Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54612.1

JCVISYN3A_0095

Preprotein translocase subunit A.
M. mycoides homolog: Q6MUE3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 88
Unique PROST Go: 27
Unique BLAST Go: 2
Unique Foldseek Go: 34

Total Homologs: 1133
Unique PROST Homologs: 147
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 161

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: secA; Protein translocase subunit SecA
Zhang et al. [4]: GO:0043952|protein transport by the Sec complex
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q2A2E3 (Protein translocase subunit SecA) with a FATCAT P-Value: 0 and RMSD of 3.09 angstrom. The sequence alignment identity is 36.8%.
Structural alignment shown in left. Query protein AVX54612.1 colored as red in alignment, homolog Q2A2E3 colored as blue. Query protein AVX54612.1 is also shown in right top, homolog Q2A2E3 showed in right bottom. They are colored based on secondary structures.

  AVX54612.1 MVS--DK-------RLLKKFGKIADKIIALEPQMRQLKDEDFILKTQEFKQMLEDGKSLDDILIEVYAVAREAARRVLGLNAYKVQLIGGIILNSGDIAE 91
      Q2A2E3 MLSLVQKIIGSRNERFIKKVSRIVQKINSLEPEFEKLSDEQLKAKTFEYRERLANGEILDNLLPEAFATVREAGKRTKNMRHYDVQLIGGIVLHQGKVAE 100

  AVX54612.1 MRTGEGKTLTGIFPAYLNALSGKGVHIVTVNEYLSKRDSEINGQVFDLLGISVGLNGSSLTKTEKREAYNKDITYTTNAELGFDYLRDNMVSDYSLKVQR 191
      Q2A2E3 MKTGEGKTLVATLPAYLNALTGDGVHVITVNDYLAKRDAELMSDIYEFLGMSVGVIVADLNPQQRKEAYACDITYGTNNEFGFDYLRDNMAYEKEQQVQR 200

  AVX54612.1 KLNYCIIDEADSVLIDEARTPLIISGGT--STRI-NLYKAANNFALTL-K-EHDDL-------D--IDLESKQVYLNEQGMKK-ANEFFSLK-------- 268
      Q2A2E3 SRNYVIIDEVDSILIDEARTPLIISGASDDSSEMYNLF---NRLVPYLEKQEKEEVENEQEQRDFYVDEKSKNAYLTEKGYAKIEN---MLKKEGILEED 294

  AVX54612.1 -NLFAIEN-TEIFHLIMNA-LKAQFAFKEGVEYTVRDNEILLIDQFTGRIMHGRSYSDGLQQALQAKENVDIEEETVTLATITYQNFYRLYSKIAGMTGT 365
      Q2A2E3 DNLYSPHNITKMHYL--NACLRAHSLYQLNIDYIVRDQEIVIIDESTGRAMPGRRWSDGLHQAIEAKEGVKINAENQTMASITFQNFFKLYNKIAGMTGT 392

  AVX54612.1 AKTEEEEFIKIYNTRVIQTPTNKPVIRKDEPDLTFGTKNAALKKLVEDVLEAHEKGAPILIGTTSVESSEQIARYLKKANLKFETINAKNHDREAEIVSK 465
      Q2A2E3 ADTEAFELHSIYGLEVIIIPTNKPMIRKDHHDEIYGSVREKFDAIVEDIKERISKGQPVLVGTASIEASEVLSTLLKKKKIRHNVLNAKQHEKEASIIAM 492

  AVX54612.1 AGEIGAITLATNMAGRGTDIKLAKG-----VAEL-------------------------GGLRVFGVERNEARRIDNQLRGRSGRQGDPGLSRFYISMDD 535
      Q2A2E3 AGYPDNVTIATNMAGRGTDIILG-GNLEVEIAQLEDPTPEDIAQIKAEWLKRNEAVKKAGGLCIIGSERHDSRRIDNQLRGRAARQGDPGESKFYLSMDD 591

  AVX54612.1 DLMMRFTAPKTRQRF-KAL-GDDYIKSKMFTRAVTNAQKKLEGMNFDQRKNVLDYDNILAQQREIIYAQRDDILEANDLSVVIEKMQITAAYELIEKHST 633
      Q2A2E3 NLLRIFASQSMAERVKKGLKGGESLAFGFMSKVISKAQGKVESYHFDIRKNLLEYDNVVNTQRKVIYEQRQSFLEAEDVSDILADIRIDVAEQLF--HDY 689

  AVX54612.1 LVHGEKTINKKELLDAIDG---TLVPKNKFRVD-DFNNK-----EKM---DL------AVEIAEGMMQLYKARISDIPDDVIIGMER---KI-ILDSFDK 711
      Q2A2E3 VSAG--SMH--ELWD-LEGLEKAL--KSDFMIELDL-QKLYEEDDSLGEEDLKRLVREAIEIE--FVE--KTK--NL-DS---GAVRQFEKFSLLQSLDT 771

  AVX54612.1 YWTKHLDIAGKLKSGIYLQQYAQNNPLAIYVEQATDLFNKMKINIANEVVENLANVILRV-VEDEEQREERIEVTD--KDIEEILFETGLQPSDINNKAI 808
      Q2A2E3 HWREHLSSIDHLRNSINLRGYAQKDPKNEYKKEAFELFSTMLDNFKYEVISSLAK--IRIATEEETQRAQQ-EWQESMSDIKA---E---HESVIDN--- 859

  AVX54612.1 NQRFDELEEEFKDDKQKLRRLRIQRDVMLGLVLELERRAEMIISPQND--QQAITQLIKELQNDIDIASITIDQIHQNFNNMVEQINDPEKLKHLVIAKD 906
      Q2A2E3 NQRHDE-DE--QEEAPKVQQVR--RE---G--PKVKR---------NDPCPCGSGKKYKQCHGKVE---------------------------------- 906

  AVX54612.1 VLLQLVARMDDIKEQEKQTRKKKKKKPHEDESSKTKIG 944
      Q2A2E3 -------------------------------------- 906

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0009570	chloroplast stroma
1. PBF	GO:0043952	protein transport by the Sec complex
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0065002	intracellular protein transmembrane transport
1. PBF	GO:0031522	cell envelope Sec protein transport complex
1. PBF	GO:0008270	zinc ion binding
1. PBF	GO:0016464	chloroplast protein-transporting ATPase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0017038	protein import
1. PBF	GO:0006605	protein targeting
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0015462	ABC-type protein transporter activity
1. PBF	GO:0008564	protein-exporting ATPase activity
1. PBF	GO:0031676	plasma membrane-derived thylakoid membrane
2. PF	GO:0008186	ATP-dependent activity, acting on RNA
2. PF	GO:0140603	obsolete ATP hydrolysis activity
2. PF	GO:0003724	RNA helicase activity
2. PF	GO:0004386	helicase activity
2. PF	GO:0005634	nucleus
2. PF	GO:0032040	small-subunit processome
2. PF	GO:0034511	U3 snoRNA binding
2. PF	GO:0034512	box C/D RNA binding
4. PB	GO:0005576	extracellular region
4. PB	GO:0052553	modulation by symbiont of host immune response
5. P	GO:1904506	negative regulation of telomere maintenance in response to DNA damage
5. P	GO:0003677	DNA binding
5. P	GO:1904430	negative regulation of t-circle formation
5. P	GO:0045910	negative regulation of DNA recombination
5. P	GO:0016817	hydrolase activity, acting on acid anhydrides
5. P	GO:0032206	positive regulation of telomere maintenance
5. P	GO:0006355	regulation of transcription, DNA-templated
5. P	GO:0000470	maturation of LSU-rRNA
5. P	GO:0032508	DNA duplex unwinding
5. P	GO:1904535	positive regulation of telomeric loop disassembly
5. P	GO:0043247	telomere maintenance in response to DNA damage
5. P	GO:0010569	regulation of double-strand break repair via homologous recombination
5. P	GO:0051539	4 iron, 4 sulfur cluster binding
5. P	GO:0000732	strand displacement
5. P	GO:0070182	DNA polymerase binding
5. P	GO:1902990	mitotic telomere maintenance via semi-conservative replication
5. P	GO:1904355	positive regulation of telomere capping
5. P	GO:0060543	negative regulation of strand invasion
5. P	GO:0070615
5. P	GO:0090657	telomeric loop disassembly
5. P	GO:0070417	cellular response to cold
5. P	GO:0000027	ribosomal large subunit assembly
5. P	GO:1902626	assembly of large subunit precursor of preribosome
5. P	GO:0006281	DNA repair
5. P	GO:0030686	90S preribosome
5. P	GO:0005654	nucleoplasm
5. P	GO:1904358	positive regulation of telomere maintenance via telomere lengthening
6. F	GO:0009035	type I site-specific deoxyribonuclease activity
6. F	GO:1990417	snoRNA release from pre-rRNA
6. F	GO:0006417	regulation of translation
6. F	GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
6. F	GO:0033962	P-body assembly
6. F	GO:0005829	cytosol
6. F	GO:0098562	cytoplasmic side of membrane
6. F	GO:0010494	cytoplasmic stress granule
6. F	GO:0034063	stress granule assembly
6. F	GO:0006364	rRNA processing
6. F	GO:0030687	preribosome, large subunit precursor
6. F	GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA
6. F	GO:0006397	mRNA processing
6. F	GO:0043175	RNA polymerase core enzyme binding
6. F	GO:0005739	mitochondrion
6. F	GO:0015616	DNA translocase activity
6. F	GO:0016070	RNA metabolic process
6. F	GO:0016787	hydrolase activity
6. F	GO:0000932	P-body
6. F	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
6. F	GO:0051028	mRNA transport
6. F	GO:1990400	mitochondrial ribosomal large subunit rRNA binding
6. F	GO:0010603	regulation of cytoplasmic mRNA processing body assembly
6. F	GO:0006401	RNA catabolic process
6. F	GO:0006265	DNA topological change
6. F	GO:0045900	negative regulation of translational elongation
6. F	GO:0005730	nucleolus
6. F	GO:0000716	transcription-coupled nucleotide-excision repair, DNA damage recognition
6. F	GO:0006268	DNA unwinding involved in DNA replication
6. F	GO:0000464	endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
6. F	GO:0003678	DNA helicase activity
6. F	GO:1902775	mitochondrial large ribosomal subunit assembly
6. F	GO:0002183	cytoplasmic translational initiation
6. F	GO:0003684	damaged DNA binding
7. B	GO:0042802	identical protein binding
7. B	GO:0005887	integral component of plasma membrane

