. PB	Q63US9	GTPase Der	1.06e-03	1.08e-04	5.15e-15	NA
4. PB	Q8NQK6	GTPase Der	3.88e-03	1.02e-02	4.68e-11	NA
4. PB	Q1WTQ4	GTPase Der	6.38e-04	6.14e-04	6.44e-15	NA
4. PB	B8HQE1	GTPase Der	9.70e-04	1.49e-03	6.80e-14	NA
4. PB	B2A4M9	GTPase Der	4.14e-03	5.88e-05	1.35e-13	NA
4. PB	A3MZC1	GTPase Der	2.13e-04	8.08e-05	1.49e-15	NA
4. PB	Q886Y6	GTPase Der	2.94e-03	2.41e-02	5.72e-17	NA
4. PB	B2HRU9	GTPase Der	1.17e-03	6.37e-04	6.65e-08	NA
4. PB	A8FEL8	GTPase Der	5.96e-04	2.68e-05	4.17e-13	NA
4. PB	A8GPH5	GTPase Der	8.59e-04	3.98e-05	2.96e-10	NA
4. PB	Q65I15	GTPase Der	1.69e-03	2.12e-05	6.83e-13	NA
4. PB	B1XLH8	GTPase Der	5.81e-04	1.41e-03	6.80e-14	NA
4. PB	B2J1L2	GTPase Der	2.84e-03	4.48e-02	3.05e-15	NA
4. PB	Q71Y78	GTPase Der	7.62e-04	2.80e-06	1.93e-19	NA
4. PB	B4EAW5	GTPase Der	2.69e-04	6.49e-05	3.53e-15	NA
4. PB	Q3AFV0	GTPase HflX	9.51e-03	4.65e-27	0.012	NA
4. PB	B5YFX9	GTPase Der	3.51e-04	5.06e-07	1.71e-12	NA
4. PB	B1XXK9	GTPase Der	4.56e-04	6.89e-05	3.87e-13	NA
4. PB	P64064	GTPase Der	5.45e-04	9.70e-06	3.24e-14	NA
4. PB	Q5XDR3	GTPase Der	2.17e-03	9.70e-06	3.24e-14	NA
4. PB	Q47BS0	GTPase Der	1.37e-03	4.49e-04	5.83e-14	NA
4. PB	Q14GT5	GTPase Der	3.86e-03	2.14e-03	9.39e-15	NA
4. PB	A7FFZ3	GTPase Der	3.98e-03	2.58e-02	1.93e-14	NA
4. PB	Q8G6A8	GTPase Der	3.47e-04	3.74e-05	5.00e-13	NA
4. PB	B5XJW0	GTPase Der	1.39e-03	9.70e-06	3.24e-14	NA
4. PB	A9KFU3	GTPase Der	1.38e-03	6.02e-04	2.89e-15	NA
4. PB	A5D1U6	GTPase Der	9.27e-04	8.95e-07	1.13e-13	NA
4. PB	A8YV35	GTPase Der	5.01e-03	2.39e-06	2.17e-13	NA
4. PB	B9M914	GTPase Der	4.92e-04	6.62e-05	1.94e-14	NA
4. PB	Q3JZR6	GTPase Der	1.65e-03	2.06e-05	2.23e-15	NA
4. PB	B6IZN3	GTPase Der	4.39e-03	9.18e-04	2.97e-15	NA
4. PB	P44536	GTPase Der	5.22e-04	1.08e-04	1.18e-16	NA
4. PB	Q39T85	GTPase Der	1.10e-03	9.70e-06	3.00e-12	NA
4. PB	Q0SS66	GTPase Der	1.10e-03	3.52e-05	3.60e-16	NA
4. PB	A8Z608	GTPase Der	4.07e-03	2.58e-04	1.04e-11	NA
4. PB	P64062	GTPase Der	5.69e-03	5.13e-06	1.28e-16	NA
4. PB	Q55C52	tRNA modification GTPase gtpbp3, mitochondrial	0.00e+00	3.46e-45	2.29e-48	NA
4. PB	B7JC34	GTPase Der	6.27e-04	8.24e-05	2.64e-15	NA
4. PB	Q8DS90	GTPase Der	3.94e-03	8.84e-06	8.46e-16	NA
4. PB	A1S859	GTPase Der	3.59e-04	6.18e-03	1.44e-13	NA
4. PB	Q68W59	GTPase Der	1.60e-03	9.09e-05	3.42e-10	NA
4. PB	B5EJF7	GTPase Der	1.99e-03	8.24e-05	2.64e-15	NA
4. PB	A8FT74	GTPase Der	2.04e-04	7.12e-03	3.92e-13	NA
4. PB	A0PSX2	GTPase Der	6.74e-04	5.28e-04	6.65e-08	NA
4. PB	Q1CT35	GTPase Der	5.73e-04	6.12e-05	2.35e-10	NA
4. PB	B8G2P9	GTPase Der	1.54e-03	9.00e-05	4.21e-13	NA
4. PB	Q2GA15	GTPase Der	3.32e-04	1.08e-05	1.35e-08	NA
4. PB	Q6G5J7	GTPase Der	3.57e-03	1.53e-04	3.49e-13	NA
4. PB	B9MFY0	GTPase Der	4.80e-03	3.71e-04	3.97e-13	NA
4. PB	A7X2I1	GTPase Der	7.64e-04	1.40e-04	7.16e-14	NA
4. PB	Q92A71	GTPase Der	1.03e-03	4.33e-06	2.17e-20	NA
4. PB	Q1JNC4	GTPase Der	2.03e-03	9.70e-06	3.24e-14	NA
4. PB	Q8F6K1	GTPase Der	1.53e-03	2.35e-03	1.31e-13	NA
4. PB	A1TA72	GTPase Der	4.31e-03	5.65e-05	3.69e-08	NA
4. PB	Q5HP70	GTPase Der	5.61e-04	1.19e-05	1.30e-14	NA
4. PB	Q5N167	GTPase Der	5.34e-04	4.99e-02	1.42e-15	NA
4. PB	B6EGZ1	GTPase Der	4.34e-04	3.34e-04	7.42e-16	NA
4. PB	Q49XS9	GTPase Der	5.27e-04	1.32e-05	2.68e-14	NA
4. PB	P0A6P5	GTPase Der	9.71e-04	3.05e-02	4.58e-17	NA
4. PB	A6WW65	GTPase Der	7.81e-04	9.27e-04	5.20e-13	NA
4. PB	Q6MTJ6	GTPase Der	5.25e-04	3.12e-06	3.46e-15	NA
4. PB	Q1C5J2	GTPase Der	6.03e-04	2.58e-02	1.93e-14	NA
4. PB	A1WE12	GTPase Der	4.91e-03	8.16e-05	1.53e-12	NA
4. PB	B6YQB9	GTPase Der	7.10e-04	1.44e-06	1.86e-11	NA
4. PB	Q2NS44	GTPase Der	6.51e-04	1.42e-03	1.05e-14	NA
4. PB	B8CWY9	GTPase Der	1.26e-03	1.64e-04	1.03e-14	NA
4. PB	A3NA49	GTPase Der	3.28e-03	1.08e-04	5.15e-15	NA
4. PB	B7MHZ6	GTPase Der	3.89e-03	2.90e-02	4.22e-17	NA
4. PB	Q923K4	tRNA modification GTPase GTPBP3, mitochondrial	0.00e+00	7.13e-22	9.89e-36	NA
4. PB	Q969Y2	tRNA modification GTPase GTPBP3, mitochondrial	0.00e+00	6.66e-22	7.91e-42	NA
4. PB	Q821L7	GTPase Der	9.76e-04	2.47e-05	4.68e-15	NA
4. PB	Q169E2	GTPase Der	8.54e-04	1.91e-04	5.93e-10	NA
4. PB	A4VNW7	GTPase Der	7.93e-04	4.37e-02	1.09e-15	NA
4. PB	B2U9V3	GTPase Der	3.39e-03	2.74e-05	2.94e-15	NA
4. PB	Q8CP62	GTPase Der	2.73e-03	1.19e-05	1.30e-14	NA
4. PB	Q3AI13	GTPase Der	3.06e-03	5.86e-04	3.81e-17	NA
4. PB	Q1MS56	GTPase Der	1.11e-03	6.74e-04	3.52e-15	NA
4. PB	Q81FR5	GTPase Der	7.77e-04	6.33e-06	2.94e-13	NA
4. PB	B3WE80	GTPase Der	8.56e-04	9.94e-05	1.70e-16	NA
4. PB	A7HZI3	GTPase Der	7.84e-04	1.51e-05	4.03e-13	NA
4. PB	A0K7T2	GTPase Der	2.52e-03	2.09e-04	1.79e-15	NA
4. PB	Q2FUQ2	tRNA modification GTPase MnmE	0.00e+00	6.73e-77	4.78e-98	NA
4. PB	P9WNL3	GTPase Der	1.11e-03	6.89e-05	8.47e-06	NA
4. PB	C1CFT0	GTPase Der	5.17e-03	5.13e-06	1.28e-16	NA
4. PB	P0DA90	GTPase Der	3.60e-03	1.05e-05	3.01e-14	NA
4. PB	B2G718	GTPase Der	6.29e-04	6.50e-04	5.88e-13	NA
4. PB	B9J7W1	GTPase Der	3.22e-04	2.55e-03	3.91e-12	NA
4. PB	B9E6L5	GTPase Der	4.78e-04	1.69e-05	2.91e-14	NA
4. PB	B8FM51	GTPase Der	8.09e-04	7.39e-05	8.62e-10	NA
4. PB	A6LSI6	GTPase Der	4.06e-03	5.70e-05	7.32e-16	NA
4. PB	B0TFW3	GTPase Der	9.37e-03	1.61e-05	8.25e-16	NA
4. PB	C0ZCB6	GTPase Der	6.88e-04	3.06e-05	2.69e-14	NA
4. PB	Q1BGX0	GTPase Der	2.88e-04	2.09e-04	1.79e-15	NA
4. PB	A6TS39	GTPase Der	1.08e-03	2.74e-05	2.51e-15	NA
4. PB	Q1LLJ5	GTPase Der	2.91e-04	2.63e-05	2.28e-15	NA
4. PB	A8GXR7	GTPase Der	8.08e-04	1.82e-04	1.48e-12	NA
4. PB	A4SDB8	GTPase Der	1.56e-03	2.12e-06	4.28e-14	NA
4. PB	Q2YM98	GTPase Der	3.04e-04	4.29e-04	3.72e-12	NA
4. PB	P57662	GTPase Der	3.73e-03	1.83e-02	1.19e-08	NA
4. PB	A5FIR0	GTPase Der	9.21e-04	8.12e-07	3.92e-19	NA
5. P	Q4A8X1	GTPase Obg	1.47e-01	2.11e-04	NA	NA
5. P	B4U7P8	GTPase Obg	9.33e-02	2.51e-02	NA	NA
5. P	A8GQ55	GTPase Obg	8.51e-02	3.25e-03	NA	NA
5. P	A4IRC7	GTPase Obg	7.99e-02	3.69e-03	NA	NA
5. P	P94478	GTPase HflX	2.43e-02	9.24e-23	NA	NA
5. P	Q73HQ3	GTPase Obg	1.47e-01	3.22e-05	NA	NA
5. P	B0B7Y8	GTPase Obg	9.58e-02	1.48e-02	NA	NA
5. P	D3FTV4	GTPase HflX	4.12e-02	2.47e-22	NA	NA
5. P	C0R5N5	GTPase Obg	9.28e-02	4.06e-05	NA	NA
5. P	Q99TK9	GTPase Obg	8.30e-02	1.28e-03	NA	NA
5. P	Q057J0	GTPase Obg	1.18e-01	1.77e-02	NA	NA
5. P	B1H0I4	GTPase Obg	5.16e-02	1.57e-02	NA	NA
5. P	B8ZPS8	GTPase Obg	1.01e-01	1.03e-02	NA	NA
5. P	Q5N4J6	GTPase Obg	1.47e-01	5.91e-03	NA	NA
5. P	Q3IXX9	GTPase Obg	1.17e-01	1.07e-02	NA	NA
5. P	B3PMC1	GTPase Obg	1.13e-01	5.32e-03	NA	NA
5. P	Q4AAV4	GTPase Obg	2.51e-01	3.54e-04	NA	NA
5. P	Q8FYM2	GTPase Obg	1.32e-01	2.47e-02	NA	NA
5. P	A3DBS5	GTPase Obg	6.12e-02	3.00e-03	NA	NA
5. P	Q8DYL0	GTPase Obg	1.09e-01	3.58e-02	NA	NA
5. P	Q5HNQ7	GTPase Obg	8.31e-02	2.61e-04	NA	NA
5. P	B2SEA8	GTPase Obg	1.63e-01	4.69e-03	NA	NA
5. P	Q89AE7	GTPase Obg	7.25e-02	1.79e-03	NA	NA
5. P	A6Q4D2	GTPase Obg	1.56e-01	5.27e-03	NA	NA
5. P	Q0TNI5	GTPase Obg	8.56e-02	1.11e-02	NA	NA
5. P	A2S5R8	GTPase Obg	1.46e-01	3.60e-05	NA	NA
5. P	B0RY32	GTPase Obg	1.86e-01	6.57e-03	NA	NA
5. P	B3Q731	GTPase Obg	1.84e-01	6.20e-04	NA	NA
5. P	Q88VG4	GTPase Obg	1.09e-01	1.89e-04	NA	NA
5. P	B0S3Z4	GTPase Obg	6.59e-02	6.08e-04	NA	NA
5. P	B0UMS4	GTPase Obg	1.43e-01	6.13e-03	NA	NA
5. P	A4XJS8	GTPase Obg	8.41e-02	1.90e-03	NA	NA
5. P	Q8DUU2	GTPase Obg	1.10e-01	5.86e-03	NA	NA
5. P	Q2GK25	GTPase Obg	3.00e-01	4.74e-03	NA	NA
5. P	Q4FRK6	GTPase Obg	5.98e-02	1.96e-02	NA	NA
5. P	A9WWW9	GTPase Obg	1.02e-01	2.47e-02	NA	NA
5. P	A6T2D5	GTPase Obg	9.27e-02	1.87e-03	NA	NA