Uniprot GO Annotations

GO	Description
GO:0015031	protein transport
GO:0065002	intracellular protein transmembrane transport
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0017038	protein import
GO:0005524	ATP binding
GO:0005737	cytoplasm
GO:0006605	protein targeting
GO:0006886	intracellular protein transport
GO:0008564	protein-exporting ATPase activity
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	B1J3I9	Protein translocase subunit SecA	0.00e+00	4.58e-27	0.0	0.8171
1. PBF	A6TLE7	Protein translocase subunit SecA 1	0.00e+00	5.72e-23	0.0	0.7497
1. PBF	B7KUB4	Protein translocase subunit SecA	0.00e+00	1.60e-28	0.0	0.8328
1. PBF	A6QKD8	Protein translocase subunit SecA 2	0.00e+00	8.11e-20	4.04e-155	0.8542
1. PBF	A2SJF9	Protein translocase subunit SecA	0.00e+00	5.08e-27	0.0	0.8523
1. PBF	Q3YQQ3	Protein translocase subunit SecA	0.00e+00	4.98e-19	0.0	0.7843
1. PBF	B7M141	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8367
1. PBF	Q3JZK2	Protein translocase subunit SecA 1	0.00e+00	3.37e-29	0.0	0.8021
1. PBF	A5HY67	Protein translocase subunit SecA	0.00e+00	2.18e-24	0.0	0.8105
1. PBF	Q183M9	Protein translocase subunit SecA 2	0.00e+00	1.12e-18	0.0	0.8075
1. PBF	Q9JYK8	Protein translocase subunit SecA	0.00e+00	1.81e-30	0.0	0.8147
1. PBF	B1MW27	Protein translocase subunit SecA	0.00e+00	4.64e-19	0.0	0.8987
1. PBF	Q9LCT3	Protein translocase subunit SecA	0.00e+00	4.73e-29	0.0	0.8336
1. PBF	Q73ZR7	Protein translocase subunit SecA 2	0.00e+00	1.68e-10	2.32e-121	0.758
1. PBF	B4TJ94	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8397
1. PBF	B7GQH1	Protein translocase subunit SecA	0.00e+00	2.39e-32	0.0	0.8631
1. PBF	B0RV96	Protein translocase subunit SecA	0.00e+00	9.02e-28	0.0	0.868
1. PBF	C6DET4	Protein translocase subunit SecA	0.00e+00	6.08e-25	0.0	0.7908
1. PBF	A6T4P1	Protein translocase subunit SecA	0.00e+00	9.20e-25	0.0	0.8446
1. PBF	A1VZT4	Protein translocase subunit SecA	0.00e+00	6.77e-29	0.0	0.9075
1. PBF	C6E178	Protein translocase subunit SecA	0.00e+00	2.02e-19	8.70e-161	0.7397
1. PBF	B8FHX0	Protein translocase subunit SecA	0.00e+00	2.43e-28	0.0	0.8361
1. PBF	A0Q2X7	Protein translocase subunit SecA	0.00e+00	9.95e-26	0.0	0.7737
1. PBF	A1K3V5	Protein translocase subunit SecA	0.00e+00	6.20e-25	0.0	0.7703
1. PBF	B3QXR7	Protein translocase subunit SecA	3.33e-16	3.23e-11	3.80e-119	0.7116
1. PBF	A2S5T4	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.7567
1. PBF	B1VAB2	Protein translocase subunit SecA	0.00e+00	8.53e-29	0.0	0.8549
1. PBF	A0QGP2	Protein translocase subunit SecA	1.11e-16	2.49e-10	2.37e-117	0.7688
1. PBF	B3E5W3	Protein translocase subunit SecA	0.00e+00	1.09e-22	0.0	0.7953
1. PBF	Q03HZ9	Protein translocase subunit SecA 2	0.00e+00	4.68e-21	2.63e-160	0.8015
1. PBF	Q9X1R4	Protein translocase subunit SecA	0.00e+00	6.90e-24	0.0	0.7128
1. PBF	A7X735	Protein translocase subunit SecA 2	0.00e+00	6.20e-20	5.27e-155	0.8587
1. PBF	A1AM15	Protein translocase subunit SecA	0.00e+00	7.33e-23	0.0	0.8274
1. PBF	P0DF66	Protein translocase subunit SecA	0.00e+00	3.69e-28	0.0	0.8003
1. PBF	Q6NCG2	Protein translocase subunit SecA	0.00e+00	9.59e-24	0.0	0.8357
1. PBF	Q3K7T9	Protein translocase subunit SecA	0.00e+00	6.49e-27	0.0	0.856
1. PBF	Q01Y13	Protein translocase subunit SecA	0.00e+00	2.69e-26	1.99e-149	0.7356
1. PBF	A6L3G1	Protein translocase subunit SecA	6.88e-15	1.29e-08	9.49e-97	0.6928
1. PBF	C1C8U0	Protein translocase subunit SecA	0.00e+00	7.96e-28	0.0	0.8124
1. PBF	A4VPA3	Protein translocase subunit SecA	0.00e+00	2.85e-29	0.0	0.8123
1. PBF	Q2NJH2	Protein translocase subunit SecA	0.00e+00	1.31e-30	0.0	0.856
1. PBF	Q82W86	Protein translocase subunit SecA	0.00e+00	5.15e-28	0.0	0.8654
1. PBF	Q89AR1	Protein translocase subunit SecA	0.00e+00	2.03e-18	0.0	0.8319
1. PBF	C5CAR1	Protein translocase subunit SecA	0.00e+00	2.85e-40	0.0	0.7922
1. PBF	A4WW84	Protein translocase subunit SecA	0.00e+00	1.97e-28	0.0	0.8455
1. PBF	Q7NJJ6	Protein translocase subunit SecA	0.00e+00	2.33e-19	2.95e-149	0.7585
1. PBF	A7GYW4	Protein translocase subunit SecA	0.00e+00	1.06e-25	0.0	0.8395
1. PBF	Q38YD2	Protein translocase subunit SecA	0.00e+00	8.91e-19	0.0	0.9207
1. PBF	A7G9S6	Protein translocase subunit SecA	0.00e+00	2.76e-24	0.0	0.8015
1. PBF	Q601A7	Protein translocase subunit SecA	0.00e+00	4.24e-63	0.0	0.7945
1. PBF	B5FB28	Protein translocase subunit SecA	0.00e+00	6.66e-26	0.0	0.716
1. PBF	B3WCM7	Protein translocase subunit SecA	0.00e+00	5.25e-19	0.0	0.8106
1. PBF	A1BFX2	Protein translocase subunit SecA	1.11e-16	2.42e-12	3.83e-116	0.7048
1. PBF	Q1CT83	Protein translocase subunit SecA	0.00e+00	1.24e-24	0.0	0.7845
1. PBF	A0RNI3	Protein translocase subunit SecA	0.00e+00	3.62e-23	0.0	0.858
1. PBF	Q5GW49	Protein translocase subunit SecA	0.00e+00	8.65e-28	0.0	0.846
1. PBF	A7FM57	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8407
1. PBF	A5WH15	Protein translocase subunit SecA	0.00e+00	3.56e-32	0.0	0.8386
1. PBF	B9LJ40	Protein translocase subunit SecA	0.00e+00	2.11e-26	0.0	0.7864
1. PBF	B3ESI0	Protein translocase subunit SecA	2.16e-10	4.77e-21	1.51e-103	0.7064
1. PBF	Q8XIF0	Protein translocase subunit SecA	0.00e+00	1.44e-28	0.0	0.807
1. PBF	Q4FV40	Protein translocase subunit SecA	0.00e+00	3.04e-27	0.0	0.7951
1. PBF	B4RWX1	Protein translocase subunit SecA	0.00e+00	1.90e-27	0.0	0.8555
1. PBF	A8IHQ3	Protein translocase subunit SecA	0.00e+00	6.28e-30	0.0	0.7945
1. PBF	Q49VV2	Protein translocase subunit SecA	0.00e+00	7.86e-25	0.0	0.8037
1. PBF	Q5KV94	Protein translocase subunit SecA 1	0.00e+00	3.57e-26	0.0	0.792
1. PBF	Q0B0B4	Protein translocase subunit SecA	0.00e+00	2.04e-25	0.0	0.8465
1. PBF	Q5NP12	Protein translocase subunit SecA	0.00e+00	3.97e-35	0.0	0.8007
1. PBF	B0UUI9	Protein translocase subunit SecA	0.00e+00	1.31e-24	0.0	0.8087
1. PBF	A6UCG8	Protein translocase subunit SecA	0.00e+00	1.10e-25	0.0	0.8245
1. PBF	B5YZD4	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.8463
1. PBF	Q7VQI2	Protein translocase subunit SecA	0.00e+00	5.87e-20	0.0	0.8563
1. PBF	A6GX63	Protein translocase subunit SecA	3.14e-10	2.13e-15	1.41e-101	0.6903
1. PBF	Q6MEX9	Protein translocase subunit SecA	3.33e-16	2.29e-17	1.01e-98	0.7217
1. PBF	B9EAE8	Protein translocase subunit SecA	0.00e+00	9.96e-25	0.0	0.8155
1. PBF	Q5GT19	Protein translocase subunit SecA	0.00e+00	2.80e-20	0.0	0.8166
1. PBF	A3CM59	Protein translocase subunit SecA 2	0.00e+00	3.01e-20	0.0	0.8263
1. PBF	Q6LMG3	Protein translocase subunit SecA	3.33e-16	2.53e-27	0.0	0.7036
1. PBF	Q821L5	Protein translocase subunit SecA	0.00e+00	7.86e-15	3.64e-91	0.7378
1. PBF	A4SV83	Protein translocase subunit SecA	2.14e-13	9.96e-27	0.0	0.7588
1. PBF	A1R844	Protein translocase subunit SecA	0.00e+00	7.92e-40	0.0	0.8187
1. PBF	Q5E2Q8	Protein translocase subunit SecA	0.00e+00	6.03e-26	0.0	0.7831
1. PBF	B5E808	Protein translocase subunit SecA	0.00e+00	5.66e-20	3.06e-159	0.7749
1. PBF	Q03GZ8	Protein translocase subunit SecA 1	0.00e+00	2.09e-19	0.0	0.8096
1. PBF	Q6GIN8	Protein translocase subunit SecA 1	1.39e-13	2.86e-27	0.0	0.8069
1. PBF	Q72J92	Protein translocase subunit SecA	0.00e+00	6.38e-24	2.36e-127	0.7236
1. PBF	B9JB90	Protein translocase subunit SecA	0.00e+00	1.35e-26	0.0	0.8277
1. PBF	Q2KVH9	Protein translocase subunit SecA 1	0.00e+00	2.98e-26	0.0	0.8326
1. PBF	B2SYW6	Protein translocase subunit SecA	0.00e+00	2.75e-27	0.0	0.8426
1. PBF	Q98G67	Protein translocase subunit SecA	0.00e+00	4.08e-29	0.0	0.8283
1. PBF	Q06461	Protein translocase subunit SecA	0.00e+00	2.75e-20	1.27e-136	0.8107
1. PBF	A3MR73	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8563
1. PBF	B8DRH3	Protein translocase subunit SecA	0.00e+00	2.06e-27	0.0	0.8499
1. PBF	P95759	Protein translocase subunit SecA	0.00e+00	8.25e-39	0.0	0.8058
1. PBF	Q87AG8	Protein translocase subunit SecA	0.00e+00	5.30e-30	0.0	0.8593
1. PBF	Q9CLK7	Protein translocase subunit SecA	0.00e+00	1.47e-23	0.0	0.8322
1. PBF	A6VQX0	Protein translocase subunit SecA	0.00e+00	6.42e-30	0.0	0.8406
1. PBF	C1CWX4	Protein translocase subunit SecA	0.00e+00	6.69e-18	1.75e-137	0.8093
1. PBF	A1ISV1	Protein translocase subunit SecA	0.00e+00	1.66e-30	0.0	0.8024
1. PBF	A7MXQ8	Protein translocase subunit SecA	3.16e-14	2.51e-29	0.0	0.7781
1. PBF	B5ZRT0	Protein translocase subunit SecA	0.00e+00	8.14e-26	0.0	0.8293
1. PBF	Q8DHU4	Protein translocase subunit SecA	0.00e+00	3.23e-25	1.92e-159	0.7717
1. PBF	Q4FNA5	Protein translocase subunit SecA	0.00e+00	2.46e-31	0.0	0.8915
1. PBF	Q1LIN6	Protein translocase subunit SecA	0.00e+00	6.08e-28	0.0	0.847
1. PBF	B8EM60	Protein translocase subunit SecA	0.00e+00	7.48e-28	0.0	0.8449
1. PBF	Q73UL2	Protein translocase subunit SecA 1	3.33e-16	1.13e-47	0.0	0.7759
1. PBF	B5RH72	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8468
1. PBF	Q92E69	Protein translocase subunit SecA 2	0.00e+00	3.56e-19	0.0	0.8073
1. PBF	Q6D0J2	Protein translocase subunit SecA	0.00e+00	2.93e-24	0.0	0.8509
1. PBF	B1JK72	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8446
1. PBF	Q5P705	Protein translocase subunit SecA	0.00e+00	9.79e-28	0.0	0.8545
1. PBF	P0DF67	Protein translocase subunit SecA	0.00e+00	3.69e-28	0.0	0.8001
1. PBF	Q5FQC8	Protein translocase subunit SecA	0.00e+00	5.62e-31	0.0	0.8288
1. PBF	Q2NZC7	Protein translocase subunit SecA	0.00e+00	8.65e-28	0.0	0.8572
1. PBF	B7NHK4	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.7785
1. PBF	Q2A2E3	Protein translocase subunit SecA	0.00e+00	1.98e-27	0.0	0.8776
1. PBF	A8F530	Protein translocase subunit SecA	2.22e-16	4.50e-24	0.0	0.7533
1. PBF	C4K1J0	Protein translocase subunit SecA	0.00e+00	6.21e-28	0.0	0.7723
1. PBF	B4U965	Protein translocase subunit SecA	2.22e-16	1.87e-26	3.37e-180	0.7198
1. PBF	B1KSU4	Protein translocase subunit SecA	0.00e+00	3.70e-24	0.0	0.8124
1. PBF	Q7W4C3	Protein translocase subunit SecA	0.00e+00	3.93e-25	0.0	0.8424
1. PBF	Q7M919	Protein translocase subunit SecA	0.00e+00	2.48e-28	0.0	0.8451
1. PBF	B7MNV7	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.8406
1. PBF	B2RKT2	Protein translocase subunit SecA	4.39e-14	2.39e-10	4.66e-99	0.7067
1. PBF	B7GWR2	Protein translocase subunit SecA	0.00e+00	1.97e-33	0.0	0.8519
1. PBF	Q1JF92	Protein translocase subunit SecA	0.00e+00	6.34e-28	0.0	0.8078
1. PBF	B5E749	Protein translocase subunit SecA	1.03e-12	7.96e-28	0.0	0.8125
1. PBF	B5XI23	Protein translocase subunit SecA	0.00e+00	4.01e-28	0.0	0.8007
1. PBF	Q631G4	Protein translocase subunit SecA 1	0.00e+00	1.35e-29	0.0	0.79
1. PBF	Q12SB8	Protein translocase subunit SecA	0.00e+00	9.18e-26	0.0	0.7649
1. PBF	Q3A245	Protein translocase subunit SecA	0.00e+00	7.61e-22	0.0	0.7958
1. PBF	O78441	Protein translocase subunit SecA	0.00e+00	2.49e-16	1.65e-153	0.8226
1. PBF	Q6G5U2	Protein translocase subunit SecA	0.00e+00	5.26e-28	0.0	0.8226
1. PBF	Q9PF72	Protein translocase subunit SecA	0.00e+00	6.28e-30	0.0	0.8564
1. PBF	B1IR80	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.7788
1. PBF	B1KKW9	Protein translocase subunit SecA	1.89e-15	5.48e-28	0.0	0.7678
1. PBF	B3PCL0	Protein translocase subunit SecA	0.00e+00	1.19e-29	0.0	0.8032
1. PBF	A8AVC1	Protein translocase subunit SecA	0.00e+00	1.06e-27	0.0	0.8055
1. PBF	Q46IG8	Protein translocase subunit SecA	0.00e+00	1.03e-21	2.26e-144	0.7463
1. PBF	Q21UD1	Protein translocase subunit SecA	0.00e+00	2.54e-25	0.0	0.856
1. PBF	Q99QY9	Protein translocase subunit SecA 2	0.00e+00	6.20e-20	5.27e-155	0.8484
1. PBF	Q493P5	Protein translocase subunit SecA	0.00e+00	1.89e-25	0.0	0.8576
1. PBF	Q3B3Y1	Protein translocase subunit SecA	2.44e-15	2.03e-08	1.94e-118	0.7099
1. PBF	P47318	Protein translocase subunit SecA	0.00e+00	5.85e-25	0.0	0.9679
1. PBF	A5UI51	Protein translocase subunit SecA	0.00e+00	5.34e-26	0.0	0.8315
1. PBF	B0SEW5	Protein translocase subunit SecA	0.00e+00	4.01e-30	5.74e-174	0.8054
1. PBF	A1A268	Protein translocase subunit SecA	0.00e+00	1.07e-36	0.0	0.8529
1. PBF	A1UCM5	Protein translocase subunit SecA 1	0.00e+00	1.68e-48	0.0	0.84
1. PBF	Q04J70	Protein translocase subunit SecA	1.22e-15	9.20e-28	0.0	0.8177
1. PBF	A2RCT1	Protein translocase subunit SecA	0.00e+00	3.69e-28	0.0	0.7989
1. PBF	A9KY37	Protein translocase subunit SecA	0.00e+00	2.69e-27	0.0	0.7773
1. PBF	A8LQ60	Protein translocase subunit SecA	0.00e+00	2.69e-27	0.0	0.8373
1. PBF	B7ICY9	Protein translocase subunit SecA	0.00e+00	1.88e-23	0.0	0.7292
1. PBF	A8GP42	Protein translocase subunit SecA	0.00e+00	2.20e-30	0.0	0.7762
1. PBF	Q74BJ1	Protein translocase subunit SecA	0.00e+00	1.26e-23	0.0	0.8037
1. PBF	A1A7E3	Protein translocase subunit SecA	0.00e+00	3.23e-24	0.0	0.7798
1. PBF	B8D900	Protein translocase subunit SecA	0.00e+00	5.33e-22	0.0	0.8545
1. PBF	Q8FRI7	Protein translocase subunit SecA 1	0.00e+00	4.09e-20	0.0	0.776
1. PBF	A2BTM1	Protein translocase subunit SecA	0.00e+00	1.24e-20	5.14e-137	0.757
1. PBF	Q1I5C6	Protein translocase subunit SecA	0.00e+00	1.99e-26	0.0	0.8507
1. PBF	A9M0X2	Protein translocase subunit SecA	0.00e+00	1.77e-30	0.0	0.8058
1. PBF	B9M3K9	Protein translocase subunit SecA	0.00e+00	7.41e-25	0.0	0.8159
1. PBF	Q73LG6	Protein translocase subunit SecA	0.00e+00	1.49e-23	0.0	0.802
1. PBF	B8DTA0	Protein translocase subunit SecA	0.00e+00	2.78e-36	0.0	0.8219
1. PBF	Q8DNT8	Protein translocase subunit SecA	0.00e+00	8.65e-28	0.0	0.8104
1. PBF	Q7A1G4	Protein translocase subunit SecA 1	0.00e+00	2.48e-27	0.0	0.8016
1. PBF	B5Z7E8	Protein translocase subunit SecA	0.00e+00	2.18e-24	0.0	0.8363
1. PBF	A3NDV4	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8592
1. PBF	Q71WR8	Protein translocase subunit SecA 1	0.00e+00	2.14e-27	0.0	0.8164
1. PBF	A5VSR9	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.8401
1. PBF	Q47VS0	Protein translocase subunit SecA	0.00e+00	7.56e-25	0.0	0.7667
1. PBF	A8FLZ7	Protein translocase subunit SecA	0.00e+00	1.03e-28	0.0	0.9123
1. PBF	Q5HQX6	Protein translocase subunit SecA 1	0.00e+00	7.19e-27	0.0	0.8076
1. PBF	Q2SZH4	Protein translocase subunit SecA	0.00e+00	2.88e-28	0.0	0.862
1. PBF	Q0RR55	Protein translocase subunit SecA	0.00e+00	1.03e-33	0.0	0.7908
1. PBF	B6ELG8	Protein translocase subunit SecA	1.49e-13	7.48e-27	0.0	0.763
1. PBF	B2HYI3	Protein translocase subunit SecA	0.00e+00	2.06e-33	0.0	0.8348
1. PBF	C0Z6T7	Protein translocase subunit SecA	1.37e-13	1.66e-31	0.0	0.8157
1. PBF	Q9CJ85	Protein translocase subunit SecA	8.88e-16	9.56e-26	0.0	0.7838
1. PBF	A0RAC8	Protein translocase subunit SecA 2	0.00e+00	1.47e-15	0.0	0.8862
1. PBF	A1SU27	Protein translocase subunit SecA	0.00e+00	5.37e-28	0.0	0.7606
1. PBF	B7K818	Protein translocase subunit SecA	0.00e+00	3.10e-23	1.59e-154	0.7488
1. PBF	A4JBA3	Protein translocase subunit SecA	0.00e+00	7.19e-27	0.0	0.8579
1. PBF	Q7CGB6	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8285
1. PBF	A0QYG9	Protein translocase subunit SecA 2	0.00e+00	3.55e-09	9.89e-116	0.7139
1. PBF	Q82DB1	Protein translocase subunit SecA 1	6.66e-16	1.03e-39	0.0	0.7887
1. PBF	Q6MR29	Protein translocase subunit SecA	0.00e+00	2.86e-39	0.0	0.8369
1. PBF	Q3B0N0	Protein translocase subunit SecA	0.00e+00	1.20e-19	1.80e-142	0.7473
1. PBF	Q9KPH4	Protein translocase subunit SecA	1.13e-11	2.38e-26	0.0	0.7155
1. PBF	Q5WDF8	Protein translocase subunit SecA	6.95e-14	3.62e-28	0.0	0.7907
1. PBF	B1LG35	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8446
1. PBF	P0A4G7	Protein translocase subunit SecA	0.00e+00	3.46e-38	0.0	0.7807
1. PBF	Q057U3	Protein translocase subunit SecA	0.00e+00	7.67e-18	0.0	0.8224
1. PBF	A6MVS6	Protein translocase subunit SecA	0.00e+00	1.81e-17	4.13e-152	0.8416
1. PBF	B4SHA9	Protein translocase subunit SecA	1.07e-13	1.16e-08	4.15e-114	0.7156
1. PBF	C1D5K2	Protein translocase subunit SecA	0.00e+00	1.74e-28	0.0	0.8608
1. PBF	A5CPU4	Protein translocase subunit SecA	4.14e-13	1.51e-47	0.0	0.764
1. PBF	A1KUX1	Protein translocase subunit SecA	0.00e+00	1.25e-30	0.0	0.8057
1. PBF	A3PNL7	Protein translocase subunit SecA	0.00e+00	1.28e-27	0.0	0.8412
1. PBF	Q74L37	Protein translocase subunit SecA 2	0.00e+00	7.33e-22	3.12e-148	0.8579
1. PBF	B1XC75	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8538
1. PBF	Q6B8L3	Protein translocase subunit SecA	0.00e+00	9.04e-23	6.23e-139	0.8284
1. PBF	Q8ZRT7	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8357
1. PBF	B2GAI7	Protein translocase subunit SecA	0.00e+00	1.81e-17	0.0	0.9243
1. PBF	B4SJY4	Protein translocase subunit SecA	0.00e+00	9.04e-30	0.0	0.8344
1. PBF	Q0SP11	Protein translocase subunit SecA	0.00e+00	6.90e-24	0.0	0.8208
1. PBF	A1B592	Protein translocase subunit SecA	0.00e+00	7.48e-27	0.0	0.8423
1. PBF	A0KPW5	Protein translocase subunit SecA	1.13e-14	4.05e-27	0.0	0.725
1. PBF	A5GEX9	Protein translocase subunit SecA	0.00e+00	6.02e-24	0.0	0.7888
1. PBF	Q12FA8	Protein translocase subunit SecA	0.00e+00	5.40e-25	0.0	0.8615
1. PBF	Q1JA48	Protein translocase subunit SecA	0.00e+00	6.34e-28	0.0	0.8006
1. PBF	A5F5P1	Protein translocase subunit SecA	4.56e-12	2.38e-26	0.0	0.7712
1. PBF	P51381	Protein translocase subunit SecA	0.00e+00	5.75e-22	2.55e-149	0.8315
1. PBF	Q318A2	Protein translocase subunit SecA	0.00e+00	5.66e-20	2.16e-140	0.7653
1. PBF	Q8E484	Protein translocase subunit SecA 2	0.00e+00	8.11e-20	9.70e-171	0.8227
1. PBF	A2RHJ5	Protein translocase subunit SecA	1.30e-13	8.82e-26	0.0	0.776
1. PBF	B2UCW7	Protein translocase subunit SecA	0.00e+00	1.23e-30	0.0	0.843
1. PBF	Q722W7	Protein translocase subunit SecA 2	0.00e+00	7.47e-19	0.0	0.8118
1. PBF	Q1BZF4	Protein translocase subunit SecA	0.00e+00	8.29e-27	0.0	0.8503
1. PBF	Q48RM6	Protein translocase subunit SecA	0.00e+00	2.43e-28	0.0	0.8016
1. PBF	B2VD75	Protein translocase subunit SecA	0.00e+00	7.37e-26	0.0	0.8497
1. PBF	A0LCX0	Protein translocase subunit SecA 1	0.00e+00	2.11e-26	0.0	0.8506
1. PBF	A7ICM7	Protein translocase subunit SecA	0.00e+00	9.76e-27	0.0	0.8201
1. PBF	Q14I65	Protein translocase subunit SecA	0.00e+00	1.28e-27	0.0	0.8766
1. PBF	Q8NSB6	Protein translocase subunit SecA 1	0.00e+00	3.15e-19	0.0	0.7914
1. PBF	A3MYW1	Protein translocase subunit SecA	0.00e+00	7.37e-26	0.0	0.8028
1. PBF	Q5PDC9	Protein translocase subunit SecA	0.00e+00	3.77e-24	0.0	0.847
1. PBF	Q6G625	Protein translocase subunit SecA 2	0.00e+00	7.69e-20	9.67e-155	0.8382
1. PBF	C5C1N8	Protein translocase subunit SecA	1.53e-14	3.02e-43	0.0	0.7992
1. PBF	B2U2A4	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.7742
1. PBF	B2UZL5	Protein translocase subunit SecA	0.00e+00	2.42e-22	0.0	0.9082
1. PBF	A5FS29	Protein translocase subunit SecA	0.00e+00	3.50e-13	0.0	0.7852
1. PBF	C5CXY9	Protein translocase subunit SecA	0.00e+00	6.63e-29	0.0	0.8639
1. PBF	B5ELD9	Protein translocase subunit SecA	0.00e+00	5.16e-31	0.0	0.8298
1. PBF	A5N3B2	Protein translocase subunit SecA	0.00e+00	1.29e-25	0.0	0.8185
1. PBF	Q3IYN1	Protein translocase subunit SecA	0.00e+00	4.14e-27	0.0	0.871
1. PBF	Q2YLU0	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.826
1. PBF	Q834A7	Protein translocase subunit SecA	0.00e+00	4.56e-30	0.0	0.798
1. PBF	Q2INY3	Protein translocase subunit SecA	0.00e+00	9.96e-27	0.0	0.7949
1. PBF	Q02H37	Protein translocase subunit SecA	0.00e+00	2.91e-29	0.0	0.8346
1. PBF	Q2ST71	Protein translocase subunit SecA	0.00e+00	6.75e-123	0.0	0.9215
1. PBF	Q3MB92	Protein translocase subunit SecA	0.00e+00	3.33e-22	2.85e-162	0.7684
1. PBF	B6IUW0	Protein translocase subunit SecA	0.00e+00	5.87e-31	0.0	0.8734
1. PBF	A7FQJ3	Protein translocase subunit SecA	0.00e+00	2.18e-24	0.0	0.8109
1. PBF	A2C591	Protein translocase subunit SecA	0.00e+00	1.03e-20	3.32e-137	0.7465
1. PBF	A5CY18	Protein translocase subunit SecA	0.00e+00	3.92e-24	0.0	0.8518
1. PBF	Q8PPA0	Protein translocase subunit SecA	0.00e+00	8.83e-28	0.0	0.8199
1. PBF	Q3Z9C1	Protein translocase subunit SecA	1.11e-16	2.54e-13	0.0	0.7752
1. PBF	Q607S5	Protein translocase subunit SecA	0.00e+00	2.01e-30	0.0	0.7481
1. PBF	Q5HUL7	Protein translocase subunit SecA	0.00e+00	1.71e-29	0.0	0.9008
1. PBF	B2FPB2	Protein translocase subunit SecA	0.00e+00	1.94e-29	0.0	0.8382
1. PBF	A1WPS8	Protein translocase subunit SecA	0.00e+00	3.54e-28	0.0	0.8517
1. PBF	Q32JZ4	Protein translocase subunit SecA	0.00e+00	2.76e-24	0.0	0.8285
1. PBF	A6WID9	Protein translocase subunit SecA	6.94e-13	2.69e-27	0.0	0.7665
1. PBF	B8CNL9	Protein translocase subunit SecA	0.00e+00	3.23e-26	0.0	0.7652
1. PBF	A2C5Z6	Protein translocase subunit SecA	0.00e+00	1.88e-20	1.61e-142	0.751
1. PBF	Q0TLP1	Protein translocase subunit SecA	0.00e+00	3.56e-24	0.0	0.7734
1. PBF	Q0IDZ9	Protein translocase subunit SecA	0.00e+00	2.50e-19	1.03e-146	0.7511
1. PBF	Q8Z9G3	Protein translocase subunit SecA	0.00e+00	1.10e-24	0.0	0.8413
1. PBF	B3DR89	Protein translocase subunit SecA	0.00e+00	4.22e-33	0.0	0.8403
1. PBF	Q2RLX5	Protein translocase subunit SecA	0.00e+00	8.27e-21	0.0	0.8177
1. PBF	Q7VUR2	Protein translocase subunit SecA	0.00e+00	3.49e-25	0.0	0.8267
1. PBF	A3DF88	Protein translocase subunit SecA	0.00e+00	5.07e-19	0.0	0.7519
1. PBF	Q3J799	Protein translocase subunit SecA	0.00e+00	1.82e-28	0.0	0.7658
1. PBF	A6WXN8	Protein translocase subunit SecA	0.00e+00	5.77e-30	0.0	0.8278
1. PBF	Q6NIR8	Protein translocase subunit SecA 1	0.00e+00	1.04e-23	0.0	0.8595
1. PBF	Q3BXE3	Protein translocase subunit SecA	0.00e+00	5.15e-28	0.0	0.8388
1. PBF	A7MQ63	Protein translocase subunit SecA	0.00e+00	8.14e-26	0.0	0.8432
1. PBF	A0AG36	Protein translocase subunit SecA 2	0.00e+00	1.67e-18	0.0	0.8103
1. PBF	Q5N2Q7	Protein translocase subunit SecA	0.00e+00	2.51e-22	4.34e-148	0.7553
1. PBF	Q5FL75	Protein translocase subunit SecA	0.00e+00	1.28e-16	0.0	0.9224
1. PBF	A4G8S7	Protein translocase subunit SecA	0.00e+00	2.48e-27	0.0	0.8391
1. PBF	B2GL56	Protein translocase subunit SecA	0.00e+00	1.49e-39	0.0	0.8477
1. PBF	Q17XE2	Protein translocase subunit SecA	4.77e-15	3.77e-28	0.0	0.8228
1. PBF	A7ZW50	Protein translocase subunit SecA	0.00e+00	9.02e-25	0.0	0.8526
1. PBF	Q5HA05	Protein translocase subunit SecA	1.29e-14	3.62e-23	0.0	0.7611
1. PBF	A9I4Y3	Protein translocase subunit SecA	0.00e+00	1.25e-26	0.0	0.825
1. PBF	B3QN61	Protein translocase subunit SecA	1.55e-15	3.92e-07	2.07e-116	0.711
1. PBF	Q5LWK0	Protein translocase subunit SecA 1	0.00e+00	5.91e-26	0.0	0.832
1. PBF	Q6MUE3	Protein translocase subunit SecA	0.00e+00	3.38e-132	0.0	0.8492
1. PBF	Q3IJE7	Protein translocase subunit SecA	0.00e+00	2.32e-24	0.0	0.768
1. PBF	A7ZHI9	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8496
1. PBF	Q89XV1	Protein translocase subunit SecA	0.00e+00	7.03e-24	0.0	0.8335
1. PBF	Q7VKT3	Protein translocase subunit SecA	0.00e+00	3.36e-26	0.0	0.7858
1. PBF	B1XT18	Protein translocase subunit SecA	2.22e-15	1.71e-25	0.0	0.7577
1. PBF	Q5L4W3	Protein translocase subunit SecA	0.00e+00	1.35e-14	1.18e-89	0.7392
1. PBF	Q5P9Q9	Protein translocase subunit SecA	0.00e+00	4.95e-21	0.0	0.8509
1. PBF	P57297	Protein translocase subunit SecA	0.00e+00	5.13e-22	0.0	0.8449
1. PBF	A8GSU6	Protein translocase subunit SecA	0.00e+00	1.12e-28	0.0	0.7738
1. PBF	Q1JK98	Protein translocase subunit SecA	0.00e+00	6.34e-28	0.0	0.8085
1. PBF	B1AIA8	Protein translocase subunit SecA	0.00e+00	3.47e-34	0.0	0.9361
1. PBF	C1DQA8	Protein translocase subunit SecA	0.00e+00	1.57e-29	0.0	0.841
1. PBF	B7UIE8	Protein translocase subunit SecA	0.00e+00	1.73e-24	0.0	0.8491
1. PBF	Q83SN2	Protein translocase subunit SecA	0.00e+00	7.41e-25	0.0	0.8385
1. PBF	Q3Z5R1	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8402
1. PBF	B2I9A3	Protein translocase subunit SecA	0.00e+00	5.30e-30	0.0	0.8491
1. PBF	B8D7A5	Protein translocase subunit SecA	0.00e+00	5.13e-22	0.0	0.8606
1. PBF	A5W8P2	Protein translocase subunit SecA	0.00e+00	1.00e-27	0.0	0.8369
1. PBF	Q8NUJ8	Protein translocase subunit SecA 2	0.00e+00	7.69e-20	9.67e-155	0.8507
1. PBF	Q15Q25	Protein translocase subunit SecA	0.00e+00	2.07e-29	0.0	0.8568
1. PBF	C1B1E2	Protein translocase subunit SecA	0.00e+00	1.38e-35	0.0	0.8563
1. PBF	Q0BUI2	Protein translocase subunit SecA	0.00e+00	6.41e-31	0.0	0.8536
1. PBF	Q1MB97	Protein translocase subunit SecA	0.00e+00	2.34e-26	0.0	0.84
1. PBF	Q1QE45	Protein translocase subunit SecA	0.00e+00	1.02e-27	0.0	0.8364
1. PBF	Q7WFT1	Protein translocase subunit SecA	0.00e+00	3.49e-25	0.0	0.8375
1. PBF	B0B8S7	Protein translocase subunit SecA	0.00e+00	6.28e-16	6.72e-102	0.7367
1. PBF	C4LA32	Protein translocase subunit SecA	6.66e-16	1.00e-27	0.0	0.7788
1. PBF	Q0SR11	Protein translocase subunit SecA	0.00e+00	1.85e-28	0.0	0.8072
1. PBF	B4SU57	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8442
1. PBF	C4ZRJ3	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8522
1. PBF	Q9AET6	Protein translocase subunit SecA 2	0.00e+00	1.12e-18	2.37e-174	0.8241
1. PBF	Q41062	Protein translocase subunit SecA, chloroplastic	0.00e+00	2.56e-10	1.28e-149	0.7732
1. PBF	Q0P9V7	Protein translocase subunit SecA	0.00e+00	3.45e-29	0.0	0.9011