5. P	Q8E465	GTPase Obg	8.70e-02	3.58e-02	NA	NA
5. P	Q4US36	GTPase Obg	1.98e-01	6.57e-03	NA	NA
5. P	A6QHI6	GTPase Obg	9.53e-02	1.28e-03	NA	NA
5. P	Q38WT4	GTPase Obg	9.97e-02	9.18e-04	NA	NA
5. P	Q9PAS3	GTPase Obg	1.83e-01	1.05e-02	NA	NA
5. P	B0BC53	GTPase Obg	1.05e-01	1.48e-02	NA	NA
5. P	Q47AD0	GTPase Obg	1.87e-01	9.99e-04	NA	NA
5. P	Q04Q90	GTPase Obg	8.23e-02	4.57e-03	NA	NA
5. P	B4SP14	GTPase Obg	1.16e-01	3.72e-03	NA	NA
5. P	A0Q1T4	GTPase Obg	4.26e-02	1.15e-03	NA	NA
5. P	B6J1S8	GTPase Obg	1.83e-01	2.21e-02	NA	NA
5. P	Q73LW4	GTPase Obg	1.37e-01	1.89e-04	NA	NA
5. P	Q8DEC6	GTPase Obg	1.13e-01	1.19e-02	NA	NA
5. P	A7HT67	GTPase Obg	1.16e-01	1.68e-02	NA	NA
5. P	Q72HR4	GTPase Obg	7.09e-02	8.66e-05	NA	NA
5. P	B4SBR3	GTPase Obg	1.44e-01	1.28e-02	NA	NA
5. P	A9M882	GTPase Obg	1.21e-01	2.47e-02	NA	NA
5. P	Q3KLT5	GTPase Obg	9.30e-02	2.92e-02	NA	NA
5. P	Q04B11	GTPase Obg	1.02e-01	1.27e-02	NA	NA
5. P	Q98EZ3	GTPase Obg	1.35e-01	1.39e-02	NA	NA
5. P	Q8DGG4	GTPase Obg	1.13e-01	2.95e-02	NA	NA
5. P	Q89X89	GTPase Obg	2.41e-01	1.94e-03	NA	NA
5. P	Q82V20	GTPase Obg	1.54e-01	2.78e-02	NA	NA
5. P	A6QB70	GTPase Obg	1.53e-01	1.08e-03	NA	NA
5. P	Q92G19	GTPase Obg	1.57e-01	3.28e-03	NA	NA
5. P	Q2GGS7	GTPase Obg	4.05e-02	2.87e-03	NA	NA
5. P	A8G2M6	GTPase Obg	1.31e-01	2.19e-02	NA	NA
5. P	P25519	GTPase HflX	1.85e-02	5.93e-22	NA	NA
5. P	A0L4B2	GTPase HflX	1.78e-03	3.37e-24	NA	NA
5. P	P72931	GTPase Obg	4.36e-02	4.14e-03	NA	NA
5. P	B2G6R9	GTPase Obg	1.44e-01	4.22e-03	NA	NA
5. P	Q31CW3	GTPase Obg	1.54e-01	1.91e-02	NA	NA
5. P	Q3MCS7	GTPase Obg	1.50e-01	3.29e-02	NA	NA
5. P	A6W352	GTPase Obg	7.67e-02	1.74e-02	NA	NA
5. P	Q5HX70	GTPase Obg	1.93e-01	5.76e-03	NA	NA
5. P	Q65GM7	GTPase Obg	1.16e-01	5.76e-03	NA	NA
5. P	B6JD21	GTPase Obg	1.51e-01	4.58e-04	NA	NA
5. P	B9JER1	GTPase Obg	1.57e-01	2.97e-03	NA	NA
5. P	Q5PAS5	GTPase Obg 1	1.30e-01	1.85e-03	NA	NA
5. P	A5VSI5	GTPase Obg	1.71e-01	2.47e-02	NA	NA
5. P	Q8CNZ7	GTPase Obg	1.18e-01	5.48e-04	NA	NA
5. P	Q97JL4	GTPase Obg	6.45e-02	6.40e-03	NA	NA
5. P	B7J427	GTPase Obg	2.41e-01	2.43e-02	NA	NA
5. P	Q2GDW7	GTPase Obg	1.25e-01	1.26e-03	NA	NA
5. P	A5VYC6	GTPase Obg	6.49e-02	1.96e-02	NA	NA
5. P	Q9ZMD3	GTPase Obg	2.03e-01	2.23e-02	NA	NA
5. P	B1ZL15	GTPase Obg	1.64e-01	7.48e-04	NA	NA
5. P	Q1JLA1	GTPase Obg	9.41e-02	1.28e-03	NA	NA
5. P	Q6DHF7	GTP-binding protein 10	1.87e-01	3.63e-05	NA	NA
5. P	A4WZ45	GTPase Obg	1.06e-01	6.24e-03	NA	NA
5. P	A1TTD3	GTPase Obg	1.38e-01	1.57e-03	NA	NA
5. P	B7IIV2	GTPase Obg	8.34e-02	2.33e-02	NA	NA
5. P	Q0SM73	GTPase Obg	8.84e-02	5.51e-03	NA	NA
5. P	Q30XW0	GTPase Obg	1.03e-01	4.86e-05	NA	NA
5. P	A5VJ99	GTPase Obg	1.29e-01	4.22e-03	NA	NA
5. P	Q6MEQ6	GTPase Obg	1.09e-01	1.30e-02	NA	NA
5. P	B7KSH0	GTPase Obg	1.65e-01	2.69e-03	NA	NA
5. P	Q7MA28	GTPase Obg	1.42e-01	2.07e-03	NA	NA
5. P	A3MR90	GTPase Obg	1.92e-01	3.60e-05	NA	NA
5. P	B0TBW1	GTPase Obg	9.49e-02	3.43e-03	NA	NA
5. P	A6UDV6	GTPase Obg	1.38e-01	2.08e-02	NA	NA
5. P	A9AI60	GTPase Obg	1.51e-01	2.17e-04	NA	NA
5. P	Q0BIH8	GTPase Obg	1.33e-01	3.34e-04	NA	NA
5. P	A7HIF8	GTPase Obg	9.99e-02	2.05e-02	NA	NA
5. P	B2S1C3	GTPase Obg	1.42e-01	7.70e-03	NA	NA
5. P	P0CB41	GTPase Obg	1.25e-01	1.02e-02	NA	NA
5. P	B1LA53	GTPase Obg	5.81e-02	1.28e-03	NA	NA
5. P	Q5FUL2	GTPase Obg	1.08e-01	1.14e-02	NA	NA
5. P	Q892N8	GTPase Obg	8.66e-02	1.29e-03	NA	NA
5. P	Q9ZCB6	GTPase Obg	7.68e-02	4.82e-03	NA	NA
5. P	B2S806	GTPase Obg	1.23e-01	2.47e-02	NA	NA
5. P	B9KIJ7	GTPase Obg 1	1.01e-01	1.07e-03	NA	NA
5. P	B8GYI7	GTPase Obg/CgtA	1.36e-01	1.02e-02	NA	NA
5. P	B4F2A8	GTPase Obg	9.07e-02	1.31e-02	NA	NA
5. P	Q1GSF4	GTPase Obg	1.74e-01	1.43e-03	NA	NA
5. P	Q8P0I6	GTPase Obg	9.36e-02	1.96e-03	NA	NA
5. P	A0Q8K2	GTPase Obg	1.80e-01	7.91e-03	NA	NA
5. P	Q07U75	GTPase Obg	1.85e-01	4.37e-04	NA	NA
5. P	A8Z6G0	GTPase Obg	1.57e-01	7.64e-03	NA	NA
5. P	Q6AK07	GTPase Obg	5.58e-02	2.09e-03	NA	NA
5. P	Q2YLM2	GTPase Obg	1.38e-01	2.47e-02	NA	NA
5. P	Q5LYR4	GTPase Obg	1.08e-01	1.42e-03	NA	NA
5. P	A2SD36	GTPase Obg	1.27e-01	2.33e-03	NA	NA
5. P	Q253F8	GTPase Obg	9.97e-02	1.88e-02	NA	NA
5. P	B7JVH9	GTPase Obg	9.72e-02	2.14e-02	NA	NA
5. P	Q1GHD0	GTPase Obg	1.04e-01	5.00e-03	NA	NA
5. P	Q83ED8	GTPase Obg	1.02e-01	2.21e-02	NA	NA
5. P	Q9WXV3	GTPase Obg	8.44e-02	8.29e-04	NA	NA
5. P	A4IVW3	GTPase Obg	1.61e-01	6.13e-03	NA	NA
5. P	Q5FKH5	GTPase Obg	8.61e-02	5.00e-03	NA	NA
5. P	Q46X17	GTPase Obg	1.40e-01	1.43e-02	NA	NA
5. P	Q63QM0	GTPase Obg	1.46e-01	3.60e-05	NA	NA
5. P	B9DSH7	GTPase Obg	9.74e-02	1.85e-03	NA	NA
5. P	A9VIR5	GTPase Obg	8.12e-02	1.93e-02	NA	NA
5. P	Q2Y807	GTPase Obg	9.68e-02	3.19e-03	NA	NA
5. P	Q04KK7	GTPase Obg	8.65e-02	1.96e-02	NA	NA
5. P	Q7ND61	GTPase Obg	1.62e-01	4.61e-03	NA	NA
5. P	Q72ZY5	GTPase Obg	8.16e-02	3.18e-02	NA	NA
5. P	A8Z2H2	GTPase Obg	9.06e-02	1.28e-03	NA	NA
5. P	B7GIR2	GTPase Obg	9.53e-02	2.56e-04	NA	NA
5. P	A9BK05	GTPase Obg	1.49e-01	3.38e-04	NA	NA
5. P	Q817U6	GTPase Obg	8.19e-02	2.80e-02	NA	NA
5. P	Q2S9T3	GTPase Obg	4.90e-02	2.49e-02	NA	NA
5. P	Q3SVI2	GTPase Obg	6.90e-02	1.54e-03	NA	NA
5. P	B2S3Y1	GTPase Obg	1.46e-01	1.43e-03	NA	NA
5. P	A8Z631	GTPase Obg	6.19e-02	4.67e-02	NA	NA
5. P	A3PAT7	GTPase Obg	1.10e-01	4.63e-02	NA	NA
5. P	Q9KUS8	GTPase Obg/CgtA	1.42e-01	3.08e-03	NA	NA
5. P	Q605N2	GTPase Obg	1.92e-01	1.58e-02	NA	NA
5. P	B2USD4	GTPase Obg	2.53e-01	5.61e-03	NA	NA
5. P	B5RMX3	GTPase Obg	1.25e-01	4.33e-02	NA	NA
5. P	Q2NCX8	GTPase Obg	7.62e-02	6.94e-04	NA	NA
5. P	B0BVJ1	GTPase Obg	1.04e-01	2.84e-03	NA	NA
5. P	O51722	GTPase Obg	9.92e-02	9.59e-03	NA	NA
5. P	Q47VL4	GTPase Obg	1.03e-01	5.18e-03	NA	NA
5. P	Q3K046	GTPase Obg	1.06e-01	3.58e-02	NA	NA
5. P	Q7VZX6	GTPase Obg	1.94e-01	5.41e-03	NA	NA
5. P	P57469	GTPase Obg	1.63e-01	3.18e-02	NA	NA
5. P	B2STC0	GTPase Obg	2.47e-01	1.04e-03	NA	NA
5. P	A2BLW4	GTPase HflX	2.28e-03	5.96e-16	NA	NA
5. P	Q0PC41	GTPase Obg	1.76e-01	8.26e-03	NA	NA
5. P	Q0AKX2	GTPase Obg	7.36e-02	2.20e-03	NA	NA
5. P	Q4UJV1	GTPase Obg	9.94e-02	2.20e-03	NA	NA
5. P	Q11Z03	GTPase Obg	5.53e-02	1.91e-02	NA	NA
5. P	B1HVB2	GTPase Obg	1.01e-01	1.22e-02	NA	NA
5. P	A1AT81	GTPase Obg	2.32e-01	5.97e-03	NA	NA
5. P	B3EP74	GTPase Obg	1.49e-01	6.56e-04	NA	NA
5. P	Q7TUR3	GTPase Obg	1.29e-01	4.52e-02	NA	NA
5. P	Q5LRY4	GTPase Obg	1.37e-01	4.26e-03	NA	NA
5. P	Q99Z94	GTPase Obg	1.04e-01	5.61e-03	NA	NA
5. P	A1VF56	GTPase Obg	9.90e-02	1.46e-04	NA	NA
5. P	Q7A584	GTPase Obg	8.29e-02	1.28e-03	NA	NA
5. P	Q2P5B4	GTPase Obg	1.94e-01	1.04e-03	NA	NA
5. P	A7H029	GTPase Obg	1.66e-01	6.02e-03	NA	NA
5. P	B8D9H2	GTPase Obg	1.37e-01	3.18e-02	NA	NA
5. P	B2FTD3	GTPase Obg	1.91e-01	1.83e-02	NA	NA
5. P	Q03YT6	GTPase Obg	9.29e-02	7.05e-03	NA	NA
5. P	Q5WHS8	GTPase Obg	7.69e-02	5.04e-03	NA	NA
5. P	B5E4J4	GTPase Obg	1.04e-01	9.84e-03	NA	NA
5. P	Q2J3J8	GTPase Obg	1.13e-01	7.69e-04	NA	NA
5. P	P75215	GTPase Obg	6.64e-02	1.28e-03	NA	NA
5. P	Q5GTG3	GTPase Obg	1.72e-01	5.88e-05	NA	NA
5. P	Q2YT86	GTPase Obg	8.62e-02	3.54e-04	NA	NA
5. P	Q72NQ7	GTPase Obg	1.68e-01	3.28e-03	NA	NA
5. P	Q8D279	GTPase Obg	1.44e-01	6.02e-03	NA	NA
5. P	B3R898	GTPase Obg	1.87e-01	4.11e-03	NA	NA
5. P	B2IE44	GTPase Obg	1.18e-01	3.26e-02	NA	NA
5. P	A9NBL5	GTPase Obg	2.19e-01	2.37e-02	NA	NA
5. P	A3NZJ0	GTPase Obg	1.21e-01	3.60e-05	NA	NA
5. P	B0CDA2	GTPase Obg	1.41e-01	2.94e-03	NA	NA
5. P	Q1LIQ0	GTPase Obg	1.36e-01	6.57e-03	NA	NA
5. P	B5Y805	GTPase Obg	5.04e-02	1.09e-05	NA	NA
5. P	B1XT35	GTPase Obg	1.12e-01	9.27e-04	NA	NA