1. PBF	Q31I38	Protein translocase subunit SecA	0.00e+00	1.41e-26	0.0	0.8406
1. PBF	C0ZWZ6	Protein translocase subunit SecA	0.00e+00	4.50e-38	0.0	0.7931
1. PBF	Q5ZVH7	Protein translocase subunit SecA	0.00e+00	6.38e-24	0.0	0.811
1. PBF	B4F102	Protein translocase subunit SecA	0.00e+00	1.31e-24	0.0	0.8444
1. PBF	Q39X31	Protein translocase subunit SecA	0.00e+00	1.55e-23	0.0	0.8258
1. PBF	Q2K3R7	Protein translocase subunit SecA	0.00e+00	6.71e-25	0.0	0.8355
1. PBF	Q8ENI7	Protein translocase subunit SecA	0.00e+00	7.14e-30	0.0	0.8257
1. PBF	B2KAS3	Protein translocase subunit SecA	0.00e+00	2.69e-21	0.0	0.8186
1. PBF	B4TXI5	Protein translocase subunit SecA	0.00e+00	2.76e-24	0.0	0.8075
1. PBF	B1LB87	Protein translocase subunit SecA	1.11e-16	7.12e-25	0.0	0.7127
1. PBF	B0BSP6	Protein translocase subunit SecA	0.00e+00	7.37e-26	0.0	0.8216
1. PBF	B5YKT5	Protein translocase subunit SecA	0.00e+00	2.13e-19	0.0	0.7978
1. PBF	B9JTG7	Protein translocase subunit SecA	0.00e+00	1.85e-25	0.0	0.8343
1. PBF	A7I1V8	Protein translocase subunit SecA	0.00e+00	1.05e-28	0.0	0.8258
1. PBF	A4VXE1	Protein translocase subunit SecA	0.00e+00	6.49e-29	0.0	0.8056
1. PBF	Q2Y647	Protein translocase subunit SecA 1	0.00e+00	4.46e-30	0.0	0.7606
1. PBF	B8J1J9	Protein translocase subunit SecA	0.00e+00	6.94e-26	0.0	0.8167
1. PBF	Q07VC7	Protein translocase subunit SecA 1	0.00e+00	2.10e-24	4.71e-141	0.8248
1. PBF	B2S897	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.7976
1. PBF	B3EJ06	Protein translocase subunit SecA	2.33e-15	5.90e-09	2.09e-120	0.7193
1. PBF	Q2YSH6	Protein translocase subunit SecA	0.00e+00	2.48e-27	0.0	0.8078
1. PBF	A5CYJ1	Protein translocase subunit SecA	0.00e+00	3.12e-20	0.0	0.761
1. PBF	A5V9S7	Protein translocase subunit SecA	0.00e+00	3.67e-29	0.0	0.823
1. PBF	A0RKX7	Protein translocase subunit SecA 1	0.00e+00	1.35e-29	0.0	0.7856
1. PBF	Q9AET4	Protein translocase subunit SecA 1	0.00e+00	1.39e-27	0.0	0.8115
1. PBF	A0L1N4	Protein translocase subunit SecA	2.33e-15	4.49e-27	0.0	0.7617
1. PBF	P9WGP4	Protein translocase subunit SecA 1	0.00e+00	3.54e-41	0.0	0.8137
1. PBF	C0QZS7	Protein translocase subunit SecA	0.00e+00	4.37e-17	6.32e-147	0.7551
1. PBF	Q7UZM1	Protein translocase subunit SecA	0.00e+00	8.90e-21	7.17e-135	0.7493
1. PBF	A4J927	Protein translocase subunit SecA	0.00e+00	3.96e-19	0.0	0.7687
1. PBF	A3Q0I3	Protein translocase subunit SecA 2	0.00e+00	2.98e-07	1.71e-121	0.7709
1. PBF	Q7V975	Protein translocase subunit SecA	0.00e+00	3.18e-20	1.71e-142	0.7459
1. PBF	Q8CMU9	Protein translocase subunit SecA 2	0.00e+00	2.13e-20	2.57e-153	0.854
1. PBF	Q8NQJ4	Protein translocase subunit SecA 2	0.00e+00	2.11e-12	1.49e-108	0.8384
1. PBF	A3PWB2	Protein translocase subunit SecA 1	0.00e+00	5.95e-49	0.0	0.8435
1. PBF	Q9ZCX7	Protein translocase subunit SecA	3.33e-16	4.18e-28	0.0	0.7667
1. PBF	A1URS7	Protein translocase subunit SecA	0.00e+00	3.06e-28	0.0	0.8211
1. PBF	A9IMM8	Protein translocase subunit SecA	0.00e+00	1.95e-26	0.0	0.8282
1. PBF	Q48EG6	Protein translocase subunit SecA	0.00e+00	4.40e-27	0.0	0.8218
1. PBF	P0CAW7	Protein translocase subunit SecA	0.00e+00	3.57e-26	1.42e-180	0.828
1. PBF	B1JV87	Protein translocase subunit SecA	9.96e-12	8.12e-27	0.0	0.7513
1. PBF	Q11YU5	Protein translocase subunit SecA	1.06e-11	4.37e-16	2.25e-95	0.6957
1. PBF	Q1MQP3	Protein translocase subunit SecA	0.00e+00	7.98e-26	0.0	0.8634
1. PBF	A9KS12	Protein translocase subunit SecA	0.00e+00	1.30e-26	0.0	0.8367
1. PBF	P47994	Protein translocase subunit SecA	0.00e+00	4.01e-25	0.0	0.8089
1. PBF	Q6KIK4	Protein translocase subunit SecA	0.00e+00	1.03e-44	0.0	0.8818
1. PBF	A8ALJ8	Protein translocase subunit SecA	0.00e+00	4.96e-24	0.0	0.849
1. PBF	A1AV60	Protein translocase subunit SecA	5.55e-16	4.82e-23	0.0	0.7549
1. PBF	Q88YL7	Protein translocase subunit SecA	0.00e+00	9.47e-17	0.0	0.8124
1. PBF	B0SVL4	Protein translocase subunit SecA	0.00e+00	3.03e-29	0.0	0.8546
1. PBF	B1Y0N7	Protein translocase subunit SecA	0.00e+00	3.10e-24	0.0	0.8662
1. PBF	Q7MWS5	Protein translocase subunit SecA	5.45e-11	4.62e-11	4.18e-99	0.7087
1. PBF	Q65EC5	Protein translocase subunit SecA	0.00e+00	3.67e-29	0.0	0.7891
1. PBF	Q6AGI2	Protein translocase subunit SecA	2.22e-16	2.17e-43	0.0	0.7718
1. PBF	A6LQJ1	Protein translocase subunit SecA	0.00e+00	7.18e-28	0.0	0.9201
1. PBF	A6WEN1	Protein translocase subunit SecA	0.00e+00	9.93e-37	0.0	0.8246
1. PBF	Q97P83	Protein translocase subunit SecA 2	0.00e+00	8.72e-20	1.00e-174	0.8384
1. PBF	Q4UQX9	Protein translocase subunit SecA	0.00e+00	4.09e-30	0.0	0.842
1. PBF	A6LKK5	Protein translocase subunit SecA	8.10e-15	3.23e-23	0.0	0.728
1. PBF	Q1CML8	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8216
1. PBF	O07497	Protein translocase subunit SecA	0.00e+00	3.05e-23	0.0	0.7995
1. PBF	Q7MNU4	Protein translocase subunit SecA	2.63e-12	4.64e-28	0.0	0.7237
1. PBF	B6HZ76	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8473
1. PBF	Q8NZK2	Protein translocase subunit SecA	0.00e+00	6.34e-28	0.0	0.8026
1. PBF	Q8YMS8	Protein translocase subunit SecA	0.00e+00	2.98e-22	8.76e-163	0.7574
1. PBF	A5IM05	Protein translocase subunit SecA	1.11e-16	6.90e-24	0.0	0.7139
1. PBF	A3QIL3	Protein translocase subunit SecA	1.36e-13	7.06e-29	0.0	0.768
1. PBF	A6TUN0	Protein translocase subunit SecA 2	0.00e+00	4.14e-23	2.73e-154	0.827
1. PBF	Q04BJ2	Protein translocase subunit SecA	5.11e-15	8.45e-19	0.0	0.8008
1. PBF	Q98RA6	Protein translocase subunit SecA	0.00e+00	7.50e-44	0.0	0.8207
1. PBF	B0KFR8	Protein translocase subunit SecA	0.00e+00	1.61e-27	0.0	0.8406
1. PBF	G2K3V6	Protein translocase subunit SecA 2	1.11e-16	7.74e-19	0.0	0.8106
1. PBF	B9KFM5	Protein translocase subunit SecA	0.00e+00	3.16e-26	0.0	0.9007
1. PBF	B3R6V0	Protein translocase subunit SecA	0.00e+00	8.31e-26	0.0	0.8462
1. PBF	Q5NGR3	Protein translocase subunit SecA	0.00e+00	1.28e-27	0.0	0.8266
1. PBF	Q9PR25	Protein translocase subunit SecA	0.00e+00	3.47e-34	0.0	0.9526
1. PBF	Q662L1	Protein translocase subunit SecA	0.00e+00	1.74e-23	0.0	0.8011
1. PBF	Q46X03	Protein translocase subunit SecA	0.00e+00	1.27e-26	0.0	0.8229
1. PBF	A7ZD16	Protein translocase subunit SecA	0.00e+00	4.01e-30	0.0	0.8422
1. PBF	A5UDG6	Protein translocase subunit SecA	0.00e+00	7.67e-26	0.0	0.8337
1. PBF	Q47LZ9	Protein translocase subunit SecA 1	2.22e-16	3.64e-32	0.0	0.7718
1. PBF	P43803	Protein translocase subunit SecA	0.00e+00	4.93e-26	0.0	0.8282
1. PBF	B2G5Y8	Protein translocase subunit SecA	0.00e+00	1.01e-18	0.0	0.9522
1. PBF	A9R0R9	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.7765
1. PBF	Q88N69	Protein translocase subunit SecA	0.00e+00	1.98e-27	0.0	0.8394
1. PBF	A6VYJ1	Protein translocase subunit SecA	8.88e-16	8.47e-28	0.0	0.771
1. PBF	Q62GT8	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8544
1. PBF	Q3ANH2	Protein translocase subunit SecA	0.00e+00	1.22e-18	5.65e-145	0.7619
1. PBF	B3H080	Protein translocase subunit SecA	0.00e+00	5.91e-26	0.0	0.8342
1. PBF	Q6NHD5	Protein translocase subunit SecA 2	0.00e+00	9.69e-13	7.40e-113	0.7995
1. PBF	A4SI63	Protein translocase subunit SecA	0.00e+00	4.77e-27	0.0	0.8334
1. PBF	A0Q5P9	Protein translocase subunit SecA	0.00e+00	4.68e-27	0.0	0.8613
1. PBF	A1S2G7	Protein translocase subunit SecA	4.75e-13	8.83e-28	0.0	0.7648
1. PBF	A5GI02	Protein translocase subunit SecA	0.00e+00	2.98e-19	2.32e-147	0.7497
1. PBF	Q1RI36	Protein translocase subunit SecA	0.00e+00	2.57e-31	0.0	0.7645
1. PBF	Q6HMU3	Protein translocase subunit SecA 2	0.00e+00	6.77e-17	0.0	0.8937
1. PBF	B1LXI2	Protein translocase subunit SecA	0.00e+00	7.64e-27	0.0	0.837
1. PBF	Q85G35	Protein translocase subunit SecA	0.00e+00	8.16e-16	0.0	0.8559
1. PBF	B7J3W9	Protein translocase subunit SecA	0.00e+00	5.16e-31	0.0	0.8342
1. PBF	B2ID49	Protein translocase subunit SecA	0.00e+00	3.56e-31	0.0	0.8442
1. PBF	P28366	Protein translocase subunit SecA	0.00e+00	4.44e-29	0.0	0.7814
1. PBF	B4U176	Protein translocase subunit SecA	0.00e+00	4.06e-31	0.0	0.796
1. PBF	Q7V9M9	Protein translocase subunit SecA	0.00e+00	1.20e-17	3.41e-146	0.7507
1. PBF	Q5YQU1	Protein translocase subunit SecA	0.00e+00	7.62e-42	0.0	0.8558
1. PBF	O25475	Protein translocase subunit SecA	0.00e+00	2.46e-24	0.0	0.839
1. PBF	Q2J2R9	Protein translocase subunit SecA	0.00e+00	2.93e-24	2.75e-140	0.8275
1. PBF	Q2FDL0	Protein translocase subunit SecA 2	0.00e+00	8.11e-20	4.04e-155	0.8565
1. PBF	Q8E3M6	Protein translocase subunit SecA 1	0.00e+00	3.37e-29	0.0	0.8023
1. PBF	B6JM18	Protein translocase subunit SecA	0.00e+00	2.60e-24	0.0	0.8449
1. PBF	A1V0Q8	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8557
1. PBF	Q5HKR6	Protein translocase subunit SecA 2	0.00e+00	1.78e-20	2.54e-153	0.8522
1. PBF	C1CM38	Protein translocase subunit SecA	0.00e+00	1.54e-27	0.0	0.811
1. PBF	A5URI4	Protein translocase subunit SecA	0.00e+00	1.10e-30	0.0	0.7971
1. PBF	A1T5Y4	Protein translocase subunit SecA 1	0.00e+00	2.84e-46	0.0	0.8454
1. PBF	Q1D1H8	Protein translocase subunit SecA	0.00e+00	1.90e-27	0.0	0.7834
1. PBF	Q4A8S6	Protein translocase subunit SecA	0.00e+00	3.69e-64	0.0	0.846
1. PBF	A0T0G5	Protein translocase subunit SecA	0.00e+00	1.24e-20	4.54e-133	0.7508
1. PBF	Q2W0C1	Protein translocase subunit SecA	0.00e+00	1.47e-26	0.0	0.8464
1. PBF	Q2SA01	Protein translocase subunit SecA	3.33e-16	1.15e-28	0.0	0.7776
1. PBF	Q36795	Protein translocase subunit SecA, chloroplastic	0.00e+00	3.55e-07	6.63e-149	0.7821
1. PBF	Q87SF7	Protein translocase subunit SecA	2.74e-13	2.51e-29	0.0	0.7692
1. PBF	Q8K9U3	Protein translocase subunit SecA	0.00e+00	5.79e-24	0.0	0.8743
1. PBF	Q67T83	Protein translocase subunit SecA	0.00e+00	2.79e-21	2.01e-159	0.7832
1. PBF	Q1QVH6	Protein translocase subunit SecA	1.34e-14	1.38e-28	0.0	0.7825
1. PBF	O67718	Protein translocase subunit SecA	6.03e-13	7.61e-22	6.28e-176	0.6673
1. PBF	A1KJN3	Protein translocase subunit SecA 2	2.22e-16	1.90e-03	1.19e-118	0.7091
1. PBF	A0T0V8	Protein translocase subunit SecA	0.00e+00	2.17e-19	6.27e-133	0.7612
1. PBF	Q815G7	Protein translocase subunit SecA	0.00e+00	2.85e-29	0.0	0.7936
1. PBF	A4Y2P4	Protein translocase subunit SecA	1.78e-15	6.62e-27	0.0	0.7651
1. PBF	P71533	Protein translocase subunit SecA 1	0.00e+00	5.49e-49	0.0	0.8421
1. PBF	Q8FTJ6	Protein translocase subunit SecA 2	0.00e+00	1.29e-12	1.48e-109	0.8344
1. PBF	Q24MT3	Protein translocase subunit SecA	5.55e-16	1.63e-22	0.0	0.8203
1. PBF	Q72R08	Protein translocase subunit SecA	0.00e+00	2.87e-35	7.37e-149	0.8051
1. PBF	A0LHJ3	Protein translocase subunit SecA	0.00e+00	8.34e-25	0.0	0.9004
1. PBF	Q6A833	Protein translocase subunit SecA	0.00e+00	1.26e-39	0.0	0.7942
1. PBF	Q5M2S3	Protein translocase subunit SecA	0.00e+00	2.19e-28	0.0	0.7948
1. PBF	B2UT44	Protein translocase subunit SecA	1.39e-11	4.83e-26	0.0	0.7895
1. PBF	B8IF29	Protein translocase subunit SecA	0.00e+00	2.58e-27	0.0	0.8304
1. PBF	Q1J543	Protein translocase subunit SecA	0.00e+00	3.69e-28	0.0	0.8012
1. PBF	Q6AJK1	Protein translocase subunit SecA	0.00e+00	3.73e-27	0.0	0.8721
1. PBF	Q99VM2	Protein translocase subunit SecA 1	1.45e-13	2.48e-27	0.0	0.7989
1. PBF	B3ECJ8	Protein translocase subunit SecA	1.11e-16	1.00e-08	1.08e-118	0.7082
1. PBF	Q1C223	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8338
1. PBF	B8GMN9	Protein translocase subunit SecA	0.00e+00	6.54e-23	0.0	0.7418
1. PBF	Q1RG97	Protein translocase subunit SecA	0.00e+00	3.23e-24	0.0	0.8452
1. PBF	B0V514	Protein translocase subunit SecA	0.00e+00	1.97e-33	0.0	0.8229
1. PBF	Q21MG1	Protein translocase subunit SecA	0.00e+00	3.52e-30	0.0	0.8201
1. PBF	B1H018	Protein translocase subunit SecA	0.00e+00	6.64e-21	0.0	0.8302
1. PBF	A6QF62	Protein translocase subunit SecA 1	8.65e-14	2.48e-27	0.0	0.8068
1. PBF	B0U4Y8	Protein translocase subunit SecA	0.00e+00	1.66e-30	0.0	0.8528
1. PBF	A1WYM9	Protein translocase subunit SecA	0.00e+00	3.42e-25	0.0	0.858
1. PBF	Q99Y96	Protein translocase subunit SecA	0.00e+00	1.13e-27	0.0	0.8023
1. PBF	B7N7X1	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.7814
1. PBF	Q4UKY1	Protein translocase subunit SecA	5.55e-16	7.84e-29	0.0	0.7837
1. PBF	A9MQB1	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.845
1. PBF	Q74KA5	Protein translocase subunit SecA 1	0.00e+00	1.02e-18	0.0	0.8635
1. PBF	Q63FC2	Protein translocase subunit SecA 2	0.00e+00	2.35e-15	0.0	0.885
1. PBF	A8Z5Z5	Protein translocase subunit SecA	1.27e-14	1.86e-10	2.81e-95	0.6632
1. PBF	Q03AP4	Protein translocase subunit SecA	4.11e-15	5.25e-19	0.0	0.8171