5. P	B1X0M2	GTPase Obg	1.26e-01	1.41e-03	NA	NA
5. P	Q9I7M2	GTP-binding protein 10 homolog	7.39e-02	2.53e-04	NA	NA
5. P	B1N057	GTPase Obg	9.59e-02	3.38e-04	NA	NA
5. P	A7NEQ3	GTPase Obg	1.89e-01	1.05e-02	NA	NA
5. P	B8I179	GTPase Obg	8.98e-02	1.42e-03	NA	NA
5. P	B1JVA1	GTPase Obg	1.06e-01	3.93e-04	NA	NA
5. P	A4VUC8	GTPase Obg	9.60e-02	4.61e-03	NA	NA
5. P	Q31PN0	GTPase Obg	1.49e-01	5.91e-03	NA	NA
5. P	Q980M3	GTPase HflX	6.02e-04	4.89e-11	NA	NA
5. P	A8XGZ9	Methylmalonic aciduria type A homolog, mitochondrial	6.14e-03	3.46e-02	NA	NA
5. P	Q3AF51	GTPase Obg	5.22e-02	4.95e-03	NA	NA
5. P	Q5NR23	GTPase Obg	1.14e-01	3.75e-03	NA	NA
5. P	B2SYV2	GTPase Obg	1.49e-01	1.05e-03	NA	NA
5. P	B7VID5	GTPase Obg	1.61e-01	2.07e-02	NA	NA
5. P	A1SSB6	GTPase Obg	1.05e-01	3.76e-02	NA	NA
5. P	Q2LR77	GTPase Obg	1.21e-01	1.09e-02	NA	NA
5. P	B0S9A3	GTPase Obg	1.91e-01	2.23e-02	NA	NA
5. P	A2RE30	GTPase Obg	1.01e-01	1.56e-03	NA	NA
5. P	Q0BK24	GTPase Obg	1.74e-01	1.05e-02	NA	NA
5. P	A1RY30	GTPase HflX	4.35e-04	1.14e-23	NA	NA
5. P	Q3SKG2	GTPase Obg	1.42e-01	4.09e-04	NA	NA
5. P	Q0AWJ4	GTPase Obg	7.38e-02	3.28e-04	NA	NA
5. P	A8G8Z4	GTPase Obg	1.61e-01	7.91e-03	NA	NA
5. P	Q2K2X6	GTPase Obg	1.41e-01	5.97e-03	NA	NA
5. P	A9IFF9	GTPase Obg	1.08e-01	3.79e-02	NA	NA
5. P	Q1AVU3	GTPase Obg	1.98e-02	1.00e-05	NA	NA
5. P	B3PIU9	GTPase Obg	8.98e-02	4.65e-03	NA	NA
5. P	B0KMF6	GTPase Obg	5.86e-02	3.13e-02	NA	NA
5. P	B1X580	Putative GTPase Obg	1.27e-01	2.51e-02	NA	NA
5. P	Q13U15	GTPase Obg	1.53e-01	2.14e-03	NA	NA
5. P	B9JUH9	GTPase Obg	1.80e-01	1.54e-02	NA	NA
5. P	Q0AAD6	GTPase Obg	1.25e-01	2.43e-03	NA	NA
5. P	Q8XVL0	GTPase Obg	1.09e-01	9.18e-03	NA	NA
5. P	Q98QK8	GTPase Obg	6.76e-02	5.18e-03	NA	NA
5. P	A5FP49	GTPase Obg	2.00e-01	2.84e-04	NA	NA
5. P	A4D1E9	GTP-binding protein 10	8.90e-02	8.83e-05	NA	NA
5. P	B8D7S4	GTPase Obg	1.52e-01	3.18e-02	NA	NA
5. P	A9BP68	GTPase Obg	1.01e-01	8.77e-04	NA	NA
5. P	A1WPR5	GTPase Obg	2.60e-01	5.03e-04	NA	NA
5. P	Q58803	Uncharacterized protein MJ1408	9.11e-04	3.38e-19	NA	NA
5. P	Q5HFB9	GTPase Obg	7.02e-02	1.14e-03	NA	NA
5. P	B9E021	GTPase Obg	4.84e-02	2.81e-03	NA	NA
5. P	O84423	GTPase Obg	9.75e-02	2.39e-02	NA	NA
5. P	Q81LF0	GTPase Obg	7.85e-02	1.76e-02	NA	NA
5. P	Q2NIK0	GTPase Obg	1.22e-01	8.79e-03	NA	NA
5. P	Q1GZ53	GTPase Obg	7.23e-02	8.57e-05	NA	NA
5. P	Q7WQL8	GTPase Obg	1.31e-01	5.41e-03	NA	NA
5. P	Q3J6S0	GTPase Obg	1.70e-01	2.76e-02	NA	NA
5. P	B9DNE7	GTPase Obg	1.04e-01	4.76e-04	NA	NA
5. P	Q03QP2	GTPase Obg	1.07e-01	1.42e-03	NA	NA
5. P	A1VK90	GTPase Obg	1.09e-01	7.48e-04	NA	NA
5. P	Q83NP1	GTPase Obg	1.74e-01	9.84e-03	NA	NA
5. P	Q1JBB7	GTPase Obg	8.34e-02	1.28e-03	NA	NA
5. P	Q8Y6Z3	GTPase Obg	9.08e-02	1.10e-02	NA	NA
5. P	A9FJF8	GTPase Obg	1.45e-01	1.04e-02	NA	NA
5. P	A6U2B2	GTPase Obg	7.69e-02	1.28e-03	NA	NA
5. P	A4J7I9	GTPase Obg	9.72e-02	6.13e-03	NA	NA
5. P	B3WE52	GTPase Obg	1.00e-01	2.64e-03	NA	NA
5. P	Q5JGB4	GTPase HflX	3.17e-03	1.16e-23	NA	NA
5. P	B7HQJ8	GTPase Obg	6.50e-02	2.55e-02	NA	NA
5. P	B2I6V6	GTPase Obg	2.09e-01	1.50e-02	NA	NA
5. P	Q7W1P2	GTPase Obg	2.18e-01	5.41e-03	NA	NA
5. P	Q6F9D8	GTPase Obg	7.14e-02	1.21e-02	NA	NA
5. P	Q1MA76	GTPase Obg	1.31e-01	1.54e-03	NA	NA
5. P	Q3MHG6	GTP-binding protein 10	8.15e-02	9.94e-05	NA	NA
5. P	Q0WTB4	GTP-binding protein At3g49725, chloroplastic	6.17e-02	6.35e-03	NA	NA
5. P	B0K414	GTPase Obg	8.89e-02	2.19e-02	NA	NA
5. P	Q8K013	GTP-binding protein 10	1.03e-01	4.82e-03	NA	NA
5. P	Q8RBA5	GTPase Obg	8.56e-02	1.95e-02	NA	NA
5. P	Q9Z873	GTPase HflX	1.49e-02	1.46e-16	NA	NA
5. P	A5FV29	GTPase Obg	1.28e-01	2.22e-03	NA	NA
5. P	B2IYX1	GTPase Obg	2.04e-01	1.64e-02	NA	NA
5. P	B6JKN2	GTPase Obg	2.50e-01	2.67e-03	NA	NA
5. P	A8AWM9	GTPase Obg	9.55e-02	2.35e-02	NA	NA
5. P	A9AXD9	GTPase Obg	5.06e-02	3.45e-05	NA	NA
5. P	B5YJ65	GTPase Obg	1.83e-01	1.74e-02	NA	NA
5. P	B2UCV3	GTPase Obg	1.42e-01	2.43e-02	NA	NA
5. P	Q2RKZ8	GTPase Obg	8.66e-02	6.20e-04	NA	NA
5. P	A3CM33	GTPase Obg	1.05e-01	2.71e-02	NA	NA
5. P	Q165Y6	GTPase Obg	1.72e-01	4.74e-03	NA	NA
5. P	B6EL43	GTPase Obg	1.64e-01	4.26e-02	NA	NA
5. P	B9LC30	GTPase Obg	7.93e-02	4.54e-04	NA	NA
5. P	B5ZA69	GTPase Obg	2.62e-01	2.22e-03	NA	NA
5. P	A9A623	GTPase HflX	1.76e-03	9.58e-20	NA	NA
5. P	Q4A6N4	GTPase Obg	1.32e-01	2.97e-03	NA	NA
5. P	Q30QP0	GTPase Obg	2.28e-01	1.88e-02	NA	NA
5. P	Q5WTF1	GTPase Obg	1.09e-01	3.95e-02	NA	NA
5. P	Q6MGS5	GTPase Obg	9.73e-02	5.22e-03	NA	NA
5. P	Q0K6P6	GTPase Obg	1.45e-01	9.26e-03	NA	NA
5. P	B9IZ16	GTPase Obg	8.43e-02	1.48e-02	NA	NA
5. P	A3PQJ0	GTPase Obg	1.06e-01	1.07e-02	NA	NA
5. P	Q67SC6	GTPase Obg	8.77e-02	2.21e-05	NA	NA
5. P	C0QLE9	GTPase Obg	1.03e-01	9.71e-04	NA	NA
5. P	Q0VSE6	GTPase Obg	5.32e-02	1.08e-02	NA	NA
5. P	Q5F5D9	GTPase Obg	9.86e-02	2.22e-03	NA	NA
5. P	A9VYM4	GTPase Obg	1.66e-01	2.69e-03	NA	NA
5. P	Q5HB45	GTPase Obg	1.16e-01	7.18e-03	NA	NA
5. P	B8FM68	GTPase Obg	1.68e-01	2.37e-03	NA	NA
5. P	B8EQH4	GTPase Obg	1.65e-01	3.31e-03	NA	NA
5. P	C3M9X9	GTPase Obg	1.69e-01	8.05e-03	NA	NA
5. P	A5IKX2	GTPase Obg	5.14e-02	1.37e-03	NA	NA
5. P	P0DB52	GTPase Obg	1.00e-01	2.24e-03	NA	NA
5. P	Q8PBH0	GTPase Obg	1.88e-01	6.57e-03	NA	NA
5. P	B3PRZ3	GTPase Obg	1.54e-01	9.02e-03	NA	NA
5. P	Q73J26	GTPase HflX	8.12e-04	1.15e-06	NA	NA
5. P	B7HE73	GTPase Obg	8.96e-02	3.43e-02	NA	NA
5. P	Q5XBM1	GTPase Obg	9.25e-02	1.75e-03	NA	NA
5. P	Q1MQQ1	GTPase Obg	6.79e-02	3.56e-03	NA	NA
5. P	Q1GAM3	GTPase Obg	9.62e-02	1.16e-02	NA	NA
5. P	Q7NZS1	GTPase Obg	1.13e-01	2.71e-03	NA	NA
5. P	A0LPF9	GTPase Obg	1.82e-01	1.10e-03	NA	NA
5. P	Q0I442	GTPase HflX	9.71e-03	8.69e-28	NA	NA
5. P	Q2JS78	GTPase Obg	1.86e-01	4.54e-04	NA	NA
5. P	B3QZT1	GTPase Obg	1.09e-01	3.93e-04	NA	NA
5. P	Q7MYX6	GTPase Obg	1.16e-01	1.36e-03	NA	NA
5. P	A6GZB7	GTPase Obg	1.52e-01	3.92e-02	NA	NA
5. P	A5E965	GTPase Obg	1.11e-01	1.66e-03	NA	NA
5. P	Q6HD85	GTPase Obg	6.33e-02	2.43e-02	NA	NA
5. P	Q1RGV9	GTPase Obg	9.36e-02	2.31e-03	NA	NA
5. P	A0M5C6	GTPase Obg	1.39e-01	4.37e-02	NA	NA
5. P	Q8YQT0	GTPase Obg	1.84e-01	4.44e-02	NA	NA
5. P	A0RJ47	GTPase Obg	7.72e-02	2.43e-02	NA	NA
5. P	B2JHD7	GTPase Obg	1.19e-01	8.93e-04	NA	NA
5. P	Q02XY2	GTPase Obg	1.09e-01	8.79e-03	NA	NA
5. P	B9MRB8	GTPase Obg	5.64e-02	3.56e-03	NA	NA
5. P	A1WY48	GTPase Obg	2.11e-01	5.41e-03	NA	NA
5. P	Q97QW8	GTPase Obg	1.16e-01	9.84e-03	NA	NA
5. P	B6IQZ9	GTPase Obg	1.26e-01	2.43e-03	NA	NA
5. P	A4W0M2	GTPase Obg	8.36e-02	3.96e-03	NA	NA
5. P	C0QUB5	GTPase Obg	1.92e-01	7.98e-03	NA	NA
5. P	Q49Y82	GTPase Obg	9.25e-02	4.29e-03	NA	NA
5. P	B0JI21	GTPase Obg	2.61e-01	4.67e-04	NA	NA
5. P	B1Y280	GTPase Obg	1.54e-01	8.41e-03	NA	NA
5. P	B2UPE7	GTPase HflX	6.30e-04	2.69e-22	NA	NA
5. P	B9MDZ7	GTPase Obg	2.11e-01	4.85e-04	NA	NA
5. P	Q6G8S5	GTPase Obg	8.68e-02	1.28e-03	NA	NA
5. P	B9L605	GTPase Obg	1.50e-01	4.85e-04	NA	NA
5. P	P20964	GTPase Obg	9.47e-02	2.07e-02	NA	NA
5. P	A2BP15	GTPase Obg	1.18e-01	1.61e-02	NA	NA
5. P	Q7A0Q3	GTPase Obg	9.25e-02	1.28e-03	NA	NA
5. P	Q11CP6	GTPase Obg	1.10e-01	9.93e-03	NA	NA
5. P	A9WK62	GTPase Obg	1.83e-01	4.54e-04	NA	NA
5. P	A2RJQ6	GTPase Obg	1.07e-01	4.82e-03	NA	NA
5. P	Q7MP92	GTPase Obg	1.45e-01	6.57e-03	NA	NA
5. P	Q57B45	GTPase Obg	1.02e-01	2.47e-02	NA	NA
5. P	A1KWG2	GTPase Obg	8.69e-02	1.71e-03	NA	NA
5. P	A9KMF5	GTPase Obg	8.62e-02	1.41e-03	NA	NA
5. P	Q39JU7	GTPase Obg	1.48e-01	2.92e-04	NA	NA
5. P	P0DB53	GTPase Obg	1.07e-01	2.24e-03	NA	NA
5. P	A5D410	GTPase Obg	8.49e-02	2.63e-04	NA	NA
5. P	O83724	GTPase Obg	1.82e-01	1.43e-03	NA	NA