1. PBF	Q89ZL5	Protein translocase subunit SecA	4.13e-10	9.43e-11	2.32e-99	0.6731
1. PBF	Q7NQ59	Protein translocase subunit SecA	1.11e-16	2.14e-24	0.0	0.7623
1. PBF	A7NDG7	Protein translocase subunit SecA	0.00e+00	1.98e-27	0.0	0.8066
1. PBF	Q97F94	Protein translocase subunit SecA	0.00e+00	3.54e-28	0.0	0.8233
1. PBF	Q2LTP4	Protein translocase subunit SecA	0.00e+00	2.80e-26	0.0	0.892
1. PBF	A7H8E6	Protein translocase subunit SecA	0.00e+00	1.11e-27	0.0	0.7994
1. PBF	Q7N156	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8309
1. PBF	Q1GS43	Protein translocase subunit SecA	0.00e+00	2.73e-32	0.0	0.8226
1. PBF	B7HEI8	Protein translocase subunit SecA	0.00e+00	2.26e-29	0.0	0.7933
1. PBF	P49649	Protein translocase subunit SecA	0.00e+00	9.17e-22	2.46e-132	0.7646
1. PBF	Q8FYD8	Protein translocase subunit SecA	0.00e+00	2.10e-28	0.0	0.8166
1. PBF	Q04SJ8	Protein translocase subunit SecA	0.00e+00	4.55e-34	2.58e-151	0.8105
1. PBF	C1F4E1	Protein translocase subunit SecA	0.00e+00	5.65e-30	2.51e-148	0.7904
1. PBF	A9B6X4	Protein translocase subunit SecA	1.67e-15	2.66e-22	0.0	0.7154
1. PBF	B2SPL6	Protein translocase subunit SecA	0.00e+00	4.36e-28	0.0	0.835
1. PBF	P9WGP2	Protein translocase subunit SecA 2	0.00e+00	1.90e-03	1.19e-118	0.7304
1. PBF	A5U3I8	Protein translocase subunit SecA 2	2.44e-15	1.90e-03	1.19e-118	0.7099
1. PBF	Q6TUJ8	Protein translocase subunit SecA	4.44e-16	9.79e-28	0.0	0.7642
1. PBF	Q87WZ3	Protein translocase subunit SecA	0.00e+00	1.76e-26	0.0	0.8376
1. PBF	A9HAU9	Protein translocase subunit SecA	0.00e+00	3.45e-29	0.0	0.8472
1. PBF	A0ALJ4	Protein translocase subunit SecA 1	0.00e+00	5.08e-27	0.0	0.8172
1. PBF	B0TYK5	Protein translocase subunit SecA	0.00e+00	3.17e-27	0.0	0.8503
1. PBF	B6YQX8	Protein translocase subunit SecA	2.20e-12	1.27e-07	4.87e-98	0.6911
1. PBF	A8FHW5	Protein translocase subunit SecA	0.00e+00	4.86e-30	0.0	0.7859
1. PBF	A5IBV4	Protein translocase subunit SecA	0.00e+00	5.57e-24	0.0	0.7685
1. PBF	Q6GB77	Protein translocase subunit SecA 1	6.43e-14	2.48e-27	0.0	0.8016
1. PBF	Q4JTQ3	Protein translocase subunit SecA 1	2.44e-15	2.11e-26	0.0	0.7549
1. PBF	B7MAM1	Protein translocase subunit SecA	0.00e+00	3.23e-24	0.0	0.8409
1. PBF	Q3AFQ0	Protein translocase subunit SecA	0.00e+00	3.81e-20	0.0	0.851
1. PBF	C3PP10	Protein translocase subunit SecA	0.00e+00	1.61e-29	0.0	0.7767
1. PBF	B0JLJ4	Protein translocase subunit SecA	0.00e+00	7.41e-21	6.74e-145	0.7466
1. PBF	Q3SMG1	Protein translocase subunit SecA	1.59e-13	8.13e-28	0.0	0.7263
1. PBF	Q313L3	Protein translocase subunit SecA	0.00e+00	4.53e-31	0.0	0.8294
1. PBF	B0CIU9	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.8286
1. PBF	A0PRE5	Protein translocase subunit SecA 1	0.00e+00	5.55e-45	0.0	0.8439
1. PBF	Q01570	Protein translocase subunit SecA	0.00e+00	1.91e-16	1.14e-145	0.7863
1. PBF	Q21BY5	Protein translocase subunit SecA	0.00e+00	1.76e-24	2.65e-142	0.835
1. PBF	Q63QK6	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.8574
1. PBF	C0M683	Protein translocase subunit SecA	5.11e-15	2.57e-31	0.0	0.8149
1. PBF	Q81X26	Protein translocase subunit SecA 1	0.00e+00	1.47e-29	0.0	0.7938
1. PBF	B1YST3	Protein translocase subunit SecA	0.00e+00	1.59e-26	0.0	0.8447
1. PBF	Q0HE90	Protein translocase subunit SecA	4.62e-14	4.87e-27	0.0	0.761
1. PBF	A1RF04	Protein translocase subunit SecA	0.00e+00	6.62e-27	0.0	0.762
1. PBF	Q032Z6	Protein translocase subunit SecA	0.00e+00	8.48e-26	0.0	0.8404
1. PBF	A4FNI7	Protein translocase subunit SecA	1.78e-15	3.50e-44	0.0	0.7937
1. PBF	C5B9G5	Protein translocase subunit SecA	0.00e+00	9.56e-26	0.0	0.7712
1. PBF	Q7A6R5	Protein translocase subunit SecA 1	1.46e-13	2.48e-27	0.0	0.8077
1. PBF	A4IST9	Protein translocase subunit SecA 1	0.00e+00	9.59e-28	0.0	0.7854
1. PBF	Q82K39	Protein translocase subunit SecA 2	0.00e+00	4.26e-37	0.0	0.8013
1. PBF	B2K4F5	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.803
1. PBF	Q28VQ6	Protein translocase subunit SecA	0.00e+00	2.80e-26	0.0	0.8501
1. PBF	C0RFJ0	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.8709
1. PBF	Q5WW88	Protein translocase subunit SecA	1.50e-12	2.60e-24	0.0	0.7647
1. PBF	Q1IMP4	Protein translocase subunit SecA	0.00e+00	9.75e-26	2.54e-145	0.7894
1. PBF	B2IUA9	Protein translocase subunit SecA	0.00e+00	4.40e-20	4.86e-162	0.7695
1. PBF	Q4QM00	Protein translocase subunit SecA	0.00e+00	3.04e-26	0.0	0.8552
1. PBF	Q55709	Protein translocase subunit SecA	0.00e+00	1.46e-20	1.50e-155	0.7502
1. PBF	A1SGL9	Protein translocase subunit SecA	0.00e+00	7.46e-30	0.0	0.8048
1. PBF	A7Z999	Protein translocase subunit SecA	0.00e+00	2.79e-29	0.0	0.7832
1. PBF	Q0I375	Protein translocase subunit SecA	0.00e+00	2.46e-24	0.0	0.8124
1. PBF	O19911	Protein translocase subunit SecA	0.00e+00	4.08e-17	2.58e-151	0.8293
1. PBF	A1T5H7	Protein translocase subunit SecA 2	0.00e+00	5.98e-20	0.0	0.8485
1. PBF	Q4K7C1	Protein translocase subunit SecA	0.00e+00	1.30e-28	0.0	0.8481
1. PBF	A8F255	Protein translocase subunit SecA	0.00e+00	1.41e-26	0.0	0.79
1. PBF	Q0A6V9	Protein translocase subunit SecA	1.11e-16	2.82e-24	0.0	0.7661
1. PBF	Q6F260	Protein translocase subunit SecA	0.00e+00	1.79e-96	0.0	0.8616
1. PBF	B9DVI5	Protein translocase subunit SecA	0.00e+00	2.07e-29	0.0	0.8002
1. PBF	Q326D7	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.8533
1. PBF	B8H392	Protein translocase subunit SecA	0.00e+00	3.57e-26	1.42e-180	0.849
1. PBF	B1IE50	Protein translocase subunit SecA	0.00e+00	3.49e-24	0.0	0.8061
1. PBF	B0RE77	Protein translocase subunit SecA	2.78e-13	1.19e-47	0.0	0.7692
1. PBF	Q10VW7	Protein translocase subunit SecA	0.00e+00	1.24e-20	3.36e-159	0.7489
1. PBF	A1JJK2	Protein translocase subunit SecA	0.00e+00	7.33e-27	0.0	0.8401
1. PBF	Q3SVN4	Protein translocase subunit SecA	0.00e+00	2.98e-25	0.0	0.8394
1. PBF	Q9Z765	Protein translocase subunit SecA	0.00e+00	7.16e-14	2.91e-95	0.7416
1. PBF	B2SDE9	Protein translocase subunit SecA	7.23e-14	1.98e-27	0.0	0.731
1. PBF	A2BZ24	Protein translocase subunit SecA	0.00e+00	1.18e-19	1.41e-137	0.7547
1. PBF	B3PP95	Protein translocase subunit SecA	0.00e+00	6.66e-26	0.0	0.828
1. PBF	Q2S4E4	Protein translocase subunit SecA	4.84e-13	8.76e-14	3.87e-99	0.7042
1. PBF	Q07HT2	Protein translocase subunit SecA 2	0.00e+00	4.59e-10	8.39e-135	0.8359
1. PBF	Q6HB99	Protein translocase subunit SecA 1	0.00e+00	1.79e-29	0.0	0.8177
1. PBF	B0U8E7	Protein translocase subunit SecA	0.00e+00	1.86e-27	0.0	0.7809
1. PBF	Q5X5A1	Protein translocase subunit SecA	0.00e+00	4.68e-24	0.0	0.7284
1. PBF	Q3JNE8	Protein translocase subunit SecA	0.00e+00	1.12e-26	0.0	0.7562
1. PBF	Q5KV31	Protein translocase subunit SecA 2	0.00e+00	8.87e-20	0.0	0.8429
1. PBF	Q0T899	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	0.7844
1. PBF	Q256C7	Protein translocase subunit SecA	0.00e+00	8.38e-15	4.42e-89	0.7332
1. PBF	A6Q383	Protein translocase subunit SecA	0.00e+00	1.30e-31	0.0	0.8934
1. PBF	B1I6D8	Protein translocase subunit SecA	0.00e+00	1.22e-25	0.0	0.7997
1. PBF	A6VB75	Protein translocase subunit SecA	0.00e+00	4.53e-29	0.0	0.8314
1. PBF	Q0K6N3	Protein translocase subunit SecA	0.00e+00	4.64e-26	0.0	0.8403
1. PBF	Q30RR0	Protein translocase subunit SecA	0.00e+00	1.24e-25	0.0	0.8943
1. PBF	A4W3N7	Protein translocase subunit SecA	0.00e+00	6.49e-29	0.0	0.8085
1. PBF	B8F3L6	Protein translocase subunit SecA	0.00e+00	7.71e-25	0.0	0.8531
1. PBF	A8GVH8	Protein translocase subunit SecA	0.00e+00	5.87e-31	0.0	0.762
1. PBF	Q9ZL57	Protein translocase subunit SecA	2.22e-16	1.51e-25	0.0	0.8305
1. PBF	A4YKV0	Protein translocase subunit SecA	0.00e+00	1.58e-25	0.0	0.8342
1. PBF	Q2WCN1	Protein translocase subunit SecA 2	0.00e+00	1.67e-18	0.0	0.8103
1. PBF	Q13EF2	Protein translocase subunit SecA	0.00e+00	1.37e-25	2.85e-138	0.8121
1. PBF	Q8YJG2	Protein translocase subunit SecA	0.00e+00	4.55e-28	0.0	0.8323
1. PBF	A4TQ74	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8471
1. PBF	Q1GCG7	Protein translocase subunit SecA	0.00e+00	5.23e-26	0.0	0.8436
1. PBF	A8EUE3	Protein translocase subunit SecA	0.00e+00	2.75e-27	0.0	0.8742
1. PBF	C6BVR6	Protein translocase subunit SecA	0.00e+00	1.83e-26	0.0	0.779
1. PBF	B4E5Y3	Protein translocase subunit SecA	0.00e+00	7.80e-27	0.0	0.855
1. PBF	A9WEB6	Protein translocase subunit SecA	8.88e-16	2.11e-26	0.0	0.7683
1. PBF	Q4A6S2	Protein translocase subunit SecA	0.00e+00	6.77e-06	0.0	0.7713
1. PBF	Q2NB30	Protein translocase subunit SecA	1.11e-16	5.16e-31	0.0	0.8088
1. PBF	Q9K6W8	Protein translocase subunit SecA	7.93e-14	1.54e-28	0.0	0.8188
1. PBF	A5EY15	Protein translocase subunit SecA	0.00e+00	4.91e-23	0.0	0.8367
1. PBF	Q8D301	Protein translocase subunit SecA	0.00e+00	1.24e-16	0.0	0.8808
1. PBF	Q8CPZ2	Protein translocase subunit SecA 1	0.00e+00	7.19e-27	0.0	0.806
1. PBF	Q5FGQ3	Protein translocase subunit SecA	0.00e+00	3.62e-23	0.0	0.7581
1. PBF	Q1BCB9	Protein translocase subunit SecA 1	0.00e+00	1.68e-48	0.0	0.8364
1. PBF	Q6FEE0	Protein translocase subunit SecA	0.00e+00	1.93e-31	0.0	0.8262
1. PBF	Q8RCB4	Protein translocase subunit SecA	0.00e+00	3.15e-22	0.0	0.797
1. PBF	A9WMN9	Protein translocase subunit SecA	0.00e+00	8.01e-42	0.0	0.7995
1. PBF	Q03SQ0	Protein translocase subunit SecA	0.00e+00	5.16e-19	0.0	0.831
1. PBF	C3LQT9	Protein translocase subunit SecA	0.00e+00	2.38e-26	0.0	0.7717
1. PBF	A7HTW6	Protein translocase subunit SecA	0.00e+00	1.79e-26	0.0	0.8736
1. PBF	Q47RW8	Protein translocase subunit SecA 2	0.00e+00	8.79e-15	3.80e-111	0.7878
1. PBF	Q5HHR7	Protein translocase subunit SecA 1	0.00e+00	2.48e-27	0.0	0.8077
1. PBF	Q57AV4	Protein translocase subunit SecA	0.00e+00	6.75e-28	0.0	0.8258
1. PBF	Q8DYM7	Protein translocase subunit SecA 2	0.00e+00	1.54e-19	2.68e-170	0.8334
1. PBF	B5BLD0	Protein translocase subunit SecA	0.00e+00	3.77e-24	0.0	0.8442
1. PBF	B8HBL4	Protein translocase subunit SecA	0.00e+00	2.55e-42	0.0	0.8114
1. PBF	A3CLD3	Protein translocase subunit SecA 1	0.00e+00	5.04e-28	0.0	0.8084
1. PBF	Q8E9Q5	Protein translocase subunit SecA	2.44e-15	2.43e-27	0.0	0.7673
1. PBF	C1CSW3	Protein translocase subunit SecA	0.00e+00	1.68e-27	0.0	0.8143
1. PBF	B6JAC3	Protein translocase subunit SecA	0.00e+00	7.06e-22	0.0	0.8097
1. PBF	A5G0Q9	Protein translocase subunit SecA	0.00e+00	4.01e-30	0.0	0.8718
1. PBF	Q0VRZ3	Protein translocase subunit SecA	0.00e+00	2.33e-28	0.0	0.8621
1. PBF	Q3K063	Protein translocase subunit SecA 2	0.00e+00	5.08e-20	6.26e-171	0.8451
1. PBF	Q5HCP8	Protein translocase subunit SecA 2	0.00e+00	8.11e-20	4.04e-155	0.8655
1. PBF	P47847	Protein translocase subunit SecA 1	0.00e+00	2.14e-27	0.0	0.8186
1. PBF	B0BAF6	Protein translocase subunit SecA	0.00e+00	6.28e-16	6.72e-102	0.7408
1. PBF	Q5SIW3	Protein translocase subunit SecA	0.00e+00	5.68e-24	1.30e-127	0.7303
1. PBF	Q81UI7	Protein translocase subunit SecA 2	0.00e+00	1.13e-15	0.0	0.8873
1. PBF	A9M8T1	Protein translocase subunit SecA	0.00e+00	4.94e-28	0.0	0.833
1. PBF	Q2GEH0	Protein translocase subunit SecA	0.00e+00	1.08e-15	0.0	0.8543
1. PBF	B3QBB7	Protein translocase subunit SecA	0.00e+00	9.59e-24	0.0	0.832
1. PBF	A3PFC8	Protein translocase subunit SecA	0.00e+00	5.94e-21	1.15e-136	0.7611
1. PBF	C4XJ72	Protein translocase subunit SecA	0.00e+00	7.04e-27	0.0	0.8843
1. PBF	Q1QQX2	Protein translocase subunit SecA 1	0.00e+00	1.19e-24	0.0	0.8347
1. PBF	Q2GIT5	Protein translocase subunit SecA	0.00e+00	1.15e-21	0.0	0.828
1. PBF	Q4AAP5	Protein translocase subunit SecA	5.55e-16	1.39e-63	0.0	0.7628
1. PBF	A1U3E9	Protein translocase subunit SecA	0.00e+00	7.62e-30	0.0	0.8146
1. PBF	P57996	Protein translocase subunit SecA 1	0.00e+00	6.19e-46	0.0	0.8309
1. PBF	Q9PLM5	Protein translocase subunit SecA	0.00e+00	3.70e-15	2.82e-103	0.7318
1. PBF	Q4G377	Protein translocase subunit SecA	0.00e+00	4.82e-20	1.28e-133	0.8321
1. PBF	A9MZM7	Protein translocase subunit SecA	0.00e+00	2.46e-24	0.0	0.8155
1. PBF	B0C1V9	Protein translocase subunit SecA	0.00e+00	6.90e-24	1.01e-154	0.7666
1. PBF	Q7A366	Protein translocase subunit SecA 2	0.00e+00	6.20e-20	5.27e-155	0.8337
1. PBF	Q8FL61	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.7997
1. PBF	A3CZM9	Protein translocase subunit SecA	8.82e-13	1.98e-27	0.0	0.7664
1. PBF	B7K110	Protein translocase subunit SecA	0.00e+00	3.30e-20	5.40e-152	0.7604
1. PBF	B4RKY2	Protein translocase subunit SecA	0.00e+00	2.15e-30	0.0	0.8317
1. PBF	Q5XAA2	Protein translocase subunit SecA	0.00e+00	6.34e-28	0.0	0.8043