5. P	Q2G983	GTPase Obg	1.11e-01	1.90e-03	NA	NA
5. P	C1ETN7	GTPase Obg	1.00e-01	2.43e-02	NA	NA
5. P	Q0AHG5	GTPase Obg	1.61e-01	4.37e-03	NA	NA
5. P	B5RQB8	GTPase Obg	1.51e-01	3.43e-02	NA	NA
5. P	Q5M3C8	GTPase Obg	1.26e-01	1.42e-03	NA	NA
5. P	Q6YRC6	GTPase Obg	1.22e-01	9.89e-04	NA	NA
5. P	A4G8R4	GTPase Obg	5.74e-02	8.60e-04	NA	NA
5. P	A9NF57	GTPase Obg	8.01e-02	1.57e-03	NA	NA
5. P	Q5SHE9	GTPase Obg	7.29e-02	1.00e-04	NA	NA
5. P	Q5H2E5	GTPase Obg	2.22e-01	1.04e-03	NA	NA
5. P	A4SVA3	GTPase Obg	9.41e-02	7.57e-03	NA	NA
5. P	Q9JXE5	GTPase Obg	5.96e-02	2.20e-03	NA	NA
5. P	Q8RAS5	GTPase HflX	7.77e-03	1.44e-21	NA	NA
5. P	B0KAB8	GTPase Obg	7.72e-02	2.19e-02	NA	NA
5. P	Q2NW34	GTPase Obg	6.66e-02	2.25e-02	NA	NA
5. P	A8MHK8	GTPase Obg	9.13e-02	1.27e-03	NA	NA
5. P	Q6MTG9	GTPase Obg	1.18e-01	7.07e-04	NA	NA
5. P	A7HJZ8	GTPase Obg	9.18e-02	2.09e-04	NA	NA
5. P	Q83MU8	GTPase Obg	1.98e-01	2.14e-03	NA	NA
5. P	Q21YZ9	GTPase Obg	9.49e-02	5.13e-03	NA	NA
5. P	B2IQ29	GTPase Obg	8.44e-02	1.17e-02	NA	NA
5. P	B4RD64	GTPase Obg	1.08e-01	2.55e-02	NA	NA
5. P	B8GA36	GTPase Obg	1.18e-01	1.03e-03	NA	NA
5. P	A5EVP4	GTPase Obg	1.44e-01	4.49e-03	NA	NA
5. P	B9KW04	GTPase Obg	1.08e-01	9.84e-03	NA	NA
5. P	Q2A1B4	GTPase Obg	1.76e-01	1.05e-02	NA	NA
5. P	Q6F0U3	GTPase Obg	1.06e-01	1.79e-02	NA	NA
5. P	Q1JGD5	GTPase Obg	9.73e-02	8.06e-04	NA	NA
5. P	B8CXZ0	GTPase Obg	9.34e-02	2.21e-05	NA	NA
5. P	B1ILY5	GTPase Obg	2.89e-02	4.16e-02	NA	NA
5. P	Q1IVS5	GTPase Obg	1.91e-01	1.07e-03	NA	NA
5. P	Q3ZAJ2	GTPase Obg	1.98e-01	7.00e-04	NA	NA
5. P	A1W4B0	GTPase Obg	2.23e-01	5.28e-04	NA	NA
5. P	Q1QQU0	GTPase Obg	1.74e-01	2.18e-03	NA	NA
5. P	A7GHK2	GTPase Obg	3.47e-02	2.60e-02	NA	NA
5. P	Q7CW97	GTPase Obg	2.32e-01	5.51e-03	NA	NA
5. P	Q1QA43	GTPase Obg	4.98e-02	3.21e-02	NA	NA
5. P	Q5FH94	GTPase Obg	1.15e-01	1.02e-02	NA	NA
5. P	A4SCP4	GTPase Obg	1.40e-01	3.15e-02	NA	NA
5. P	Q03JJ8	GTPase Obg	1.00e-01	1.42e-03	NA	NA
5. P	Q1IW72	GTPase Obg	9.28e-02	7.84e-04	NA	NA
5. P	A8HS51	GTPase Obg	1.49e-01	1.94e-03	NA	NA
5. P	Q5U528	GTP-binding protein 10	1.28e-01	8.37e-04	NA	NA
5. P	B8DRN9	GTPase Obg	1.28e-01	7.50e-03	NA	NA
5. P	Q5M8V6	GTP-binding protein 10	8.32e-02	7.55e-04	NA	NA
5. P	A1B9C8	GTPase Obg	1.47e-01	3.58e-02	NA	NA
5. P	A7IH06	GTPase Obg	1.92e-01	7.84e-04	NA	NA
5. P	B0SRT7	GTPase Obg	9.00e-02	2.23e-02	NA	NA
5. P	Q14FR3	GTPase Obg	1.45e-01	7.44e-03	NA	NA
5. P	Q7U4Y5	GTPase Obg	1.61e-01	2.49e-02	NA	NA
5. P	Q18B27	GTPase Obg	7.68e-02	3.61e-02	NA	NA
5. P	Q13DL7	GTPase Obg	1.19e-01	7.07e-04	NA	NA
5. P	A8F478	GTPase Obg	9.85e-02	1.45e-03	NA	NA
5. P	A8GTZ9	GTPase Obg	9.21e-02	2.84e-03	NA	NA
5. P	A5VD74	GTPase Obg	6.88e-02	3.62e-03	NA	NA
5. P	Q6KHM2	GTPase Obg	1.01e-01	1.63e-05	NA	NA
5. P	C0MDB4	GTPase Obg	8.73e-02	2.39e-03	NA	NA
5. P	A5ITG8	GTPase Obg	1.12e-01	1.28e-03	NA	NA
5. P	C0MBS1	GTPase Obg	8.43e-02	4.65e-03	NA	NA
5. P	B8FUR9	GTPase Obg	1.07e-01	4.16e-04	NA	NA
5. P	A3NDS7	GTPase Obg	1.90e-01	5.01e-05	NA	NA
5. P	A9H0F1	GTPase Obg	1.03e-01	4.49e-03	NA	NA
5. P	Q24SP0	GTPase Obg	1.13e-01	6.26e-04	NA	NA
5. P	B1I5V8	GTPase Obg	1.00e-01	2.78e-02	NA	NA
5. P	Q3APF4	GTPase Obg	1.56e-01	1.42e-02	NA	NA
5. P	A7X361	GTPase Obg	8.78e-02	1.28e-03	NA	NA
5. P	Q05473	MIOREX complex component 8	2.39e-03	1.00e-02	NA	NA
5. P	B4E5X0	GTPase Obg	1.59e-01	3.90e-04	NA	NA
5. P	Q5KWP5	GTPase Obg	6.64e-02	3.34e-03	NA	NA
5. P	Q6GG60	GTPase Obg	8.19e-02	8.77e-04	NA	NA
5. P	B8DHL1	GTPase Obg	7.79e-02	1.10e-02	NA	NA
5. P	A5CX17	GTPase Obg	9.56e-02	8.56e-03	NA	NA
5. P	Q6G4Z2	GTPase Obg	1.66e-01	4.44e-02	NA	NA
5. P	Q2FG83	GTPase Obg	8.18e-02	1.28e-03	NA	NA
5. P	A7H1H0	GTPase Obg	2.99e-01	3.28e-03	NA	NA
5. P	C1F407	GTPase HflX	1.36e-02	5.77e-21	NA	NA
5. P	Q2JJ90	GTPase Obg	1.12e-01	4.37e-03	NA	NA
5. P	Q1R0C0	GTPase Obg	1.75e-01	3.55e-02	NA	NA
5. P	Q8DPV8	GTPase Obg	9.01e-02	1.96e-02	NA	NA
5. P	A8F063	GTPase Obg	1.25e-01	5.76e-03	NA	NA
5. P	B5XLZ0	GTPase Obg	9.31e-02	8.68e-04	NA	NA
5. P	Q12F99	GTPase Obg	1.07e-01	3.72e-03	NA	NA
5. P	Q1WT46	GTPase Obg	9.85e-02	7.14e-04	NA	NA
5. P	Q8XIJ2	GTPase Obg	5.86e-02	1.11e-02	NA	NA
5. P	Q0SR54	GTPase Obg	6.53e-02	1.11e-02	NA	NA
5. P	O25074	GTPase Obg	2.53e-01	7.12e-03	NA	NA
5. P	Q71ZD3	GTPase Obg	8.69e-02	1.10e-02	NA	NA
5. P	Q2FXT1	GTPase Obg	7.49e-02	1.28e-03	NA	NA
5. P	B5ELU2	GTPase Obg	1.61e-01	2.43e-02	NA	NA
5. P	A1R0K4	GTPase Obg	1.51e-01	9.34e-03	NA	NA
5. P	A9KEJ7	GTPase Obg	2.38e-01	2.21e-02	NA	NA
5. P	Q3U6U5	Putative GTP-binding protein 6	6.52e-03	2.14e-05	NA	NA
5. P	Q7UVH6	GTPase Obg	1.05e-01	2.35e-02	NA	NA
5. P	B1VAF2	GTPase Obg	6.44e-02	1.42e-02	NA	NA
5. P	Q3BW46	GTPase Obg	2.41e-01	5.91e-04	NA	NA
5. P	Q7V368	GTPase Obg	1.79e-01	4.23e-02	NA	NA
5. P	A5WFV1	GTPase Obg	2.56e-02	1.08e-02	NA	NA
5. P	Q87BL2	GTPase Obg	1.51e-01	1.50e-02	NA	NA
5. P	Q602A7	GTPase Obg	1.38e-01	2.76e-04	NA	NA
5. P	Q3AV08	GTPase Obg	1.70e-01	2.23e-02	NA	NA
5. P	Q9KDK0	GTPase Obg	1.09e-01	4.45e-03	NA	NA
5. P	A4JBB8	GTPase Obg	1.52e-01	1.23e-04	NA	NA
5. P	Q6G0S8	GTPase Obg	1.15e-01	3.79e-02	NA	NA
5. P	Q8PN23	GTPase Obg	2.11e-01	4.67e-04	NA	NA
5. P	B2UQ30	GTPase Obg	6.30e-02	3.18e-02	NA	NA
5. P	A6TQJ6	GTPase Obg	1.00e-01	4.85e-04	NA	NA
5. P	Q2L062	GTPase Obg	1.65e-01	4.55e-02	NA	NA
5. P	B0U3R3	GTPase Obg	1.73e-01	5.36e-03	NA	NA
5. P	B7J0M7	GTPase Obg	7.72e-02	9.59e-03	NA	NA
5. P	A0AIY6	GTPase Obg	8.51e-02	1.82e-02	NA	NA
5. P	Q92LB4	GTPase Obg	2.02e-01	2.10e-02	NA	NA
5. P	Q1BZE0	GTPase Obg	1.58e-01	3.90e-04	NA	NA
5. P	A8GUG0	GTPase Obg	9.98e-02	2.31e-03	NA	NA
5. P	A5GQQ5	GTPase Obg	1.39e-01	7.91e-03	NA	NA
5. P	B7JQ26	GTPase Obg	8.99e-02	1.65e-02	NA	NA
5. P	B9K736	GTPase Obg	9.66e-02	3.58e-02	NA	NA
5. P	Q04EZ8	GTPase Obg	1.39e-01	4.85e-04	NA	NA
5. P	A9M061	GTPase Obg	1.00e-01	2.22e-03	NA	NA
5. P	Q65ZZ3	GTPase Obg	9.74e-02	6.81e-03	NA	NA
5. P	Q58526	GTPase HflX	2.99e-04	1.75e-23	NA	NA
5. P	Q2SZG0	GTPase Obg	1.12e-01	1.65e-04	NA	NA
5. P	Q21D04	GTPase Obg	2.34e-01	1.87e-03	NA	NA
5. P	Q9PJX7	GTPase Obg	1.36e-01	1.32e-02	NA	NA
5. P	Q31IT4	GTPase Obg	1.55e-01	1.71e-02	NA	NA
5. P	B1YSU7	GTPase Obg	1.39e-01	3.38e-04	NA	NA
5. P	A8F2Y3	GTPase Obg	9.63e-02	4.74e-03	NA	NA
5. P	Q3YRX8	GTPase Obg	9.62e-02	1.10e-02	NA	NA
5. P	Q8YJ80	GTPase Obg	1.81e-01	2.47e-02	NA	NA
5. P	Q48SX8	GTPase Obg	9.00e-02	3.69e-03	NA	NA
5. P	B3E609	GTPase Obg	1.55e-01	5.32e-03	NA	NA
5. P	B1IBL9	GTPase Obg	1.02e-01	1.23e-02	NA	NA
5. P	Q0BRE9	GTPase Obg	1.46e-01	2.43e-03	NA	NA
5. P	Q1LSJ9	GTPase Obg	1.18e-01	2.21e-02	NA	NA
5. P	A8FJQ1	GTPase Obg	1.54e-01	6.18e-03	NA	NA
5. P	B4U3Q7	GTPase Obg	9.25e-02	1.10e-02	NA	NA
5. P	Q9Z808	GTPase Obg	1.09e-01	2.49e-02	NA	NA
5. P	Q3B6H6	GTPase Obg	1.72e-01	6.35e-03	NA	NA
5. P	B4RQP4	GTPase Obg	1.06e-01	2.22e-03	NA	NA
5. P	Q39QR4	GTPase Obg	1.25e-01	2.33e-02	NA	NA
5. P	A5UZ80	GTPase Obg	7.53e-02	3.28e-04	NA	NA
5. P	A7I166	GTPase Obg	1.72e-01	1.20e-03	NA	NA
5. P	A8ZRY1	GTPase Obg	1.10e-01	1.16e-02	NA	NA
5. P	A6H294	GTPase HflX	1.47e-02	1.10e-21	NA	NA
5. P	B5YEQ1	GTPase Obg	9.26e-02	2.62e-02	NA	NA
5. P	B8HU67	GTPase Obg	1.59e-01	3.22e-04	NA	NA
5. P	A8LK09	GTPase Obg	1.13e-01	3.43e-03	NA	NA
5. P	Q9RY66	GTPase Obg	6.58e-02	3.00e-03	NA	NA
5. P	Q634A3	GTPase Obg	8.22e-02	2.43e-02	NA	NA
5. P	Q68VS1	GTPase Obg	1.00e-01	5.22e-03	NA	NA
5. P	B5E958	GTPase Obg	1.99e-01	1.98e-02	NA	NA
5. P	Q2SRV9	GTPase Obg	7.16e-02	1.36e-03	NA	NA
5. P	A5IYU8	GTPase Obg	9.01e-02	6.31e-04	NA	NA