1. PBF	Q042C9	Protein translocase subunit SecA	0.00e+00	2.06e-18	0.0	0.9202
1. PBF	B1VUY4	Protein translocase subunit SecA	0.00e+00	4.00e-41	0.0	0.7944
1. PBF	Q5LY68	Protein translocase subunit SecA	0.00e+00	3.77e-28	0.0	0.7786
1. PBF	O83394	Protein translocase subunit SecA	0.00e+00	6.08e-25	0.0	0.7808
1. PBF	Q3KKZ3	Protein translocase subunit SecA	0.00e+00	6.81e-16	5.77e-102	0.7391
1. PBF	B5Y1T9	Protein translocase subunit SecA	0.00e+00	1.76e-24	0.0	0.8443
1. PBF	Q32743	Protein translocase subunit SecA	0.00e+00	5.52e-21	2.57e-128	0.7398
1. PBF	C5BP26	Protein translocase subunit SecA	0.00e+00	1.02e-26	0.0	0.8718
1. PBF	C0Q5J4	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.7757
1. PBF	B5R2N2	Protein translocase subunit SecA	0.00e+00	1.19e-24	0.0	0.8472
1. PBF	Q0TNE0	Protein translocase subunit SecA	0.00e+00	1.78e-27	0.0	0.8069
1. PBF	Q03IX4	Protein translocase subunit SecA	0.00e+00	2.64e-28	0.0	0.7964
1. PBF	B9KPP0	Protein translocase subunit SecA	0.00e+00	9.37e-27	0.0	0.8421
1. PBF	Q0BIJ2	Protein translocase subunit SecA	0.00e+00	9.76e-27	0.0	0.8263
1. PBF	A6T2E8	Protein translocase subunit SecA	0.00e+00	1.13e-27	0.0	0.8358
1. PBF	A8YUC4	Protein translocase subunit SecA	0.00e+00	5.44e-19	0.0	0.8098
1. PBF	O84707	Protein translocase subunit SecA	0.00e+00	6.18e-16	5.89e-102	0.7381
1. PBF	Q2NVU3	Protein translocase subunit SecA	0.00e+00	5.98e-27	0.0	0.8291
1. PBF	Q1XDA6	Protein translocase subunit SecA	0.00e+00	1.14e-19	3.47e-155	0.8336
1. PBF	C1FQR0	Protein translocase subunit SecA	0.00e+00	2.46e-24	0.0	0.8013
1. PBF	A1KNP2	Protein translocase subunit SecA 1	0.00e+00	3.54e-41	0.0	0.8223
1. PBF	P0DJP3	Protein translocase subunit SecA 2	9.99e-16	5.54e-19	0.0	0.8045
1. PBF	Q13U01	Protein translocase subunit SecA	0.00e+00	1.02e-27	0.0	0.8556
1. PBF	Q1B827	Protein translocase subunit SecA 2	0.00e+00	2.98e-07	1.71e-121	0.7759
1. PBF	A1T9W4	Protein translocase subunit SecA 3	6.49e-14	3.00e-08	9.13e-116	0.7306
1. PBF	Q6G0Q8	Protein translocase subunit SecA	0.00e+00	6.36e-27	0.0	0.8303
1. PBF	Q3ZZG5	Protein translocase subunit SecA	0.00e+00	3.50e-13	0.0	0.7809
1. PBF	A4XQT3	Protein translocase subunit SecA	0.00e+00	4.45e-28	0.0	0.8225
1. PBF	Q8PCJ2	Protein translocase subunit SecA	0.00e+00	9.02e-28	0.0	0.8255
1. PBF	B5FI79	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.846
1. PBF	B9K8Q4	Protein translocase subunit SecA	2.22e-16	3.16e-23	0.0	0.7116
1. PBF	A8MJN5	Protein translocase subunit SecA	0.00e+00	6.06e-23	0.0	0.7582
1. PBF	B9MDY4	Protein translocase subunit SecA	1.25e-13	1.08e-25	0.0	0.7621
1. PBF	A0LYR8	Protein translocase subunit SecA	1.93e-14	5.66e-20	4.13e-99	0.6815
1. PBF	Q97PD6	Protein translocase subunit SecA 1	0.00e+00	8.65e-28	0.0	0.9131
1. PBF	Q7CSN9	Protein translocase subunit SecA	0.00e+00	2.46e-24	0.0	0.8259
1. PBF	Q1QHC7	Protein translocase subunit SecA 2	0.00e+00	2.47e-14	1.91e-139	0.8794
1. PBF	A6L997	Protein translocase subunit SecA	7.33e-12	5.45e-13	1.07e-96	0.7007
1. PBF	A8G7E5	Protein translocase subunit SecA	0.00e+00	1.03e-20	5.30e-137	0.7573
1. PBF	C0MEB9	Protein translocase subunit SecA	0.00e+00	3.64e-31	0.0	0.8014
1. PBF	A0K496	Protein translocase subunit SecA	1.11e-15	8.12e-27	0.0	0.7589
1. PBF	Q8G4G5	Protein translocase subunit SecA	0.00e+00	1.05e-32	0.0	0.8578
1. PBF	B7LWG4	Protein translocase subunit SecA	0.00e+00	9.96e-25	0.0	0.8435
1. PBF	A1TTE9	Protein translocase subunit SecA	2.22e-16	1.83e-26	0.0	0.7576
1. PBF	A1VK79	Protein translocase subunit SecA	0.00e+00	2.26e-25	0.0	0.8564
1. PBF	Q83N29	Protein translocase subunit SecA	0.00e+00	1.58e-17	0.0	0.7942
1. PBF	Q2JEZ1	Protein translocase subunit SecA	0.00e+00	3.64e-32	0.0	0.7954
1. PBF	Q8KD18	Protein translocase subunit SecA	2.11e-15	2.64e-08	6.96e-118	0.7183
1. PBF	Q2RXV5	Protein translocase subunit SecA	0.00e+00	9.75e-26	0.0	0.8686
1. PBF	Q8XVJ6	Protein translocase subunit SecA	8.51e-13	6.42e-30	0.0	0.7572
1. PBF	Q5LGL5	Protein translocase subunit SecA	1.63e-08	2.49e-10	1.08e-98	0.6911
1. PBF	Q0HZQ8	Protein translocase subunit SecA	2.44e-15	7.80e-27	0.0	0.7627
1. PBF	C0QI23	Protein translocase subunit SecA	0.00e+00	1.29e-25	0.0	0.9114
1. PBF	B2TK15	Protein translocase subunit SecA	0.00e+00	1.69e-22	0.0	0.9092
1. PBF	Q7NC50	Protein translocase subunit SecA	0.00e+00	3.35e-55	0.0	0.8379
1. PBF	Q4L4H8	Protein translocase subunit SecA 1	0.00e+00	7.96e-28	0.0	0.8105
1. PBF	B0BYC1	Protein translocase subunit SecA	0.00e+00	1.12e-28	0.0	0.7884
1. PBF	Q9RWU0	Protein translocase subunit SecA	0.00e+00	3.07e-18	2.81e-134	0.7986
1. PBF	Q3ARU5	Protein translocase subunit SecA 1	7.66e-15	1.21e-11	1.07e-114	0.7136
1. PBF	Q8DSF0	Protein translocase subunit SecA	0.00e+00	4.55e-28	0.0	0.7848
1. PBF	Q18CN0	Protein translocase subunit SecA 1	0.00e+00	1.03e-21	1.25e-167	0.796
1. PBF	Q1GB45	Protein translocase subunit SecA	0.00e+00	7.21e-19	0.0	0.8099
1. PBF	A7H409	Protein translocase subunit SecA	0.00e+00	1.30e-28	0.0	0.9045
1. PBF	A1W465	Protein translocase subunit SecA	0.00e+00	2.17e-25	0.0	0.7568
1. PBF	P0A5Y9	Protein translocase subunit SecA 1	0.00e+00	3.54e-41	0.0	0.8366
1. PBF	Q7VJC6	Protein translocase subunit SecA	0.00e+00	6.90e-27	0.0	0.8766
1. PBF	P52966	Protein translocase subunit SecA	0.00e+00	6.89e-28	0.0	0.8374
1. PBF	Q2JJ09	Protein translocase subunit SecA	0.00e+00	1.15e-26	8.98e-161	0.7399
1. PBF	A0JYG5	Protein translocase subunit SecA	0.00e+00	1.89e-42	0.0	0.809
1. PBF	Q83NT4	Protein translocase subunit SecA	0.00e+00	1.58e-17	0.0	0.8128
1. PBF	B0VRG7	Protein translocase subunit SecA	0.00e+00	2.76e-34	0.0	0.8552
1. PBF	A4ISX2	Protein translocase subunit SecA 2	0.00e+00	1.31e-17	0.0	0.9174
1. PBF	B8G7L6	Protein translocase subunit SecA	1.38e-13	7.19e-27	0.0	0.756
1. PBF	B7LFW8	Protein translocase subunit SecA	0.00e+00	6.20e-25	0.0	0.8409
1. PBF	Q65VS6	Protein translocase subunit SecA	0.00e+00	4.47e-23	0.0	0.8469
1. PBF	Q7UA15	Protein translocase subunit SecA	0.00e+00	4.73e-19	8.74e-145	0.7612
1. PBF	P75559	Protein translocase subunit SecA	0.00e+00	1.44e-23	0.0	0.9254
1. PBF	O32922	Protein translocase subunit SecA 2	0.00e+00	1.16e-08	1.42e-111	0.7692
1. PBF	Q2JW99	Protein translocase subunit SecA	0.00e+00	1.25e-26	3.32e-162	0.7572
1. PBF	A5CD15	Protein translocase subunit SecA	0.00e+00	6.54e-23	0.0	0.8458
1. PBF	Q1IZH7	Protein translocase subunit SecA	0.00e+00	1.94e-16	1.37e-132	0.7701
1. PBF	A4SEF9	Protein translocase subunit SecA	1.55e-15	4.08e-13	6.75e-119	0.7112
1. PBF	Q03ZQ8	Protein translocase subunit SecA	0.00e+00	2.76e-17	0.0	0.8959
1. PBF	Q04ED0	Protein translocase subunit SecA	0.00e+00	3.95e-20	0.0	0.909
1. PBF	B7VJ09	Protein translocase subunit SecA	7.31e-13	1.86e-29	0.0	0.7193
1. PBF	B2JHF1	Protein translocase subunit SecA	0.00e+00	5.56e-26	0.0	0.8522
1. PBF	A4QC94	Protein translocase subunit SecA 1	0.00e+00	4.81e-19	0.0	0.7824
1. PBF	A6QAC7	Protein translocase subunit SecA	0.00e+00	8.83e-28	0.0	0.882
1. PBF	Q4L9N5	Protein translocase subunit SecA 2	0.00e+00	2.74e-21	5.98e-154	0.8383
1. PBF	A5ETE1	Protein translocase subunit SecA	0.00e+00	4.52e-25	0.0	0.8373
1. PBF	A4W6K1	Protein translocase subunit SecA	0.00e+00	2.70e-25	0.0	0.8444
1. PBF	B1X0K6	Protein translocase subunit SecA	0.00e+00	1.41e-21	9.62e-151	0.7529
1. PBF	Q92H92	Protein translocase subunit SecA	9.44e-15	1.82e-29	0.0	0.7723
1. PBF	A0PSH1	Protein translocase subunit SecA 2	0.00e+00	9.83e-03	1.90e-105	0.7833
1. PBF	B8HSJ5	Protein translocase subunit SecA	0.00e+00	1.97e-22	4.86e-159	0.7634
1. PBF	Q0S2Y0	Protein translocase subunit SecA	0.00e+00	5.08e-36	0.0	0.8356
1. PBF	Q0BL01	Protein translocase subunit SecA	0.00e+00	1.64e-27	0.0	0.8652
1. PBF	A8EYB0	Protein translocase subunit SecA	0.00e+00	4.73e-31	0.0	0.7517
1. PBF	Q1AVJ6	Protein translocase subunit SecA	3.93e-14	4.05e-27	0.0	0.7188
1. PBF	Q2GF50	Protein translocase subunit SecA	0.00e+00	1.10e-17	0.0	0.7593
1. PBF	Q72DV4	Protein translocase subunit SecA	0.00e+00	2.23e-24	0.0	0.8347
1. PBF	Q39JW1	Protein translocase subunit SecA	0.00e+00	9.37e-27	0.0	0.8496
1. PBF	B3CSS2	Protein translocase subunit SecA	0.00e+00	2.93e-23	0.0	0.8536
1. PBF	P66786	Protein translocase subunit SecA 2	3.33e-16	1.90e-03	1.19e-118	0.7237
1. PBF	Q11DY9	Protein translocase subunit SecA	0.00e+00	4.22e-27	0.0	0.8494
1. PBF	A4IZ46	Protein translocase subunit SecA	0.00e+00	3.30e-27	0.0	0.873
1. PBF	Q2G6U3	Protein translocase subunit SecA	0.00e+00	1.17e-29	0.0	0.8309
1. PBF	Q57TC2	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8444
1. PBF	Q55357	Protein translocase subunit SecA	0.00e+00	2.51e-22	4.34e-148	0.7533
1. PBF	Q5F807	Protein translocase subunit SecA	0.00e+00	1.93e-30	0.0	0.836
1. PBF	Q4JVU1	Protein translocase subunit SecA 2	2.21e-14	5.41e-11	2.41e-104	0.7143
1. PBF	Q898W1	Protein translocase subunit SecA	0.00e+00	4.03e-26	0.0	0.8051
1. PBF	A0LVS1	Protein translocase subunit SecA	0.00e+00	6.70e-30	0.0	0.7686
1. PBF	Q8DEL8	Protein translocase subunit SecA	9.66e-15	4.01e-28	0.0	0.7172
1. PBF	Q64XF8	Protein translocase subunit SecA	5.21e-09	2.05e-10	1.07e-98	0.6909
1. PBF	C3MHS0	Protein translocase subunit SecA	0.00e+00	1.29e-25	0.0	0.8236
1. PBF	B0SNG1	Protein translocase subunit SecA	0.00e+00	4.01e-30	5.74e-174	0.8082
1. PBF	B4S7J9	Protein translocase subunit SecA	1.11e-16	7.89e-09	2.73e-120	0.7181
1. PBF	B7I8J5	Protein translocase subunit SecA	0.00e+00	1.97e-33	0.0	0.7953
1. PBF	Q5R0N7	Protein translocase subunit SecA	6.33e-15	8.63e-27	0.0	0.7665
1. PBF	Q0AMD3	Protein translocase subunit SecA	0.00e+00	3.44e-27	0.0	0.8171
1. PBF	Q8F4S9	Protein translocase subunit SecA	0.00e+00	4.45e-35	7.86e-149	0.8035
1. PBF	Q73HK8	Protein translocase subunit SecA	0.00e+00	1.17e-20	0.0	0.8479
1. PBF	Q2FIN8	Protein translocase subunit SecA 1	0.00e+00	2.48e-27	0.0	0.8036
1. PBF	Q1GZ36	Protein translocase subunit SecA	3.57e-13	2.75e-26	0.0	0.7612
1. PBF	Q16D42	Protein translocase subunit SecA	0.00e+00	3.37e-27	0.0	0.8387
1. PBF	Q050M4	Protein translocase subunit SecA	0.00e+00	4.25e-34	3.25e-151	0.8499
1. PBF	A1UGY0	Protein translocase subunit SecA 2	0.00e+00	2.98e-07	1.71e-121	0.766
1. PBF	Q0BXE2	Protein translocase subunit SecA	0.00e+00	2.70e-28	0.0	0.8312
1. PBF	A5U7R4	Protein translocase subunit SecA 1	0.00e+00	3.54e-41	0.0	0.8214
1. PBF	A7WZP8	Protein translocase subunit SecA 1	0.00e+00	2.48e-27	0.0	0.8006
1. PBF	A1VFF6	Protein translocase subunit SecA	0.00e+00	2.27e-24	0.0	0.8641
1. PBF	A9BD85	Protein translocase subunit SecA	0.00e+00	8.72e-20	1.02e-144	0.7544
1. PBF	A3M8M4	Protein translocase subunit SecA	0.00e+00	1.97e-33	0.0	0.8446
1. PBF	A5GQ30	Protein translocase subunit SecA	0.00e+00	2.75e-20	2.88e-151	0.7566
1. PBF	Q72XS9	Protein translocase subunit SecA	0.00e+00	3.10e-29	0.0	0.7957
1. PBF	Q83F06	Protein translocase subunit SecA	0.00e+00	2.55e-30	0.0	0.8556
1. PBF	Q66EJ6	Protein translocase subunit SecA	0.00e+00	1.62e-26	0.0	0.8502
1. PBF	Q0AH18	Protein translocase subunit SecA	0.00e+00	2.28e-27	0.0	0.8637
1. PBF	B1XL02	Protein translocase subunit SecA	0.00e+00	1.03e-21	3.70e-152	0.7582
1. PBF	A8G9T6	Protein translocase subunit SecA	0.00e+00	1.59e-26	0.0	0.7976
1. PBF	C3KYK9	Protein translocase subunit SecA	0.00e+00	3.77e-24	0.0	0.8066
1. PBF	B7J185	Protein translocase subunit SecA	0.00e+00	2.03e-23	0.0	0.808
1. PBF	B8CYM4	Protein translocase subunit SecA	0.00e+00	2.92e-27	0.0	0.8661
1. PBF	Q6GDF3	Protein translocase subunit SecA 2	0.00e+00	9.53e-20	3.82e-154	0.8625
1. PBF	A4RW83	Protein translocase subunit SecA, chloroplastic	0.00e+00	2.06e-24	9.57e-151	0.7732
1. PBF	B7IPV1	Protein translocase subunit SecA	0.00e+00	1.22e-29	0.0	0.8188
1. PBF	Q8X996	Protein translocase subunit SecA	0.00e+00	2.06e-24	0.0	0.8488
1. PBF	Q92MI9	Protein translocase subunit SecA	0.00e+00	2.08e-25	0.0	0.8234
1. PBF	A4XJ42	Protein translocase subunit SecA	0.00e+00	1.38e-23	0.0	0.874
1. PBF	A9BP81	Protein translocase subunit SecA	7.77e-16	2.43e-27	0.0	0.7787
1. PBF	B7UZI1	Protein translocase subunit SecA	0.00e+00	4.73e-29	0.0	0.8162
1. PBF	A9AI87	Protein translocase subunit SecA	0.00e+00	4.40e-27	0.0	0.8474
1. PBF	B0TGY6	Protein translocase subunit SecA	0.00e+00	2.79e-29	0.0	0.8734
1. PBF	Q7UDY6	Protein translocase subunit SecA 1	2.46e-12	3.25e-16	2.55e-171	0.658
1. PBF	P0A4G6	Protein translocase subunit SecA	0.00e+00	3.46e-38	0.0	0.7899
1. PBF	Q07WJ3	Protein translocase subunit SecA	2.66e-15	1.41e-26	0.0	0.7645