5. P	B3CNP2	GTPase Obg	1.42e-01	5.69e-04	NA	NA
5. P	Q72DK0	GTPase Obg	1.45e-01	1.46e-04	NA	NA
5. P	A6LJZ0	GTPase Obg	7.58e-02	1.54e-04	NA	NA
5. P	Q88Q08	GTPase Obg	6.31e-02	1.96e-02	NA	NA
5. P	B1YJR9	GTPase Obg	9.50e-02	2.69e-03	NA	NA
5. P	A1V0P1	GTPase Obg	1.36e-01	3.60e-05	NA	NA
5. P	B0TWK7	GTPase Obg	1.87e-01	9.76e-03	NA	NA
5. P	Q039J3	GTPase Obg	8.85e-02	2.24e-03	NA	NA
5. P	Q10XA1	GTPase Obg	1.47e-01	4.37e-03	NA	NA
5. P	Q824F3	GTPase Obg	6.46e-02	2.83e-02	NA	NA
5. P	Q3JNG0	GTPase Obg	1.76e-01	3.60e-05	NA	NA
5. P	Q1J652	GTPase Obg	9.58e-02	1.64e-03	NA	NA
5. P	B8GQQ3	GTPase Obg	1.74e-01	1.20e-02	NA	NA
5. P	P47624	GTPase Obg	1.65e-01	5.91e-03	NA	NA
5. P	B7KIC1	GTPase Obg	7.87e-02	5.00e-03	NA	NA
5. P	B8IEL9	GTPase Obg	1.80e-01	3.28e-03	NA	NA
5. P	A1IPH6	GTPase Obg	9.53e-02	1.19e-03	NA	NA
5. P	B7IGK8	GTPase Obg	1.09e-01	3.34e-04	NA	NA
5. P	Q1IF13	GTPase Obg	6.02e-02	3.21e-02	NA	NA
5. P	B1M697	GTPase Obg	1.51e-01	1.33e-02	NA	NA
5. P	Q8F7U0	GTPase Obg	1.15e-01	3.28e-03	NA	NA
5. P	Q5NEB0	GTPase Obg	1.62e-01	7.44e-03	NA	NA
5. P	B0T310	GTPase Obg	1.70e-01	4.45e-03	NA	NA
5. P	Q747Q2	GTPase Obg	1.15e-01	1.11e-02	NA	NA
5. P	Q6NDE6	GTPase Obg	1.59e-01	3.90e-04	NA	NA
5. P	Q8RHS8	GTPase Obg	6.95e-02	4.74e-03	NA	NA
5. P	Q62GV4	GTPase Obg	1.58e-01	3.60e-05	NA	NA
5. P	Q7NB30	GTPase Obg	7.98e-02	1.62e-04	NA	NA
5. P	B5ZUE3	GTPase Obg	1.62e-01	1.24e-02	NA	NA
5. P	Q9CF94	GTPase Obg	8.47e-02	1.19e-02	NA	NA
5. P	A1VXH9	GTPase Obg	2.23e-01	1.54e-02	NA	NA
5. P	A4YKF3	GTPase Obg	1.31e-01	2.94e-03	NA	NA
5. P	Q29K06	GTP-binding protein 10 homolog	8.01e-02	1.72e-04	NA	NA
5. P	B3EHE6	GTPase Obg	1.62e-01	1.71e-02	NA	NA
5. P	B9M3W3	GTPase Obg	1.78e-01	9.34e-03	NA	NA
5. P	Q92BH7	GTPase Obg	8.18e-02	1.45e-02	NA	NA
5. P	Q1CUK0	GTPase Obg	2.06e-01	5.22e-03	NA	NA
5. P	Q3ZW89	GTPase Obg	1.85e-01	2.84e-04	NA	NA
5. P	Q4FP46	GTPase Obg	2.83e-01	7.37e-03	NA	NA
5. P	Q0BZ39	GTPase Obg	1.57e-01	3.16e-03	NA	NA
5. P	Q834V4	GTPase Obg	1.01e-01	2.76e-03	NA	NA
5. P	Q17Y93	GTPase Obg	2.00e-01	4.82e-03	NA	NA
5. P	B8E0B2	GTPase Obg	7.23e-02	2.76e-02	NA	NA
5. P	A7NRU6	GTPase Obg	6.74e-02	3.61e-04	NA	NA
5. P	A6WXS0	GTPase Obg	1.15e-01	2.53e-02	NA	NA
5. P	A8YV14	GTPase Obg	8.72e-02	1.39e-02	NA	NA
5. P	B9KER3	GTPase Obg	1.74e-01	1.70e-02	NA	NA
5. P	Q4L6Y9	GTPase Obg	9.40e-02	3.04e-04	NA	NA
5. P	Q3A1D8	GTPase Obg	1.11e-01	4.67e-04	NA	NA
5. P	Q054P6	GTPase Obg	1.26e-01	4.57e-03	NA	NA
5. P	E0RQS7	GTPase HflX	1.46e-02	6.92e-23	NA	NA
5. P	Q03F34	GTPase Obg	9.20e-02	9.67e-03	NA	NA
5. P	A0K4B0	GTPase Obg	1.08e-01	3.93e-04	NA	NA
6. F	A8LLE0	GTPase Era	5.25e-04	NA	NA	0.5004
7. B	A7H4G2	Probable GTP-binding protein EngB	2.45e-05	NA	0.002	NA
7. B	Q8Z4K5	GTPase Era	1.03e-03	NA	0.015	NA
7. B	A1APR8	GTPase Era	1.42e-03	NA	6.30e-07	NA
7. B	Q8DDQ8	Probable GTP-binding protein EngB	5.07e-02	NA	0.039	NA
7. B	Q0SRG1	GTPase Era	3.01e-04	NA	3.73e-07	NA
7. B	A8GM60	Probable GTP-binding protein EngB	2.44e-02	NA	0.011	NA
7. B	B0KV26	GTPase Era	7.47e-04	NA	0.001	NA
7. B	B8ZP66	GTPase Era	5.42e-04	NA	5.16e-10	NA
7. B	B7MYJ7	GTPase Era	1.06e-03	NA	0.010	NA
7. B	B8I736	GTPase Era	3.32e-04	NA	1.62e-09	NA
7. B	Q66GG3	Probable GTP-binding protein EngB	1.41e-02	NA	0.015	NA
7. B	C5D8U8	Ribosome biogenesis GTPase A	7.75e-02	NA	0.026	NA
7. B	Q9PQM5	Probable GTP-binding protein EngB	1.12e-03	NA	0.045	NA
7. B	Q5XDG3	GTPase Era	4.27e-04	NA	1.17e-08	NA
7. B	Q7VNY0	Probable GTP-binding protein EngB	1.04e-02	NA	0.011	NA
7. B	B9KIV1	Probable GTP-binding protein EngB	9.80e-05	NA	0.005	NA
7. B	A2BPL9	GTPase Der	7.29e-04	NA	1.06e-11	NA
7. B	B9KGA1	GTPase Era	7.01e-04	NA	1.49e-06	NA
7. B	P64084	GTPase Era	3.36e-04	NA	4.45e-11	NA
7. B	Q2KWX8	GTPase Era	6.02e-04	NA	1.24e-04	NA
7. B	Q038T2	GTPase Era	3.58e-04	NA	1.16e-07	NA
7. B	B1JR12	Probable GTP-binding protein EngB	1.65e-02	NA	0.015	NA
7. B	Q7MQ23	Probable GTP-binding protein EngB	5.65e-02	NA	0.042	NA
7. B	Q9ZG89	GTP-binding protein EngB	1.56e-02	NA	0.018	NA
7. B	A4TKX7	GTPase Era	1.17e-03	NA	0.004	NA
7. B	B3QS35	Probable GTP-binding protein EngB	8.71e-03	NA	0.005	NA
7. B	B5XK74	GTPase Era	3.90e-04	NA	1.17e-08	NA
7. B	B0RT56	GTPase Der	2.29e-03	NA	3.82e-11	NA
7. B	Q4A5B4	Probable GTP-binding protein EngB	2.22e-02	NA	1.09e-06	NA
7. B	B8H1E7	Probable GTP-binding protein EngB	1.64e-02	NA	0.018	NA
7. B	A4YWC7	GTPase Era	2.31e-04	NA	5.38e-05	NA
7. B	B8F3C8	GTPase Era	8.05e-04	NA	0.001	NA
7. B	Q48UW6	GTPase Era	3.87e-04	NA	1.17e-08	NA
7. B	Q1I5V9	GTPase Era	8.28e-04	NA	0.001	NA
7. B	Q0TQK6	Probable GTP-binding protein EngB	1.22e-02	NA	4.76e-05	NA
7. B	B6J4J8	GTPase Era	6.97e-04	NA	3.43e-06	NA
7. B	A5W8F1	GTPase Era	7.22e-04	NA	0.001	NA
7. B	A7FCP5	Probable GTP-binding protein EngB	1.54e-02	NA	0.015	NA
7. B	A5N2K5	Probable GTP-binding protein EngB	1.67e-02	NA	0.001	NA
7. B	A3MZR0	GTPase Era	9.91e-04	NA	0.002	NA
7. B	Q8P979	GTPase Der	2.54e-03	NA	3.82e-11	NA
7. B	A5G693	GTPase Era	3.31e-04	NA	4.72e-10	NA
7. B	Q8EW66	GTPase Era	6.38e-04	NA	7.80e-09	NA
7. B	A4WDD7	GTPase Era	9.83e-04	NA	0.013	NA
7. B	Q1QH69	Probable GTP-binding protein EngB	1.32e-02	NA	0.001	NA
7. B	Q7V2S6	GTPase Der	1.74e-03	NA	9.96e-12	NA
7. B	B5FRC4	GTPase Era	9.62e-04	NA	0.014	NA
7. B	A4XKV8	GTPase Era	2.88e-04	NA	8.55e-11	NA
7. B	B7MIQ1	GTPase Era	9.88e-04	NA	0.010	NA
7. B	B2TXX9	GTPase Era	1.01e-03	NA	0.010	NA
7. B	Q9PB97	GTPase Era	7.76e-04	NA	3.21e-06	NA
7. B	P57947	Probable GTP-binding protein EngB	1.53e-02	NA	1.19e-04	NA
7. B	B4SSW8	GTPase Der	7.24e-03	NA	1.04e-13	NA
7. B	Q1RH06	Probable GTP-binding protein EngB	8.81e-03	NA	0.004	NA
7. B	B0U3D9	GTPase Era	7.37e-04	NA	3.45e-06	NA
7. B	A9IIJ3	GTPase Era	7.64e-04	NA	0.001	NA
7. B	Q1CKE3	GTPase Era	1.07e-03	NA	0.004	NA
7. B	Q7W5J7	GTPase Era	7.23e-04	NA	0.001	NA
7. B	B9E055	GTPase Era	3.99e-04	NA	9.67e-10	NA
7. B	Q83NI3	GTPase Era	3.16e-04	NA	3.09e-07	NA
7. B	A8MG70	GTPase Era	3.55e-04	NA	1.04e-11	NA
7. B	Q5H1R1	GTPase Era	9.24e-04	NA	1.11e-05	NA
7. B	A5IIT6	GTPase Era	6.00e-04	NA	0.003	NA
7. B	Q5WHD9	GTPase Era	4.83e-04	NA	2.27e-14	NA
7. B	Q9WZV1	GTPase Era	5.73e-04	NA	1.89e-04	NA
7. B	Q02HS3	GTPase Era	7.90e-04	NA	0.003	NA
7. B	P0A3C1	GTPase Era	4.41e-04	NA	7.21e-13	NA
7. B	A8FL71	Probable GTP-binding protein EngB	2.60e-05	NA	0.002	NA
7. B	Q7SHR8	Nucleolar GTP-binding protein 2	9.17e-02	NA	0.001	NA
7. B	Q8Y6X3	Probable GTP-binding protein EngB	1.17e-02	NA	0.011	NA
7. B	A5D451	Probable GTP-binding protein EngB	3.64e-02	NA	0.049	NA
7. B	B2UX10	Probable GTP-binding protein EngB	2.05e-02	NA	0.005	NA
7. B	B0BUA7	GTPase Era	9.76e-04	NA	0.002	NA
7. B	Q89AM7	GTPase Era	7.89e-04	NA	0.002	NA
7. B	B1MYE3	GTPase Era	4.32e-04	NA	2.57e-10	NA
7. B	Q6MEP0	Probable GTP-binding protein EngB	2.49e-02	NA	0.012	NA
7. B	Q4UKB0	GTPase Era	9.94e-04	NA	2.95e-08	NA
7. B	C7LZP1	GTPase Era	5.55e-04	NA	5.24e-07	NA
7. B	B3CL86	Probable GTP-binding protein EngB	1.71e-04	NA	0.008	NA
7. B	Q1JN21	GTPase Era	3.64e-04	NA	1.17e-08	NA
7. B	A9NFM5	Probable GTP-binding protein EngB	2.40e-04	NA	0.012	NA
7. B	A5U557	GTPase Era	9.51e-04	NA	2.57e-04	NA
7. B	C1CK50	GTPase Era	5.34e-04	NA	4.84e-10	NA
7. B	Q4UYM8	Probable GTP-binding protein EngB	2.08e-02	NA	0.010	NA
7. B	A7ZQ10	GTPase Era	9.65e-04	NA	0.010	NA
7. B	Q4UNC2	Probable GTP-binding protein EngB	1.41e-02	NA	0.002	NA
7. B	C5CEL1	Probable GTP-binding protein EngB	1.91e-02	NA	1.46e-05	NA
7. B	K7UTH7	GTPase ERA1, chloroplastic	7.34e-03	NA	1.22e-06	NA
7. B	Q9X1H7	Probable GTP-binding protein EngB	2.29e-02	NA	5.55e-05	NA
7. B	Q9K8F7	Probable GTP-binding protein EngB	1.44e-02	NA	0.013	NA
7. B	B2UTX1	GTPase Era	7.86e-04	NA	9.05e-05	NA
7. B	A9N1T2	GTPase Era	1.03e-03	NA	0.015	NA
7. B	A4TSG6	Probable GTP-binding protein EngB	1.02e-02	NA	0.015	NA
7. B	Q1CN51	Probable GTP-binding protein EngB	1.47e-02	NA	0.015	NA
7. B	B2FPX8	GTPase Era	1.05e-03	NA	2.79e-08	NA
7. B	Q2FY06	GTPase Era	3.61e-04	NA	4.37e-11	NA
7. B	A1JHT4	Probable GTP-binding protein EngB	1.62e-02	NA	0.025	NA
7. B	A1TZQ4	GTPase Der	8.73e-03	NA	2.35e-15	NA
7. B	Q4KHT0	GTPase Era	7.10e-04	NA	0.012	NA
7. B	Q633X5	Probable GTP-binding protein EngB	1.91e-02	NA	0.022	NA
7. B	P0A3C4	GTPase Era	5.22e-04	NA	4.84e-10	NA
7. B	B0S6U7	GTPase Era, mitochondrial	8.42e-02	NA	0.015	NA
7. B	C1DE52	GTPase Der	3.75e-03	NA	1.42e-13	NA
7. B	A5UFI7	GTPase Era	9.86e-04	NA	0.006	NA
7. B	Q8YYD8	GTPase Era	1.15e-03	NA	4.04e-09	NA
7. B	B9LZU0	Probable GTP-binding protein EngB	2.26e-02	NA	7.50e-04	NA
7. B	A1KL54	GTPase Era	8.94e-04	NA	2.57e-04	NA
7. B	Q49Y10	GTPase Era	3.57e-04	NA	5.12e-10	NA
7. B	B7HQM9	Probable GTP-binding protein EngB	1.89e-02	NA	0.022	NA
7. B	Q57LD1	GTPase Era	9.29e-04	NA	0.014	NA
7. B	Q3YRS0	GTPase Era	6.82e-04	NA	1.40e-05	NA
7. B	A1KT93	GTPase Der	5.12e-03	NA	1.51e-13	NA
7. B	Q3YYV0	GTPase Era	1.01e-03	NA	0.010	NA
7. B	P0DA96	GTPase Era	3.84e-04	NA	1.17e-08	NA
7. B	B8CXI2	GTPase Era	4.33e-04	NA	1.80e-07	NA
7. B	Q0BU77	Probable GTP-binding protein EngB	1.54e-02	NA	0.005	NA
7. B	B1LBK5	Probable GTP-binding protein EngB	2.32e-02	NA	4.08e-05	NA
7. B	P75678	Uncharacterized protein YkfA	1.10e-03	NA	2.68e-06	NA
7. B	A0AIR3	GTPase Era	3.35e-04	NA	2.39e-09	NA
7. B	C3P9F4	Probable GTP-binding protein EngB	1.91e-02	NA	0.022	NA
7. B	Q5GSS9	Probable GTP-binding protein EngB	1.10e-02	NA	0.002	NA
7. B	Q7MHN9	GTPase Era	2.12e-03	NA	0.004	NA
7. B	Q8ZJS0	Probable GTP-binding protein EngB	1.74e-02	NA	0.015	NA
7. B	A1VHK4	GTPase Era	1.56e-03	NA	2.78e-08	NA
7. B	Q89AD0	Probable GTP-binding protein EngB	1.74e-02	NA	0.004	NA
7. B	O83552	GTPase Era	1.10e-03	NA	4.44e-07	NA
7. B	Q1C237	Probable GTP-binding protein EngB	1.73e-02	NA	0.015	NA
7. B	Q71ZK8	GTPase Era	3.43e-04	NA	3.09e-09	NA
7. B	C1CLR7	Probable GTP-binding protein EngB	1.46e-02	NA	0.041	NA
7. B	A1AE96	GTPase Era	8.89e-04	NA	0.010	NA
7. B	B2TPB6	Probable GTP-binding protein EngB	2.76e-02	NA	0.005	NA
7. B	Q58859	Uncharacterized GTP-binding protein MJ1464	2.44e-02	NA	0.008	NA
7. B	B8I8N7	Probable GTP-binding protein EngB	1.50e-02	NA	0.020	NA
7. B	C5D5L1	Probable GTP-binding protein EngB	1.97e-02	NA	0.006	NA
7. B	A8GLI8	Probable GTP-binding protein EngB	1.19e-02	NA	0.008	NA
7. B	Q8Y750	GTPase Era	3.43e-04	NA	3.09e-09	NA
7. B	Q6HD57	Probable GTP-binding protein EngB	1.86e-02	NA	0.022	NA
7. B	Q8P5E4	Probable GTP-binding protein EngB	2.95e-02	NA	0.010	NA
7. B	C1CXC1	GTPase Era	1.82e-03	NA	1.07e-05	NA
7. B	Q0T1T9	GTPase Era	9.55e-04	NA	0.008	NA
7. B	P0DA97	GTPase Era	3.91e-04	NA	1.17e-08	NA
7. B	B5E6L1	Probable GTP-binding protein EngB	1.97e-02	NA	0.048	NA
7. B	Q0TES2	GTPase Era	9.88e-04	NA	0.010	NA
7. B	Q031W8	GTPase Era	4.04e-04	NA	6.51e-13	NA
7. B	A5IMB8	Probable GTP-binding protein EngB	2.39e-02	NA	4.56e-05	NA
7. B	B1J4E1	GTPase Era	7.31e-04	NA	0.001	NA
7. B	Q17XF9	GTPase Era	8.10e-04	NA	8.43e-05	NA
7. B	B3ETC6	GTPase Era	1.34e-03	NA	5.80e-04	NA
7. B	Q8NNB9	GTPase Era	9.79e-04	NA	1.89e-07	NA
7. B	Q7WD33	GTPase Era	7.40e-04	NA	0.001	NA
7. B	Q9PHL7	Probable GTP-binding protein EngB	1.49e-05	NA	0.004	NA
7. B	A7FFU0	GTPase Era	1.00e-03	NA	0.004	NA
7. B	Q9RDF2	GTPase Era	8.01e-04	NA	3.53e-06	NA
7. B	A4VW74	GTPase Era	4.05e-04	NA	7.18e-10	NA
7. B	A9QYI0	Probable GTP-binding protein EngB	1.80e-02	NA	0.020	NA
7. B	B0V4V6	GTPase Der	1.76e-03	NA	4.95e-13	NA
7. B	Q8G1P9	GTPase Era	3.56e-04	NA	2.17e-06	NA
7. B	C0R5M1	Probable GTP-binding protein EngB	1.55e-04	NA	0.003	NA
7. B	A1U2V4	GTPase Era	7.97e-04	NA	0.020	NA
7. B	C1CFF1	Probable GTP-binding protein EngB	1.46e-02	NA	0.021	NA
7. B	Q4QLH6	Probable GTP-binding protein EngB	1.55e-02	NA	2.70e-04	NA
7. B	Q82S94	Probable GTP-binding protein EngB	2.30e-02	NA	8.25e-04	NA
7. B	P46453	Probable GTP-binding protein EngB	1.59e-02	NA	2.51e-04	NA
7. B	Q2SSN1	Probable GTP-binding protein EngB	1.76e-02	NA	0.014	NA
7. B	Q7NS92	GTPase Der	5.61e-03	NA	4.45e-13	NA
7. B	Q83QI5	GTPase Era	9.64e-04	NA	0.009	NA
7. B	Q1C554	GTPase Era	1.02e-03	NA	0.004	NA
7. B	C3L700	Probable GTP-binding protein EngB	1.89e-02	NA	0.022	NA
7. B	Q89BP9	Probable GTP-binding protein EngB	7.94e-03	NA	0.014	NA
7. B	Q58330	Uncharacterized protein MJ0920	1.48e-03	NA	2.46e-07	NA
7. B	B3E2D1	Probable GTP-binding protein EngB	3.91e-03	NA	1.54e-04	NA
7. B	A1VZ10	Probable GTP-binding protein EngB	2.70e-05	NA	0.002	NA
7. B	A1WUL5	GTPase Der	7.57e-04	NA	1.38e-15	NA
7. B	B1AIQ5	Probable GTP-binding protein EngB	1.08e-03	NA	0.045	NA
7. B	A9N941	GTPase Era	8.61e-04	NA	8.83e-06	NA
7. B	D5DJL5	Ribosome biogenesis GTPase A	1.06e-01	NA	0.007	NA
7. B	Q68XY6	GTPase Era	7.65e-04	NA	4.47e-08	NA
7. B	Q6NG20	GTPase Era	9.99e-04	NA	1.38e-06	NA
7. B	B0RX26	GTPase Era	9.51e-04	NA	3.85e-05	NA
7. B	B7J2L5	GTPase Era	7.70e-04	NA	1.07e-05	NA
7. B	B4U458	GTPase Era	4.29e-04	NA	3.94e-09	NA
7. B	Q87XG2	GTPase Era	6.71e-04	NA	0.011	NA
7. B	Q1RHA4	GTPase Era	8.10e-04	NA	5.56e-08	NA
7. B	A4W2H9	GTPase Era	4.57e-04	NA	7.18e-10	NA
7. B	A5UIP2	Probable GTP-binding protein EngB	1.57e-02	NA	2.51e-04	NA
7. B	Q9L6G1	Probable GTP-binding protein EngB	1.64e-02	NA	0.034	NA
7. B	A3M215	GTPase Der	7.36e-04	NA	4.95e-13	NA
7. B	Q68XW9	Probable GTP-binding protein EngB	1.25e-02	NA	0.001	NA
7. B	Q9PHL1	GTPase Era	5.23e-04	NA	8.65e-05	NA
7. B	Q6DB76	Probable GTP-binding protein EngB	2.22e-02	NA	0.027	NA
7. B	B5Z140	GTPase Era	1.00e-03	NA	0.008	NA
7. B	Q0ST57	Probable GTP-binding protein EngB	1.20e-02	NA	2.03e-05	NA
7. B	Q3BTW0	GTPase Der	9.99e-03	NA	3.89e-11	NA
7. B	Q182C3	GTPase Era	6.66e-04	NA	4.14e-11	NA
7. B	C0MBF0	GTPase Era	4.53e-04	NA	6.10e-09	NA
7. B	B2IPC3	GTPase Era	4.94e-04	NA	4.84e-10	NA
7. B	Q9CGE5	Probable GTP-binding protein EngB	1.78e-02	NA	0.028	NA
7. B	A8F6R1	GTPase Era	7.55e-04	NA	1.05e-04	NA
7. B	C1CDW4	GTPase Era	4.29e-04	NA	4.38e-10	NA
7. B	B1XST2	Probable GTP-binding protein EngB	2.50e-02	NA	0.020	NA
7. B	Q817Q5	Probable GTP-binding protein EngB	1.83e-02	NA	0.024	NA
7. B	A5UCY6	Probable GTP-binding protein EngB	1.29e-02	NA	1.40e-04	NA
7. B	Q21086	Guanine nucleotide-binding protein-like 3 homolog	2.19e-02	NA	0.031	NA
7. B	A8GQS1	Probable GTP-binding protein EngB	1.68e-02	NA	0.006	NA
7. B	B8DHJ0	Probable GTP-binding protein EngB	9.62e-03	NA	0.016	NA
7. B	Q8ZD71	GTPase Era	1.12e-03	NA	0.004	NA
7. B	B7IH25	GTPase Era	3.83e-04	NA	1.37e-04	NA
7. B	A7X2W5	GTPase Era	3.38e-04	NA	4.45e-11	NA
7. B	Q8XIU8	GTPase Era	3.24e-04	NA	4.23e-07	NA
7. B	B4RKD2	GTPase Der	5.77e-03	NA	1.24e-13	NA
7. B	A1VZ20	GTPase Era	5.76e-04	NA	4.41e-05	NA
7. B	A6TSJ8	GTPase Era	3.70e-04	NA	1.10e-12	NA
7. B	Q73IC3	Probable GTP-binding protein EngB	1.61e-04	NA	0.007	NA
7. B	Q57986	Fe(2+) transporter FeoB	1.34e-01	NA	0.046	NA
7. B	Q04A20	GTPase Era	5.38e-04	NA	1.20e-07	NA
7. B	B5F1G0	GTPase Era	9.59e-04	NA	0.014	NA
7. B	Q92JC9	Probable GTP-binding protein EngB	1.60e-02	NA	3.15e-04	NA
7. B	B7LUZ8	GTPase Era	9.85e-04	NA	0.009	NA