1. PBF	B0S3K9	Protein translocase subunit SecA	2.22e-16	1.13e-20	0.0	0.7133
1. PBF	Q927Y3	Protein translocase subunit SecA 1	0.00e+00	1.10e-26	0.0	0.8166
1. PBF	Q8DY07	Protein translocase subunit SecA 1	0.00e+00	3.37e-29	0.0	0.7763
1. PBF	Q47AB4	Protein translocase subunit SecA	2.14e-12	1.15e-26	0.0	0.7579
1. PBF	Q8RI93	Protein translocase subunit SecA	0.00e+00	2.03e-17	0.0	0.8041
1. PBF	A8FQA8	Protein translocase subunit SecA	1.11e-16	2.10e-27	0.0	0.7852
1. PBF	B5F7X1	Protein translocase subunit SecA	0.00e+00	2.50e-24	0.0	0.8437
1. PBF	A5VIG0	Protein translocase subunit SecA	0.00e+00	1.01e-18	0.0	0.949
1. PBF	A4QIG3	Protein translocase subunit SecA 2	0.00e+00	1.25e-12	1.17e-106	0.8242
1. PBF	A3NZK5	Protein translocase subunit SecA	0.00e+00	1.56e-26	0.0	0.8563
1. PBF	A7HMM7	Protein translocase subunit SecA	2.03e-14	4.95e-22	0.0	0.7526
1. PBF	Q1WSW8	Protein translocase subunit SecA	0.00e+00	1.26e-18	0.0	0.9393
1. PBF	A9GI17	Protein translocase subunit SecA	2.11e-15	6.08e-41	0.0	0.7054
1. PBF	Q4ZNZ8	Protein translocase subunit SecA	0.00e+00	4.68e-27	0.0	0.8471
2. PF	Q75C76	ATP-dependent RNA helicase DBP4	5.97e-03	1.33e-02	NA	0.3681
2. PF	A6ZPU3	ATP-dependent RNA helicase DBP4	2.64e-03	1.31e-02	NA	0.3411
2. PF	A3GGE9	ATP-dependent RNA helicase DBP4	6.59e-04	2.54e-02	NA	0.3639
2. PF	B7V6T4	RNA polymerase-associated protein RapA	1.03e-03	2.66e-02	NA	0.2392
2. PF	A5E3K3	ATP-dependent RNA helicase DBP4	7.40e-04	1.13e-02	NA	0.3718
2. PF	A7TJ71	ATP-dependent RNA helicase DBP4	5.42e-03	5.29e-03	NA	0.3363
2. PF	Q9HYT6	RNA polymerase-associated protein RapA	3.65e-02	2.49e-02	NA	0.235
3. BF	Q3AQA7	Protein translocase subunit SecA 2	0.00e+00	NA	1.64e-101	0.8176
3. BF	A0L9N3	Protein translocase subunit SecA 3	0.00e+00	NA	3.46e-94	0.8103
3. BF	A0L9Q5	Protein translocase subunit SecA 2	1.45e-13	NA	2.52e-101	0.7929
3. BF	Q2YAJ4	Protein translocase subunit SecA 2	0.00e+00	NA	1.58e-114	0.8423
3. BF	Q7UWI5	Protein translocase subunit SecA 2	1.33e-15	NA	1.23e-125	0.7823
3. BF	Q5LPY3	Protein translocase subunit SecA 2	4.53e-13	NA	1.96e-83	0.7867
3. BF	Q8EVL6	Protein translocase subunit SecA	0.00e+00	NA	0.0	0.9476
3. BF	Q2L0B4	Protein translocase subunit SecA 2	0.00e+00	NA	3.13e-104	0.8417
4. PB	Q2FUW6	Protein translocase subunit SecA 2	0.00e+00	8.11e-20	4.04e-155	NA
4. PB	P9WGP3	Protein translocase subunit SecA 2	1.44e-15	1.90e-03	1.19e-118	NA
4. PB	P9WGP5	Protein translocase subunit SecA 1	0.00e+00	3.54e-41	0.0	NA
4. PB	P10408	Protein translocase subunit SecA	0.00e+00	8.02e-25	0.0	NA
4. PB	Q6YQA1	Protein translocase subunit SecA	NA	2.80e-31	0.0	NA
4. PB	O06446	Protein translocase subunit SecA 1	0.00e+00	2.48e-27	0.0	NA
4. PB	D8WUA4	Protein translocase subunit SECA2, chloroplastic	0.00e+00	8.42e-10	1.35e-126	NA
4. PB	Q9SYI0	Protein translocase subunit SECA1, chloroplastic	0.00e+00	1.82e-06	2.46e-150	NA
5. P	B0URM0	RNA polymerase-associated protein RapA	7.03e-02	1.69e-03	NA	NA
5. P	Q9VHU1	Probable ATP-dependent RNA helicase DDX55 homolog	1.39e-03	3.62e-03	NA	NA
5. P	A3QA31	RNA polymerase-associated protein RapA	5.48e-04	4.21e-03	NA	NA
5. P	Q0I5G1	RNA polymerase-associated protein RapA	9.87e-03	2.30e-03	NA	NA
5. P	A4YAN1	RNA polymerase-associated protein RapA	5.87e-04	5.56e-03	NA	NA
5. P	A4TQB3	RNA polymerase-associated protein RapA	9.40e-03	1.41e-02	NA	NA
5. P	C4ZPY3	RNA polymerase-associated protein RapA	1.43e-03	2.16e-03	NA	NA
5. P	B7MAI2	RNA polymerase-associated protein RapA	9.54e-04	2.16e-03	NA	NA
5. P	B5FGE9	RNA polymerase-associated protein RapA	9.10e-04	1.14e-02	NA	NA
5. P	P33906	ATP-dependent RNA helicase DeaD	6.42e-03	4.61e-04	NA	NA
5. P	B6EPV7	RNA polymerase-associated protein RapA	7.37e-04	3.85e-03	NA	NA
5. P	A4W6G3	RNA polymerase-associated protein RapA	2.69e-03	2.08e-02	NA	NA
5. P	Q87LD0	RNA polymerase-associated protein RapA	7.28e-04	6.91e-03	NA	NA
5. P	B7VIC2	RNA polymerase-associated protein RapA	2.61e-03	3.70e-03	NA	NA
5. P	P0A9P6	ATP-dependent RNA helicase DeaD	7.89e-03	3.77e-04	NA	NA
5. P	A3D001	RNA polymerase-associated protein RapA	5.56e-04	6.51e-03	NA	NA
5. P	Q4QMI0	RNA polymerase-associated protein RapA	1.41e-02	1.61e-04	NA	NA
5. P	Q6H1L8	Regulator of telomere elongation helicase 1	1.96e-01	1.02e-02	NA	NA
5. P	A8G9P6	RNA polymerase-associated protein RapA	8.19e-03	1.23e-02	NA	NA
5. P	Q1RGE0	RNA polymerase-associated protein RapA	8.86e-03	2.16e-03	NA	NA
5. P	Q32K36	RNA polymerase-associated protein RapA	5.94e-03	9.81e-04	NA	NA
5. P	C6DEY0	RNA polymerase-associated protein RapA	5.85e-03	1.97e-02	NA	NA
5. P	B2U265	RNA polymerase-associated protein RapA	6.06e-03	1.98e-03	NA	NA
5. P	Q0HR19	RNA polymerase-associated protein RapA	3.52e-03	1.19e-02	NA	NA
5. P	Q57TG4	RNA polymerase-associated protein RapA	1.49e-03	3.55e-03	NA	NA
5. P	A7TJS7	ATP-dependent rRNA helicase SPB4	1.54e-03	1.51e-03	NA	NA
5. P	A1JJG0	RNA polymerase-associated protein RapA	2.60e-02	2.54e-02	NA	NA
5. P	Q07XC8	RNA polymerase-associated protein RapA	8.29e-03	3.96e-03	NA	NA
5. P	B8CIB4	RNA polymerase-associated protein RapA	6.56e-04	7.12e-03	NA	NA
5. P	A3MZ32	RNA polymerase-associated protein RapA	8.00e-03	1.47e-03	NA	NA
5. P	B2K4B3	RNA polymerase-associated protein RapA	6.97e-03	1.79e-02	NA	NA
5. P	Q2NVX0	RNA polymerase-associated protein RapA	9.14e-03	1.75e-02	NA	NA
5. P	Q6CN92	ATP-dependent rRNA helicase SPB4	1.08e-03	1.88e-03	NA	NA
5. P	P57453	ATP-dependent RNA helicase DeaD	4.30e-03	1.27e-03	NA	NA
5. P	A0KGL5	RNA polymerase-associated protein RapA	7.65e-03	1.01e-02	NA	NA
5. P	B4SU17	RNA polymerase-associated protein RapA	6.84e-03	2.57e-03	NA	NA
5. P	Q326H6	RNA polymerase-associated protein RapA	1.83e-03	1.96e-03	NA	NA
5. P	Q48LP5	RNA polymerase-associated protein RapA	6.21e-03	3.43e-02	NA	NA
5. P	Q59N29	ATP-dependent rRNA helicase SPB4	2.13e-03	3.01e-02	NA	NA
5. P	B2VGQ6	RNA polymerase-associated protein RapA	3.59e-03	2.00e-02	NA	NA
5. P	A7MSB2	RNA polymerase-associated protein RapA	8.81e-04	4.38e-03	NA	NA
5. P	Q1C1Y2	RNA polymerase-associated protein RapA	8.94e-03	1.41e-02	NA	NA
5. P	Q6FKS8	ATP-dependent rRNA helicase SPB4	1.31e-03	9.31e-04	NA	NA
5. P	B8ECC6	RNA polymerase-associated protein RapA	5.58e-04	4.89e-03	NA	NA
5. P	Q0T8D8	RNA polymerase-associated protein RapA	5.68e-04	2.21e-03	NA	NA
5. P	B3H0F9	RNA polymerase-associated protein RapA	1.59e-02	1.12e-03	NA	NA
5. P	A9MYN1	RNA polymerase-associated protein RapA	5.96e-03	2.52e-03	NA	NA
5. P	P0CR09	ATP-dependent rRNA helicase SPB4	5.64e-03	9.71e-04	NA	NA
5. P	A7FM96	RNA polymerase-associated protein RapA	1.03e-02	1.79e-02	NA	NA
5. P	Q7UDT5	RNA polymerase-associated protein RapA	2.15e-03	2.21e-03	NA	NA
5. P	A7MIC1	RNA polymerase-associated protein RapA	6.06e-03	5.09e-03	NA	NA
5. P	Q5UQW0	Putative ATP-dependent RNA helicase L377	NA	1.17e-03	NA	NA
5. P	P0A9P8	ATP-dependent RNA helicase DeaD	5.26e-03	3.77e-04	NA	NA
5. P	A9R154	RNA polymerase-associated protein RapA	8.44e-03	1.41e-02	NA	NA
5. P	Q7N8V1	RNA polymerase-associated protein RapA	1.41e-02	7.40e-03	NA	NA
5. P	A8FQW4	RNA polymerase-associated protein RapA	1.27e-03	6.26e-03	NA	NA
5. P	B7N7T3	RNA polymerase-associated protein RapA	6.26e-03	2.16e-03	NA	NA
5. P	A1RFP5	RNA polymerase-associated protein RapA	5.40e-04	5.40e-03	NA	NA
5. P	B1LFZ3	RNA polymerase-associated protein RapA	5.91e-03	1.71e-03	NA	NA
5. P	A6WSX5	RNA polymerase-associated protein RapA	6.09e-04	5.19e-03	NA	NA
5. P	Q4P7M1	ATP-dependent RNA helicase DBP9	1.92e-01	4.29e-02	NA	NA
5. P	Q8K9H6	ATP-dependent RNA helicase DeaD	4.59e-03	6.08e-03	NA	NA
5. P	A4K436	Regulator of telomere elongation helicase 1	6.15e-02	1.41e-04	NA	NA
5. P	P60241	RNA polymerase-associated protein RapA	8.93e-03	2.16e-03	NA	NA
5. P	B5BL33	RNA polymerase-associated protein RapA	6.78e-03	2.32e-03	NA	NA
5. P	Q12RU8	RNA polymerase-associated protein RapA	8.38e-04	5.40e-03	NA	NA
5. P	B6HZ39	RNA polymerase-associated protein RapA	8.32e-03	2.16e-03	NA	NA
5. P	Q0TLT1	RNA polymerase-associated protein RapA	1.88e-03	1.71e-03	NA	NA
5. P	A1A7A6	RNA polymerase-associated protein RapA	2.12e-03	2.37e-03	NA	NA
5. P	A8ALP3	RNA polymerase-associated protein RapA	8.54e-04	3.85e-03	NA	NA
5. P	C0Q5F4	RNA polymerase-associated protein RapA	7.91e-03	1.59e-03	NA	NA
5. P	Q6FPQ3	ATP-dependent DNA helicase MPH1	3.47e-02	5.96e-03	NA	NA
5. P	A7ZW09	RNA polymerase-associated protein RapA	2.00e-03	1.80e-03	NA	NA
5. P	A7ZHF0	RNA polymerase-associated protein RapA	8.06e-03	2.23e-03	NA	NA
5. P	A7A237	ATP-dependent rRNA helicase SPB4	3.89e-04	2.65e-03	NA	NA
5. P	B7MNR6	RNA polymerase-associated protein RapA	2.13e-02	1.13e-03	NA	NA
5. P	B7L4I0	RNA polymerase-associated protein RapA	8.21e-03	2.16e-03	NA	NA
5. P	A9L3Y2	RNA polymerase-associated protein RapA	5.93e-04	4.89e-03	NA	NA
5. P	B0BT63	RNA polymerase-associated protein RapA	4.41e-02	1.07e-03	NA	NA
5. P	B7LVT0	RNA polymerase-associated protein RapA	5.76e-03	2.02e-03	NA	NA
5. P	Q4KH47	RNA polymerase-associated protein RapA	1.25e-03	1.04e-02	NA	NA
5. P	P20448	ATP-dependent RNA helicase HCA4	6.54e-03	1.11e-02	NA	NA
5. P	Q8DCG1	RNA polymerase-associated protein RapA	1.56e-02	6.08e-03	NA	NA
5. P	Q4P9E5	ATP-dependent rRNA helicase SPB4	2.45e-02	3.73e-02	NA	NA
5. P	Q8ZII0	RNA polymerase-associated protein RapA	9.66e-03	1.41e-02	NA	NA
5. P	A4SR75	RNA polymerase-associated protein RapA	7.64e-04	1.73e-03	NA	NA
5. P	Q0UMB9	ATP-dependent RNA helicase DBP4	4.35e-04	6.51e-03	NA	NA
5. P	Q9NZ71	Regulator of telomere elongation helicase 1	6.67e-02	6.84e-03	NA	NA
5. P	C3LR47	RNA polymerase-associated protein RapA	4.31e-04	5.14e-03	NA	NA
5. P	B5FI41	RNA polymerase-associated protein RapA	6.91e-03	2.52e-03	NA	NA
5. P	Q0VGM9	Regulator of telomere elongation helicase 1	8.36e-02	7.26e-03	NA	NA
5. P	Q8XA87	ATP-dependent RNA helicase DeaD	6.60e-03	2.00e-04	NA	NA
5. P	P60240	RNA polymerase-associated protein RapA	7.89e-03	2.16e-03	NA	NA
5. P	Q0HMR2	RNA polymerase-associated protein RapA	5.66e-04	9.92e-03	NA	NA
5. P	B5R1T4	RNA polymerase-associated protein RapA	8.52e-03	2.52e-03	NA	NA
5. P	Q66EN4	RNA polymerase-associated protein RapA	2.91e-02	1.79e-02	NA	NA
5. P	P0C928	Regulator of telomere elongation helicase 1	7.53e-02	1.09e-02	NA	NA
5. P	A8H8X8	RNA polymerase-associated protein RapA	1.50e-03	2.04e-03	NA	NA
5. P	Q7VKV0	RNA polymerase-associated protein RapA	8.35e-03	5.09e-03	NA	NA
5. P	Q914M3	Putative helicase 7	NA	4.42e-02	NA	NA
5. P	Q7MHE6	RNA polymerase-associated protein RapA	6.97e-03	4.56e-03	NA	NA
5. P	B4F2H6	RNA polymerase-associated protein RapA	1.28e-03	1.45e-02	NA	NA
5. P	A5VZN0	RNA polymerase-associated protein RapA	2.69e-03	3.37e-02	NA	NA
5. P	B1J1F5	RNA polymerase-associated protein RapA	2.55e-03	3.99e-02	NA	NA
5. P	P25808	ATP-dependent rRNA helicase SPB4	1.09e-03	2.65e-03	NA	NA
5. P	Q9KP70	RNA polymerase-associated protein RapA	6.51e-04	5.14e-03	NA	NA
5. P	P44586	ATP-dependent RNA helicase DeaD	4.36e-03	6.71e-03	NA	NA
5. P	P0CR07	ATP-dependent RNA helicase DBP10	1.25e-03	1.08e-02	NA	NA
5. P	B4TWU3	RNA polymerase-associated protein RapA	6.85e-03	2.52e-03	NA	NA
5. P	Q89AF9	ATP-dependent RNA helicase DeaD	2.47e-03	7.93e-03	NA	NA
5. P	B1KJA5	RNA polymerase-associated protein RapA	7.70e-03	4.56e-03	NA	NA
5. P	A5F5C5	RNA polymerase-associated protein RapA	1.62e-03	5.78e-03	NA	NA
5. P	B7M0F4	RNA polymerase-associated protein RapA	8.75e-04	2.23e-03	NA	NA
5. P	O74764	ATP-dependent rRNA helicase spb4	9.32e-04	9.03e-04	NA	NA
5. P	Q750F8	ATP-dependent rRNA helicase SPB4	6.48e-04	4.14e-02	NA	NA
5. P	Q9CK01	RNA polymerase-associated protein RapA	1.18e-02	5.96e-03	NA	NA
5. P	A9MQF6	RNA polymerase-associated protein RapA	2.65e-02	4.42e-03	NA	NA
5. P	B5F778	RNA polymerase-associated protein RapA	7.82e-03	2.52e-03	NA	NA
5. P	Q8EJ93	RNA polymerase-associated protein RapA	8.73e-03	2.79e-03	NA	NA
5. P	Q8Z9J4	RNA polymerase-associated protein RapA	9.30e-03	2.87e-03	NA	NA
5. P	B1IRB9	RNA polymerase-associated protein RapA	5.62e-03	2.16e-03	NA	NA
5. P	Q9UTP9	ATP-dependent RNA helicase dbp4	6.31e-05	8.00e-03	NA	NA
5. P	P0CR08	ATP-dependent rRNA helicase SPB4	5.51e-03	9.71e-04	NA	NA
5. P	A0KSP4	RNA polymerase-associated protein RapA	7.85e-03	1.24e-02	NA	NA
5. P	Q2H2J1	ATP-dependent RNA helicase DBP4	1.13e-03	1.55e-02	NA	NA
5. P	P0A9P7	ATP-dependent RNA helicase DeaD	4.64e-03	3.77e-04	NA	NA
5. P	B0TVM8	RNA polymerase-associated protein RapA	2.15e-03	7.47e-03	NA	NA
5. P	Q1CMQ6	RNA polymerase-associated protein RapA	9.73e-03	1.41e-02	NA	NA