7. B	Q73Y13	GTPase Era	6.52e-04	NA	8.74e-05	NA
7. B	B9K8C0	Probable GTP-binding protein EngB	2.40e-02	NA	9.12e-05	NA
7. B	Q1CR39	Probable GTP-binding protein EngB	1.84e-04	NA	0.006	NA
7. B	Q5FFN4	GTPase Era	4.42e-04	NA	3.33e-05	NA
7. B	B5E488	GTPase Era	NA	NA	8.47e-10	NA
7. B	Q7VW40	GTPase Era	1.10e-04	NA	0.001	NA
7. B	A1KSV0	GTPase Era	6.36e-04	NA	1.45e-04	NA
7. B	B2S103	GTPase Era	6.47e-04	NA	3.72e-04	NA
7. B	B3QQY9	Probable GTP-binding protein EngB	9.12e-05	NA	1.97e-04	NA
7. B	Q87B41	GTPase Der	1.43e-03	NA	2.86e-15	NA
7. B	Q1IXB4	GTPase Era	1.88e-03	NA	4.13e-08	NA
7. B	B2V2K0	GTPase Era	3.53e-04	NA	3.36e-10	NA
7. B	B6IZ00	GTPase Era	8.58e-04	NA	2.84e-06	NA
7. B	B7HEA1	Probable GTP-binding protein EngB	1.79e-02	NA	0.024	NA
7. B	B5QTU7	GTPase Era	9.81e-04	NA	0.014	NA
7. B	A1R085	GTPase Era	6.39e-04	NA	3.38e-05	NA
7. B	Q6GGD3	GTPase Era	4.18e-04	NA	4.45e-11	NA
7. B	B9MS56	GTPase Era	2.81e-04	NA	1.16e-11	NA
7. B	A5IXT1	Probable GTP-binding protein EngB	1.75e-02	NA	0.003	NA
7. B	B0USS2	GTPase Era	8.86e-04	NA	6.17e-06	NA
7. B	Q8FF17	GTPase Era	9.16e-04	NA	0.010	NA
7. B	B5X2B8	GTPase Era, mitochondrial	8.03e-02	NA	0.006	NA
7. B	Q3KHL8	GTPase Era	6.88e-04	NA	0.008	NA
7. B	Q9ZE30	GTPase Era	8.90e-04	NA	6.09e-08	NA
7. B	Q9K0C7	GTPase Era	7.70e-04	NA	1.46e-04	NA
7. B	A7ZDF6	GTPase Era	7.73e-04	NA	6.05e-08	NA
7. B	Q10190	Large subunit GTPase 1	2.29e-01	NA	0.003	NA
7. B	Q2JM09	GTPase Der	3.05e-03	NA	1.95e-13	NA
7. B	Q31XS1	GTPase Era	8.77e-04	NA	0.010	NA
7. B	A7FXK1	GTPase Era	3.25e-04	NA	1.43e-10	NA
7. B	A7MH00	GTPase Era	9.33e-04	NA	0.023	NA
7. B	Q87TG0	Probable GTP-binding protein EngB	6.03e-02	NA	0.001	NA
7. B	P0A3C3	GTPase Era	4.76e-04	NA	4.84e-10	NA
7. B	A8A376	GTPase Era	8.20e-04	NA	0.009	NA
7. B	B2SNS8	Probable GTP-binding protein EngB	1.39e-02	NA	0.009	NA
7. B	Q92BF6	Probable GTP-binding protein EngB	1.16e-02	NA	0.016	NA
7. B	B2I605	GTPase Era	8.98e-04	NA	3.99e-06	NA
7. B	Q8PPG1	Probable GTP-binding protein EngB	1.93e-02	NA	0.015	NA
7. B	Q1JI67	GTPase Era	3.85e-04	NA	1.17e-08	NA
7. B	P64073	Probable GTP-binding protein EngB	1.53e-02	NA	0.048	NA
7. B	B7UWJ2	GTPase Der	5.21e-03	NA	4.34e-14	NA
7. B	A0RJ86	Probable GTP-binding protein EngB	1.79e-02	NA	0.022	NA
7. B	A9VIU3	Probable GTP-binding protein EngB	1.95e-02	NA	0.030	NA
7. B	Q831T9	GTPase Era	3.98e-04	NA	2.34e-11	NA
7. B	A3CMV2	Probable GTP-binding protein EngB	1.81e-02	NA	0.009	NA
7. B	O74776	Mitochondrial GTPase 1	1.80e-01	NA	0.044	NA
7. B	Q6G900	GTPase Era	3.13e-04	NA	4.45e-11	NA
7. B	Q8PKY6	GTPase Der	1.87e-03	NA	3.96e-11	NA
7. B	B5Z6P0	GTPase Era	7.54e-04	NA	9.72e-05	NA
7. B	Q49768	GTPase Era	7.48e-04	NA	0.001	NA
7. B	A5N6N6	GTPase Era	4.09e-04	NA	9.67e-10	NA
7. B	Q9CPH8	GTPase Era	9.17e-04	NA	0.002	NA
7. B	Q3YS22	Probable GTP-binding protein EngB	7.89e-03	NA	0.042	NA
7. B	Q07TY1	Probable GTP-binding protein EngB	1.40e-02	NA	0.002	NA
7. B	A8MIS4	Probable GTP-binding protein EngB	1.71e-02	NA	0.002	NA
7. B	Q9ZE46	Probable GTP-binding protein EngB	2.08e-02	NA	0.020	NA
7. B	P06616	GTPase Era	9.87e-04	NA	0.009	NA
7. B	Q72ZV7	Probable GTP-binding protein EngB	1.83e-02	NA	0.022	NA
7. B	A7GYN7	GTPase Era	8.86e-04	NA	1.30e-09	NA
7. B	P0C0B9	GTPase Era	3.88e-04	NA	1.18e-08	NA
7. B	Q8E4L9	Probable GTP-binding protein EngB	2.45e-02	NA	0.032	NA
7. B	A2RG20	GTPase Era	3.82e-04	NA	1.17e-08	NA
7. B	B2KA46	GTPase Era	1.03e-03	NA	0.004	NA
7. B	B5RMK6	GTPase Era	5.67e-04	NA	7.67e-04	NA
7. B	P37214	GTPase Era	3.78e-04	NA	1.43e-10	NA
7. B	B0VKR4	GTPase Der	5.99e-03	NA	5.18e-13	NA
7. B	Q2NB82	GTPase Era	5.32e-04	NA	3.53e-04	NA
7. B	A0RPN6	GTPase Era	4.51e-04	NA	7.17e-07	NA
7. B	B1LP79	GTPase Era	9.85e-04	NA	0.010	NA
7. B	Q21B49	Probable GTP-binding protein EngB	1.31e-02	NA	0.004	NA
7. B	A0Q2K7	Probable GTP-binding protein EngB	1.24e-02	NA	5.12e-05	NA
7. B	A7H4F3	GTPase Era	6.96e-04	NA	1.77e-04	NA
7. B	Q9XCX8	GTPase Era	9.68e-04	NA	0.003	NA
7. B	B2A1E8	Probable GTP-binding protein EngB	1.93e-02	NA	0.028	NA
7. B	Q8XKK5	Probable GTP-binding protein EngB	1.15e-02	NA	4.76e-05	NA
7. B	Q8UGK1	GTPase Era	2.82e-04	NA	6.71e-09	NA
7. B	Q88VS0	GTPase Era	4.03e-04	NA	1.39e-09	NA
7. B	B9FI63	GTPase ERA-like, chloroplastic	1.20e-02	NA	9.58e-07	NA
7. B	Q0SMJ3	GTPase Era	7.76e-04	NA	4.51e-05	NA
7. B	C0QLA5	Probable GTP-binding protein EngB	1.23e-02	NA	0.026	NA
7. B	B9DRF9	GTPase Era	3.89e-04	NA	2.23e-09	NA
7. B	O67679	Probable GTP-binding protein EngB	2.20e-02	NA	0.020	NA
7. B	Q748I9	Probable GTP-binding protein EngB	2.96e-03	NA	5.79e-04	NA
7. B	Q4FTW3	GTPase Der	2.82e-03	NA	4.72e-14	NA
7. B	C1DQS3	GTPase Era	7.19e-04	NA	0.001	NA
7. B	C1C8F9	Probable GTP-binding protein EngB	1.52e-02	NA	0.048	NA
7. B	Q2GGZ1	GTPase Era	6.03e-04	NA	2.26e-05	NA
7. B	B4SRK9	GTPase Era	9.38e-04	NA	2.17e-07	NA
7. B	Q0AB37	GTPase Der	3.26e-03	NA	1.36e-15	NA
7. B	Q667V2	GTPase Era	1.05e-03	NA	0.004	NA
7. B	B5RQ02	GTPase Era	5.35e-04	NA	0.003	NA
7. B	A5G964	Probable GTP-binding protein EngB	1.50e-04	NA	0.028	NA
7. B	Q04KV9	GTPase Era	5.28e-04	NA	4.84e-10	NA
7. B	A4XSC5	GTPase Era	6.50e-04	NA	0.004	NA
7. B	P64088	GTPase Era	3.85e-04	NA	1.17e-08	NA
7. B	Q9RNL6	GTP-binding protein EngB	1.33e-02	NA	7.16e-04	NA
7. B	Q9RWM0	GTPase Era	2.14e-03	NA	1.19e-06	NA
7. B	Q02Z21	Probable GTP-binding protein EngB	1.67e-02	NA	0.034	NA
7. B	Q8KAK5	Probable GTP-binding protein EngB	7.48e-05	NA	0.011	NA
7. B	Q21KS9	GTPase Der	5.38e-03	NA	1.07e-14	NA
7. B	A8EXI4	GTPase Era	1.07e-03	NA	3.59e-08	NA
7. B	B8FVH0	Probable GTP-binding protein EngB	2.25e-02	NA	0.002	NA
7. B	Q73LG9	GTPase Era	4.42e-04	NA	6.02e-06	NA
7. B	A5VYT9	GTPase Der	1.25e-03	NA	4.92e-16	NA
7. B	Q5GVY6	Probable GTP-binding protein EngB	2.57e-02	NA	0.009	NA
7. B	Q87C05	GTPase Era	8.53e-04	NA	3.99e-06	NA
7. B	Q3K022	GTPase Era	3.86e-04	NA	9.43e-09	NA
7. B	Q39T84	GTPase Era	3.34e-04	NA	2.66e-11	NA
7. B	O51604	GTPase Era	7.70e-04	NA	1.07e-05	NA
7. B	Q3BVV5	GTPase Era	1.02e-03	NA	3.85e-05	NA
7. B	A8EXG4	Probable GTP-binding protein EngB	1.88e-02	NA	0.001	NA
7. B	Q2NZ59	Probable GTP-binding protein EngB	2.26e-02	NA	0.009	NA
7. B	Q660L0	GTPase Era	8.28e-04	NA	5.83e-06	NA
7. B	Q87LP0	GTPase Era	1.89e-03	NA	0.005	NA
7. B	A5IXQ6	GTPase Era	6.30e-04	NA	3.82e-07	NA
7. B	Q04JI0	Probable GTP-binding protein EngB	1.97e-02	NA	0.048	NA
7. B	Q9JVD2	GTPase Era	2.00e-03	NA	1.44e-04	NA
7. B	Q0I4Z4	GTPase Era	7.48e-04	NA	6.19e-05	NA
7. B	C1F4C3	Probable GTP-binding protein EngB	1.83e-03	NA	1.04e-06	NA
7. B	Q0I1G1	Probable GTP-binding protein EngB	1.21e-02	NA	2.22e-04	NA
7. B	C0QA05	GTPase Der	3.79e-03	NA	1.59e-12	NA
7. B	Q2GAU7	Probable GTP-binding protein EngB	1.11e-02	NA	0.036	NA
7. B	Q8VZ74	GTPase ERA-like, chloroplastic	7.40e-03	NA	5.18e-05	NA
7. B	Q2YT12	GTPase Era	3.43e-04	NA	4.37e-11	NA
7. B	Q56057	GTPase Era	1.07e-03	NA	0.014	NA
7. B	B2UVY4	Probable GTP-binding protein EngB	1.59e-02	NA	0.016	NA
7. B	Q1JD46	GTPase Era	4.75e-04	NA	1.17e-08	NA
7. B	A6QHB0	GTPase Era	3.37e-04	NA	4.45e-11	NA
7. B	Q4ZPE2	GTPase Era	7.05e-04	NA	0.016	NA
7. B	B3WEL1	GTPase Era	3.55e-04	NA	8.65e-08	NA
7. B	B1XB40	GTPase Era	8.26e-04	NA	0.009	NA
7. B	C5BLV6	GTPase Der	9.59e-04	NA	6.93e-14	NA
7. B	Q82SJ6	GTPase Era	7.93e-04	NA	0.002	NA
7. B	A9MGX7	GTPase Era	8.52e-04	NA	0.014	NA
7. B	B4S596	Probable GTP-binding protein EngB	1.02e-04	NA	0.012	NA
7. B	Q39YG6	Probable GTP-binding protein EngB	6.02e-03	NA	0.047	NA
7. B	B6JGG2	GTPase Era	2.11e-04	NA	7.00e-06	NA
7. B	B2JYK5	Probable GTP-binding protein EngB	1.58e-02	NA	0.015	NA
7. B	Q3SN20	Probable GTP-binding protein EngB	1.14e-02	NA	0.010	NA
7. B	Q1CU14	GTPase Era	6.79e-04	NA	1.74e-04	NA
7. B	B4TS13	GTPase Era	1.06e-03	NA	0.014	NA
7. B	Q65R06	Probable GTP-binding protein EngB	1.22e-02	NA	0.002	NA
7. B	Q1J822	GTPase Era	4.83e-04	NA	6.38e-09	NA
7. B	A1JKK4	GTPase Era	1.08e-03	NA	8.51e-04	NA
7. B	B7IIY0	Probable GTP-binding protein EngB	1.85e-02	NA	0.020	NA
7. B	Q81LC2	Probable GTP-binding protein EngB	1.75e-02	NA	0.022	NA
7. B	B7UH06	GTPase Era	9.04e-04	NA	0.010	NA
7. B	B2I3F0	GTPase Der	2.47e-03	NA	4.95e-13	NA
7. B	Q92JA9	GTPase Era	1.37e-03	NA	1.79e-08	NA
7. B	B0TAF1	GTPase Era	7.16e-04	NA	9.55e-14	NA
7. B	A9KFA1	GTPase Era	8.14e-04	NA	3.43e-06	NA
7. B	P75135	Probable ribosome biogenesis GTPase A	1.44e-01	NA	0.017	NA
7. B	Q1WTU6	GTPase Era	4.32e-04	NA	1.97e-10	NA
7. B	B5BAT1	GTPase Era	9.32e-04	NA	0.014	NA
7. B	C3PMD9	Probable GTP-binding protein EngB	1.58e-02	NA	2.57e-04	NA
7. B	Q6F1A9	Probable GTP-binding protein EngB	1.20e-02	NA	5.14e-04	NA
7. B	A6TCI0	GTPase Era	9.78e-04	NA	0.017	NA
7. B	B7JQ62	Probable GTP-binding protein EngB	1.68e-02	NA	0.022	NA
7. B	P52131	Uncharacterized protein YfjP	1.45e-03	NA	9.46e-05	NA
7. B	Q5HVB3	GTPase Era	5.73e-04	NA	8.73e-05	NA
7. B	Q24SK9	Probable GTP-binding protein EngB	2.29e-02	NA	0.002	NA
7. B	O69162	GTPase Era	2.93e-04	NA	2.46e-05	NA
7. B	Q5PAH3	Probable GTP-binding protein EngB	9.58e-05	NA	0.005	NA
7. B	Q0TNU5	GTPase Era	3.49e-04	NA	1.19e-07	NA
7. B	A6LL68	GTPase Era	3.41e-04	NA	0.001	NA
7. B	Q0AF71	GTPase Era	5.88e-04	NA	3.84e-06	NA
7. B	B7N6F4	GTPase Era	9.64e-04	NA	0.010	NA
7. B	Q5HVC1	Probable GTP-binding protein EngB	2.51e-05	NA	0.005	NA
7. B	B1HTJ0	GTPase Era	4.42e-04	NA	9.44e-13	NA
7. B	B7H065	GTPase Der	6.70e-04	NA	4.95e-13	NA
7. B	Q2P4M0	GTPase Era	9.77e-04	NA	1.11e-05	NA
7. B	B7NRL9	GTPase Era	9.77e-04	NA	0.010	NA
7. B	B2FTY5	Probable GTP-binding protein EngB	1.30e-02	NA	2.07e-04	NA
7. B	A7I277	GTPase Era	6.10e-04	NA	2.54e-08	NA
7. B	B3PDM5	GTPase Der	3.75e-03	NA	2.25e-14	NA
7. B	Q3AEZ3	GTPase Era	6.92e-04	NA	1.30e-09	NA
7. B	B1IVR1	GTPase Era	7.52e-04	NA	0.009	NA
7. B	Q0APC5	GTPase Era	6.80e-04	NA	8.20e-05	NA
7. B	B5RD48	GTPase Era	9.20e-04	NA	0.014	NA
7. B	B6JL99	GTPase Era	7.17e-04	NA	1.18e-04	NA
7. B	Q5PIG4	GTPase Era	9.61e-04	NA	0.014	NA
7. B	Q6MPP2	Probable GTP-binding protein EngB	2.29e-02	NA	0.010	NA
7. B	Q8PB51	GTPase Era	9.13e-04	NA	3.85e-05	NA
7. B	A6LT31	Probable GTP-binding protein EngB	2.13e-02	NA	0.014	NA
7. B	Q9JV01	GTPase Der	5.60e-03	NA	1.41e-13	NA
7. B	B4TE14	GTPase Era	9.43e-04	NA	0.014	NA
7. B	Q6MTV5	Probable GTP-binding protein EngB	1.69e-02	NA	0.011	NA
7. B	A8GUK6	Probable GTP-binding protein EngB	8.12e-03	NA	0.004	NA
7. B	B2FNR1	GTPase Der	9.06e-04	NA	1.09e-13	NA
7. B	B0KA54	GTPase Era	4.83e-04	NA	8.20e-14	NA
7. B	Q057R5	GTPase Era	3.71e-04	NA	1.93e-08	NA
7. B	B3GX86	GTPase Era	9.86e-04	NA	0.002	NA
7. B	A9R403	GTPase Era	1.10e-03	NA	0.004	NA
7. B	B6JJN9	Probable GTP-binding protein EngB	1.19e-02	NA	1.22e-05	NA
7. B	B4T1F7	GTPase Era	9.35e-04	NA	0.014	NA
7. B	Q8PMU9	GTPase Era	9.45e-04	NA	3.53e-05	NA
7. B	A6U7A9	GTPase Era	2.53e-04	NA	2.22e-08	NA
7. B	B7UYX1	GTPase Era	9.01e-04	NA	0.003	NA
7. B	B5XNH1	GTPase Era	1.01e-03	NA	0.020	NA
7. B	Q32CV5	GTPase Era	9.66e-04	NA	0.026	NA
7. B	P51836	GTPase Era	8.61e-04	NA	8.83e-06	NA
7. B	B1JRC8	GTPase Era	1.06e-03	NA	0.004	NA
7. B	Q49435	Probable ribosome biogenesis GTPase A	1.21e-01	NA	0.033	NA
7. B	Q97FU0	Probable GTP-binding protein EngB	3.35e-02	NA	3.03e-04	NA
7. B	A6TM67	Probable GTP-binding protein EngB	2.60e-02	NA	1.49e-05	NA
7. B	B9IZ44	Probable GTP-binding protein EngB	1.87e-02	NA	0.022	NA
7. B	B7LDF9	GTPase Era	9.96e-04	NA	0.010	NA
7. B	B6I5E0	GTPase Era	1.03e-03	NA	0.010	NA
7. B	Q8EX09	Probable GTP-binding protein EngB	6.98e-05	NA	0.022	NA
7. B	Q892S2	GTPase Era	4.26e-04	NA	2.44e-07	NA
7. B	Q5FJT7	GTPase Era	4.40e-04	NA	7.11e-11	NA
7. B	B1WT49	GTPase Era	1.16e-03	NA	1.05e-12	NA
7. B	C1FVS6	GTPase Era	3.29e-04	NA	2.37e-10	NA
7. B	Q8E443	GTPase Era	3.86e-04	NA	9.43e-09	NA
7. B	Q8Y0I0	GTPase Era	7.31e-04	NA	1.09e-08	NA
7. B	P58070	GTPase Era	9.74e-04	NA	0.008	NA
7. B	B8F8H7	Probable GTP-binding protein EngB	1.03e-02	NA	0.006	NA
7. B	C1ETR5	Probable GTP-binding protein EngB	1.87e-02	NA	0.022	NA
7. B	Q2P2T5	GTPase Der	3.52e-03	NA	5.64e-11	NA
7. B	C1KVA9	GTPase Era	4.26e-04	NA	3.09e-09	NA
7. B	P9WNK9	GTPase Era	9.71e-04	NA	2.57e-04	NA
7. B	Q8MT06	Guanine nucleotide-binding protein-like 3 homolog	7.56e-02	NA	0.003	NA
7. B	Q3BXK1	Probable GTP-binding protein EngB	2.91e-02	NA	0.011	NA
7. B	Q4USF8	GTPase Era	9.43e-04	NA	3.85e-05	NA
7. B	B5ZB76	Probable GTP-binding protein EngB	1.18e-03	NA	3.85e-04	NA
7. B	Q2GKS7	Probable GTP-binding protein EngB	4.56e-03	NA	0.005	NA
7. B	Q1R8G7	GTPase Era	9.51e-04	NA	0.010	NA
7. B	A6V0W4	GTPase Der	3.63e-03	NA	3.38e-14	NA
7. B	Q9HXJ8	GTPase Der	3.71e-03	NA	3.38e-14	NA
7. B	Q0ASI7	Probable GTP-binding protein EngB	9.91e-03	NA	0.001	NA
7. B	B1IBC9	GTPase Era	4.78e-04	NA	5.16e-10	NA
7. B	Q1GN74	Probable GTP-binding protein EngB	2.07e-02	NA	0.004	NA
7. B	P9WNK8	GTPase Era	9.07e-04	NA	2.57e-04	NA
7. B	A1SHZ4	GTPase Era	8.27e-04	NA	1.40e-05	NA
7. B	Q48EV4	GTPase Era	6.64e-04	NA	0.016	NA
7. B	A0QEB0	GTPase Era	6.59e-04	NA	2.77e-04	NA
7. B	O87407	GTPase Der	5.18e-03	NA	1.42e-13	NA
7. B	P64086	GTPase Era	4.16e-04	NA	4.45e-11	NA
7. B	Q82XU6	GTPase Der	5.22e-04	NA	1.29e-13	NA
7. B	C4K1B9	Probable GTP-binding protein EngB	2.68e-02	NA	0.008	NA
7. B	P43728	GTPase Era	9.59e-04	NA	0.006	NA
7. B	Q180E5	Probable GTP-binding protein EngB	1.91e-02	NA	2.40e-05	NA
7. B	Q9ZLW0	GTPase Era	7.74e-04	NA	1.17e-04	NA
7. B	C1C6U6	GTPase Era	4.22e-04	NA	4.84e-10	NA
7. B	O67800	GTPase Era	8.97e-04	NA	6.47e-09	NA
7. B	Q88MY4	GTPase Era	7.16e-04	NA	0.001	NA
7. B	A8AD18	GTPase Era	9.72e-04	NA	0.010	NA
7. B	B6JW87	Mitochondrial GTPase 1	7.09e-02	NA	0.005	NA
7. B	Q8CP21	GTPase Era	3.95e-04	NA	2.46e-10	NA
7. B	P56059	GTPase Era	7.95e-04	NA	7.84e-05	NA
7. B	Q8DC75	GTPase Era	2.03e-03	NA	0.004	NA
7. B	P64072	Probable GTP-binding protein EngB	1.63e-02	NA	0.048	NA
7. B	Q7NWC3	GTPase Era	4.31e-04	NA	2.26e-07	NA
7. B	A6LRP9	GTPase Era	3.59e-04	NA	1.53e-11	NA
7. B	P0A563	GTPase Era	9.32e-04	NA	2.57e-04	NA
7. B	C4ZYI9	GTPase Era	8.13e-04	NA	0.009	NA
7. B	Q7VL76	GTPase Era	1.08e-03	NA	3.97e-04	NA
7. B	C1AQS7	GTPase Era	9.45e-04	NA	2.57e-04	NA
7. B	Q985A5	GTPase Era	2.80e-04	NA	2.78e-09	NA
7. B	B5ZBZ8	GTPase Era	1.90e-03	NA	9.35e-07	NA
7. B	Q71ZB0	Probable GTP-binding protein EngB	1.03e-02	NA	0.016	NA
7. B	Q3IYY4	Probable GTP-binding protein EngB	2.83e-02	NA	0.001	NA
7. B	Q8YG75	GTPase Era	3.09e-04	NA	2.21e-06	NA
7. B	B1AJD1	GTPase Era	2.34e-03	NA	1.89e-06	NA
7. B	P0A3C2	GTPase Era	4.28e-04	NA	7.21e-13	NA
7. B	C0PYG8	GTPase Era	9.39e-04	NA	0.014	NA
7. B	Q9PPZ9	GTPase Era	7.81e-04	NA	1.89e-06	NA
7. B	A1AU48	Probable GTP-binding protein EngB	1.15e-04	NA	4.28e-04	NA
7. B	A9BHV0	Probable GTP-binding protein EngB	7.22e-03	NA	6.59e-05	NA
7. B	Q8RGM1	GTPase Era	6.10e-04	NA	1.43e-10	NA
7. B	A8GM80	GTPase Era	8.27e-04	NA	4.30e-09	NA
7. B	C1KVK5	Probable GTP-binding protein EngB	1.33e-02	NA	0.016	NA
7. B	A8FL79	GTPase Era	5.26e-04	NA	7.70e-05	NA
7. B	B2S3D3	GTPase Era	1.18e-03	NA	4.44e-07	NA