5. P	Q6D0E6	RNA polymerase-associated protein RapA	3.56e-03	2.77e-02	NA	NA
5. P	Q8ZRV8	RNA polymerase-associated protein RapA	6.20e-04	3.18e-03	NA	NA
5. P	Q5PDF0	RNA polymerase-associated protein RapA	6.78e-03	2.32e-03	NA	NA
5. P	B1JKV7	RNA polymerase-associated protein RapA	8.92e-03	1.79e-02	NA	NA
5. P	P44781	RNA polymerase-associated protein RapA	4.15e-03	4.91e-04	NA	NA
5. P	Q3Z5V2	RNA polymerase-associated protein RapA	7.91e-03	2.28e-03	NA	NA
5. P	A1SAC7	RNA polymerase-associated protein RapA	6.47e-04	9.81e-04	NA	NA
5. P	Q6CRF4	ATP-dependent RNA helicase DBP4	1.33e-03	2.14e-02	NA	NA
5. P	A6T4J7	RNA polymerase-associated protein RapA	7.07e-03	3.96e-03	NA	NA
5. P	P0CR06	ATP-dependent RNA helicase DBP10	3.23e-03	1.08e-02	NA	NA
5. P	A5UAT0	RNA polymerase-associated protein RapA	2.54e-02	3.50e-04	NA	NA
5. P	B0KU95	RNA polymerase-associated protein RapA	6.81e-03	3.60e-02	NA	NA
5. P	Q06VC2	Putative ATP-dependent RNA helicase	NA	4.18e-02	NA	NA
5. P	Q3KGV8	RNA polymerase-associated protein RapA	6.34e-03	1.41e-02	NA	NA
5. P	B7NHG5	RNA polymerase-associated protein RapA	5.62e-03	1.71e-03	NA	NA
5. P	B5Y1Y4	RNA polymerase-associated protein RapA	5.46e-03	4.47e-03	NA	NA
5. P	B7UIA5	RNA polymerase-associated protein RapA	9.24e-03	1.71e-03	NA	NA
5. P	A6VQU2	RNA polymerase-associated protein RapA	6.77e-02	8.00e-03	NA	NA
5. P	Q8FL92	RNA polymerase-associated protein RapA	7.83e-03	1.71e-03	NA	NA
6. F	Q751D1	ATP-dependent RNA helicase DBP6	4.90e-03	NA	NA	0.4028
6. F	A7TE77	ATP-dependent RNA helicase MRH4, mitochondrial	4.37e-03	NA	NA	0.4483
6. F	Q4L3G0	Transcription-repair-coupling factor	4.23e-02	NA	NA	0.2976
6. F	P0CQ82	ATP-dependent RNA helicase DBP4	4.96e-03	NA	NA	0.4154
6. F	A7TFZ9	ATP-dependent RNA helicase DBP6	2.01e-03	NA	NA	0.3695
6. F	A7IB61	ATP-dependent DNA helicase Hel308	1.67e-03	NA	NA	0.3275
6. F	Q40465	Eukaryotic initiation factor 4A-11	1.30e-04	NA	NA	0.5654
6. F	Q6C3J3	ATP-dependent RNA helicase MRH4, mitochondrial	2.03e-03	NA	NA	0.4834
6. F	Q9HJX7	ATP-dependent DNA helicase Hel308	1.27e-02	NA	NA	0.3259
6. F	O52236	Transcription-repair-coupling factor	3.30e-03	NA	NA	0.3545
6. F	Q4WWD3	ATP-dependent RNA helicase dhh1	4.30e-04	NA	NA	0.4678
6. F	Q75BL8	ATP-dependent RNA helicase eIF4A	2.51e-04	NA	NA	0.5884
6. F	P43809	ATP-dependent DNA helicase RecG	4.42e-04	NA	NA	0.3558
6. F	Q6CT46	ATP-dependent RNA helicase DBP3	2.02e-04	NA	NA	0.4739
6. F	Q6GJG8	Transcription-repair-coupling factor	4.47e-02	NA	NA	0.3847
6. F	A4R715	ATP-dependent RNA helicase DHH1	1.75e-04	NA	NA	0.4757
6. F	A6RY31	ATP-dependent RNA helicase dhh1	2.99e-04	NA	NA	0.4771
6. F	Q0W6L1	ATP-dependent DNA helicase Hel308	2.51e-02	NA	NA	0.2925
6. F	A1CJ18	ATP-dependent RNA helicase dhh1	2.49e-04	NA	NA	0.469
6. F	Q88NR0	RNA polymerase-associated protein RapA	5.78e-03	NA	NA	0.2389
6. F	Q1E5R1	ATP-dependent RNA helicase DHH1	2.42e-04	NA	NA	0.467
6. F	Q8R979	Reverse gyrase	3.20e-02	NA	NA	0.2919
6. F	Q12WZ6	ATP-dependent DNA helicase Hel308	1.23e-03	NA	NA	0.294
6. F	A5E0U9	ATP-dependent RNA helicase DBP8	2.91e-03	NA	NA	0.5295
6. F	Q6G9Y6	ATP-dependent DNA helicase RecG	1.19e-03	NA	NA	0.3714
6. F	P74397	Primosomal protein N'	5.70e-02	NA	NA	0.3371
6. F	A1D8G1	ATP-dependent RNA helicase dhh1	1.25e-04	NA	NA	0.4701
6. F	A7TEF4	ATP-dependent RNA helicase FAL1	3.04e-04	NA	NA	0.597
6. F	A7TGU7	ATP-dependent RNA helicase DHH1	6.28e-04	NA	NA	0.4798
6. F	Q97VY9	ATP-dependent DNA helicase Hel308	5.18e-03	NA	NA	0.3231
6. F	O34942	ATP-dependent DNA helicase RecG	1.15e-03	NA	NA	0.3632
6. F	Q755C5	ATP-dependent RNA helicase MRH4, mitochondrial	3.38e-03	NA	NA	0.4397
6. F	Q5HIH2	Transcription-repair-coupling factor	4.87e-02	NA	NA	0.3155
6. F	A2Q9T6	ATP-dependent RNA helicase has1	3.45e-03	NA	NA	0.4263
6. F	Q8NXZ6	Transcription-repair-coupling factor	4.94e-02	NA	NA	0.3603
6. F	Q754J2	ATP-dependent RNA helicase DBP7	1.19e-02	NA	NA	0.4072
6. F	Q6CZD9	ATP-dependent RNA helicase RhlB	6.99e-04	NA	NA	0.5613
6. F	Q6FST5	ATP-dependent RNA helicase DBP6	2.33e-03	NA	NA	0.3833
6. F	A7TK55	ATP-dependent RNA helicase eIF4A	2.56e-04	NA	NA	0.5934
6. F	P05470	Uncharacterized killer plasmid pGKL-2 helicase	5.62e-03	NA	NA	0.3849
6. F	B5RFS3	ATP-dependent RNA helicase RhlB	1.84e-03	NA	NA	0.5621
6. F	Q0CMM5	ATP-dependent RNA helicase dbp4	5.81e-03	NA	NA	0.4201
6. F	Q0U8V9	ATP-dependent RNA helicase DBP8	2.32e-03	NA	NA	0.4877
6. F	A6ZUB2	ATP-dependent RNA helicase MRH4, mitochondrial	4.98e-03	NA	NA	0.4397
6. F	P41379	Eukaryotic initiation factor 4A-2	2.07e-04	NA	NA	0.5773
6. F	Q6FPT7	ATP-dependent RNA helicase DBP4	2.72e-03	NA	NA	0.3556
6. F	Q57HT6	ATP-dependent RNA helicase RhlB	1.73e-03	NA	NA	0.5666
6. F	Q6GBY5	Transcription-repair-coupling factor	4.57e-02	NA	NA	0.353
6. F	Q55681	ATP-dependent DNA helicase RecG	1.64e-03	NA	NA	0.3519
6. F	O51568	Transcription-repair-coupling factor	9.84e-03	NA	NA	0.3049
6. F	A2QS00	ATP-dependent RNA helicase dbp4	6.08e-03	NA	NA	0.4103
6. F	A1DNF9	ATP-dependent RNA helicase dbp4	1.03e-03	NA	NA	0.4336
6. F	C4ZZ48	ATP-dependent RNA helicase RhlB	1.80e-03	NA	NA	0.5625
6. F	Q9CMB4	ATP-dependent DNA helicase RecG	1.37e-03	NA	NA	0.3525
6. F	Q1RI82	Transcription-repair-coupling factor	1.05e-02	NA	NA	0.3719
6. F	Q2YVY2	Transcription-repair-coupling factor	4.44e-02	NA	NA	0.314
6. F	A6QXC1	ATP-dependent RNA helicase DBP3	4.21e-04	NA	NA	0.492
6. F	Q975P6	Reverse gyrase 2	7.67e-03	NA	NA	0.2892
6. F	B4TB13	ATP-dependent RNA helicase RhlB	1.73e-03	NA	NA	0.5624
6. F	P37474	Transcription-repair-coupling factor	5.40e-02	NA	NA	0.3011
6. F	Q0UY62	ATP-dependent RNA helicase DBP3	7.70e-04	NA	NA	0.449
6. F	O67226	Reverse gyrase 2	1.54e-02	NA	NA	0.3273
6. F	B5BIS9	ATP-dependent RNA helicase RhlB	1.91e-03	NA	NA	0.5606
6. F	Q8ZAD8	ATP-dependent RNA helicase RhlB	7.22e-04	NA	NA	0.561
6. F	Q49V12	Transcription-repair-coupling factor	4.37e-02	NA	NA	0.2976
6. F	Q8PZR7	ATP-dependent DNA helicase Hel308	6.89e-04	NA	NA	0.2906
6. F	A3LNR6	ATP-dependent RNA helicase HAS1	6.33e-04	NA	NA	0.4294
6. F	A9MXF3	ATP-dependent RNA helicase RhlB	1.77e-03	NA	NA	0.5648
6. F	Q89AK2	Transcription-repair-coupling factor	1.28e-03	NA	NA	0.3219
6. F	Q97ZZ8	Reverse gyrase 1	8.12e-03	NA	NA	0.2808
6. F	O67837	ATP-dependent DNA helicase RecG	3.66e-03	NA	NA	0.3574
6. F	Q6FIL3	ATP-dependent RNA helicase HAS1	3.23e-03	NA	NA	0.4789
6. F	A5DLF4	ATP-dependent RNA helicase DBP4	1.29e-03	NA	NA	0.4217
6. F	Q2NQB2	ATP-dependent RNA helicase RhlB	1.11e-03	NA	NA	0.5596
6. F	Q6F598	Reverse gyrase	4.78e-02	NA	NA	0.2531
6. F	Q4HW67	ATP-dependent RNA helicase DHH1	3.71e-04	NA	NA	0.4814
6. F	A1SZG4	ATP-dependent RNA helicase RhlB	6.87e-04	NA	NA	0.5646
6. F	P41382	Eukaryotic initiation factor 4A-10	2.28e-04	NA	NA	0.5753
6. F	Q97AI2	ATP-dependent DNA helicase Hel308	6.26e-04	NA	NA	0.3327
6. F	Q6FQU5	ATP-dependent RNA helicase DHH1	9.79e-04	NA	NA	0.4502
6. F	P95479	Reverse gyrase	1.09e-02	NA	NA	0.2635
6. F	Q0U7S9	ATP-dependent RNA helicase DHH1	2.12e-04	NA	NA	0.462
6. F	Q8XD86	ATP-dependent DNA helicase RecG	4.04e-03	NA	NA	0.3738
6. F	Q6BJX6	ATP-dependent RNA helicase DHH1	8.27e-04	NA	NA	0.4588
6. F	Q6CWQ5	ATP-dependent RNA helicase MRH4, mitochondrial	5.42e-03	NA	NA	0.4124
6. F	A2QEN5	ATP-dependent RNA helicase eIF4A	2.21e-04	NA	NA	0.5874
6. F	Q08582	Reverse gyrase	1.43e-02	NA	NA	0.2804
6. F	A5DAC8	ATP-dependent RNA helicase DBP3	1.42e-04	NA	NA	0.459
6. F	Q9UZ86	Reverse gyrase	3.09e-02	NA	NA	0.239
6. F	O58530	Reverse gyrase	9.95e-03	NA	NA	0.2348
6. F	P39145	ComF operon protein 1	6.57e-04	NA	NA	0.4817
6. F	A1CKJ0	ATP-dependent RNA helicase dbp8	3.46e-03	NA	NA	0.4667
6. F	Q3IU46	ATP-dependent DNA helicase Hel308	7.40e-03	NA	NA	0.2969
6. F	Q4I662	ATP-dependent RNA helicase DBP8	8.83e-04	NA	NA	0.4544
6. F	Q7A7B2	Transcription-repair-coupling factor	4.53e-02	NA	NA	0.3662
6. F	Q9YFQ8	ATP-dependent DNA helicase Hel308	7.80e-03	NA	NA	0.2913
6. F	Q73EU1	DEAD-box ATP-dependent RNA helicase CshA	2.40e-03	NA	NA	0.4546
6. F	P47264	Uncharacterized ATP-dependent helicase MG018	7.19e-02	NA	NA	0.3455
6. F	A1CJT5	ATP-dependent RNA helicase eIF4A	2.08e-04	NA	NA	0.592
6. F	Q47281	Type I restriction enzyme EcoEI R protein	5.03e-03	NA	NA	0.3887
6. F	P96130	ATP-dependent DNA helicase RecG	2.69e-03	NA	NA	0.375
6. F	Q8ZXT5	Reverse gyrase	2.13e-02	NA	NA	0.2736
6. F	Q1R4F9	ATP-dependent RNA helicase RhlB	1.86e-03	NA	NA	0.5721
6. F	B7L8B6	ATP-dependent RNA helicase RhlB	1.84e-03	NA	NA	0.5673
6. F	Q6C0X2	ATP-dependent RNA helicase DHH1	7.74e-04	NA	NA	0.465
6. F	Q2UUN6	ATP-dependent RNA helicase has1	2.40e-03	NA	NA	0.4378
6. F	A3LWX3	ATP-dependent RNA helicase DHH1	6.80e-04	NA	NA	0.4618
6. F	F0NDL2	ATP-dependent DNA helicase Hel308	1.44e-04	NA	NA	0.3248
6. F	Q99WA0	Transcription-repair-coupling factor	4.97e-02	NA	NA	0.3159
6. F	Q0UN57	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	2.84e-02	NA	NA	0.4919
6. F	P0A2P0	ATP-dependent RNA helicase RhlB	1.79e-03	NA	NA	0.5703
6. F	O29238	Reverse gyrase	6.33e-02	NA	NA	0.317
6. F	P0CQ71	ATP-dependent RNA helicase eIF4A	8.33e-04	NA	NA	0.5983
6. F	P64324	ATP-dependent DNA helicase RecG	2.14e-03	NA	NA	0.3849
6. F	Q1CNK3	ATP-dependent RNA helicase RhlB	6.23e-04	NA	NA	0.555
6. F	Q2U5A2	ATP-dependent RNA helicase dhh1	1.01e-03	NA	NA	0.4582
6. F	A5AA68	ATP-dependent RNA helicase dbp8	3.81e-04	NA	NA	0.4644
6. F	Q4WX43	ATP-dependent RNA helicase eIF4A	4.38e-04	NA	NA	0.5428
6. F	A1D7N3	ATP-dependent RNA helicase eIF4A	2.52e-04	NA	NA	0.5812
6. F	Q2GQ93	ATP-dependent RNA helicase DHH1	3.34e-04	NA	NA	0.491
6. F	A2RUV5	Probable ATP-dependent DNA helicase HFM1	1.60e-02	NA	NA	0.2853
6. F	Q0CBE1	ATP-dependent RNA helicase dhh1	2.76e-04	NA	NA	0.4582
6. F	A5DIP0	ATP-dependent RNA helicase DHH1	8.56e-04	NA	NA	0.4735
6. F	B5YY28	ATP-dependent RNA helicase RhlB	1.79e-03	NA	NA	0.5691
6. F	Q5HPW4	ATP-dependent DNA helicase RecG	1.32e-03	NA	NA	0.3364
6. F	B1JQ11	ATP-dependent RNA helicase RhlB	5.52e-04	NA	NA	0.5632
6. F	A6ZXG9	ATP-dependent RNA helicase DHH1	7.25e-04	NA	NA	0.4678
6. F	Q8TL39	ATP-dependent DNA helicase Hel308	1.99e-03	NA	NA	0.2994
6. F	Q5BFU1	ATP-dependent RNA helicase dbp4	1.12e-02	NA	NA	0.4256
6. F	P64327	Transcription-repair-coupling factor	3.77e-02	NA	NA	0.3871
6. F	Q6GGV4	3'-5' exonuclease DinG	1.39e-03	NA	NA	0.3884
6. F	Q7S5D9	ATP-dependent RNA helicase dhh1	6.22e-04	NA	NA	0.4737
6. F	Q9V0A9	ATP-dependent DNA helicase Hel308	7.77e-03	NA	NA	0.3134
6. F	P9WMQ4	Transcription-repair-coupling factor	2.04e-02	NA	NA	0.3993
6. F	Q6BLU9	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	6.66e-04	NA	NA	0.4496
6. F	O51934	Reverse gyrase	1.88e-02	NA	NA	0.2905
6. F	Q465R3	ATP-dependent DNA helicase Hel308	4.80e-04	NA	NA	0.304
6. F	D0KN27	ATP-dependent DNA helicase Hel308	4.91e-03	NA	NA	0.3129
6. F	Q75BS4	ATP-dependent RNA helicase DHH1	1.64e-03	NA	NA	0.4835
6. F	Q5UYM9	ATP-dependent DNA helicase Hel308	3.41e-04	NA	NA	0.2792
6. F	Q8SR01	ATP-dependent RNA helicase DBP4	1.70e-04	NA	NA	0.5077
6. F	Q2FJD8	Transcription-repair-coupling factor	4.95e-02	NA	NA	0.3121
6. F	P57381	Transcription-repair-coupling factor	4.43e-03	NA	NA	0.3923
6. F	B1IWC0	ATP-dependent RNA helicase RhlB	1.81e-03	NA	NA	0.5625
6. F	A7TNT1	ATP-dependent RNA helicase DBP7	2.01e-03	NA	NA	0.3201
6. F	A6TGG9	ATP-dependent RNA helicase RhlB	1.77e-03	NA	NA	0.5686
6. F	Q07736	Type I restriction enzyme EcoAI R protein	4.94e-03	NA	NA	0.3401
6. F	O59025	ATP-dependent DNA helicase Hel308	7.99e-03	NA	NA	0.3207
6. F	Q5HRQ2	Transcription-repair-coupling factor	4.97e-02	NA	NA	0.2984
6. F	P0DMI1	ATP-dependent DNA helicase Hel308	3.08e-03	NA	NA	0.3274
6. F	Q61R02	Probable ATP-dependent RNA helicase DDX55 homolog	3.51e-04	NA	NA	0.4287
6. F	A6ZZY8	ATP-dependent RNA helicase DBP7	1.75e-03	NA	NA	0.3169
6. F	Q6FJJ8	ATP-dependent RNA helicase MRH4, mitochondrial	7.77e-03	NA	NA	0.4396
6. F	A2QY39	ATP-dependent RNA helicase dhh1	2.45e-04	NA	NA	0.4714
6. F	Q6CKZ4	ATP-dependent RNA helicase DBP6	7.53e-04	NA	NA	0.3987
6. F	B4TNT3	ATP-dependent RNA helicase RhlB	1.90e-03	NA	NA	0.5619
6. F	Q6CSZ7	ATP-dependent RNA helicase DHH1	7.74e-04	NA	NA	0.4531
6. F	P0CQ83	ATP-dependent RNA helicase DBP4	1.26e-02	NA	NA	0.4163
6. F	O73946	ATP-dependent DNA helicase Hel308	9.17e-03	NA	NA	0.3437
6. F	P45128	Transcription-repair-coupling factor	9.44e-03	NA	NA	0.3633
6. F	B5XYY9	ATP-dependent RNA helicase RhlB	1.78e-03	NA	NA	0.5602
7. B	P96313	Protein translocase subunit SecA (Fragment)	0.00e+00	NA	4.39e-109	NA