Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54614.1

JCVISYN3A_0105

Exodeoxyribonuclease VII small subunit.
M. mycoides homolog: Q6MUD2.
TIGRfam Classification: 4=Probable.
Category: Nonessential.

Statistics

Total GO Annotation: 58
Unique PROST Go: 54
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 963
Unique PROST Homologs: 935
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: xseB; Exodeoxyribonuclease 7 small subunit
Zhang et al. [4]: GO:0008855|exodeoxyribonuclease VII activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was B9JSL3 (Exodeoxyribonuclease 7 small subunit) with a FATCAT P-Value: 0 and RMSD of 0.67 angstrom. The sequence alignment identity is 17.4%.
Structural alignment shown in left. Query protein AVX54614.1 colored as red in alignment, homolog B9JSL3 colored as blue. Query protein AVX54614.1 is also shown in right top, homolog B9JSL3 showed in right bottom. They are colored based on secondary structures.

  AVX54614.1 MSN------KSKSYDELISEIKEDTKKLSSNEISVEQAMEIFEQN-IEKIKLAKEKLTQYKGQIYKVMQD--------DELEEFKD 71
      B9JSL3 MTDVAATDIAAYSFEKAVAELESIVARLERGDVALDESISIYERGELLK-KHCEALLSAAENRIEKIRLDRAGKPVGAEPLD--KD 83

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
4. PB	GO:0009318	exodeoxyribonuclease VII complex
4. PB	GO:0006308	DNA catabolic process
4. PB	GO:0008855	exodeoxyribonuclease VII activity
4. PB	GO:0005737	cytoplasm
5. P	GO:0009740	gibberellic acid mediated signaling pathway
5. P	GO:0007021	tubulin complex assembly
5. P	GO:0031511	Mis6-Sim4 complex
5. P	GO:0033566	gamma-tubulin complex localization
5. P	GO:0005819	spindle
5. P	GO:0051010	microtubule plus-end binding
5. P	GO:0043937	regulation of sporulation
5. P	GO:0051415	microtubule nucleation by interphase microtubule organizing center
5. P	GO:0098003	viral tail assembly
5. P	GO:0031021	interphase microtubule organizing center
5. P	GO:0000746	conjugation
5. P	GO:0062110	negative regulation of DNA recombinase disassembly
5. P	GO:0006355	regulation of transcription, DNA-templated
5. P	GO:0004333	fumarate hydratase activity
5. P	GO:0030436	asexual sporulation
5. P	GO:0003735	structural constituent of ribosome
5. P	GO:0072686	mitotic spindle
5. P	GO:0032955	regulation of division septum assembly
5. P	GO:0042729	DASH complex
5. P	GO:0051455	monopolar spindle attachment to meiosis I kinetochore
5. P	GO:0051987	positive regulation of attachment of spindle microtubules to kinetochore
5. P	GO:0007023	post-chaperonin tubulin folding pathway
5. P	GO:0002528	regulation of vascular permeability involved in acute inflammatory response
5. P	GO:0006294	nucleotide-excision repair, preincision complex assembly
5. P	GO:0005634	nucleus
5. P	GO:0061497	inner plaque of mitotic spindle pole body
5. P	GO:0005840	ribosome
5. P	GO:1900191	negative regulation of single-species biofilm formation
5. P	GO:0032798	Swi5-Sfr1 complex
5. P	GO:0060633	negative regulation of transcription initiation from RNA polymerase II promoter
5. P	GO:0005816	spindle pole body
5. P	GO:0009640	photomorphogenesis
5. P	GO:0000708	meiotic strand invasion
5. P	GO:0006412	translation
5. P	GO:0005874	microtubule
5. P	GO:0070088	PHA granule
5. P	GO:0009399	nitrogen fixation
5. P	GO:0000709	meiotic joint molecule formation
5. P	GO:0072201	negative regulation of mesenchymal cell proliferation
5. P	GO:0090307	mitotic spindle assembly
5. P	GO:0043093	FtsZ-dependent cytokinesis
5. P	GO:0010772	meiotic DNA recombinase assembly involved in reciprocal meiotic recombination
5. P	GO:0051417	microtubule nucleation by spindle pole body
5. P	GO:0030435	sporulation resulting in formation of a cellular spore
5. P	GO:0010086	embryonic root morphogenesis
5. P	GO:0048510	regulation of timing of transition from vegetative to reproductive phase
5. P	GO:1990758	mitotic sister chromatid biorientation
5. P	GO:0031116	positive regulation of microtubule polymerization
5. P	GO:0009742	brassinosteroid mediated signaling pathway
5. P	GO:0000931	gamma-tubulin large complex
5. P	GO:0071479	cellular response to ionizing radiation
5. P	GO:0008608	attachment of spindle microtubules to kinetochore
5. P	GO:0034974	Swi5-Swi2 complex
5. P	GO:0019843	rRNA binding

Uniprot GO Annotations

GO	Description
GO:0006308	DNA catabolic process
GO:0090305	nucleic acid phosphodiester bond hydrolysis
GO:0004527	exonuclease activity
GO:0009318	exodeoxyribonuclease VII complex
GO:0008855	exodeoxyribonuclease VII activity
GO:0016787	hydrolase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
4. PB	B7HB50	Exodeoxyribonuclease 7 small subunit	3.03e-07	3.13e-30	0.002	NA
4. PB	A9QZS1	Exodeoxyribonuclease 7 small subunit	4.90e-07	4.72e-26	0.042	NA
4. PB	Q6HDY6	Exodeoxyribonuclease 7 small subunit	3.20e-07	3.13e-30	0.002	NA
4. PB	B7IXH0	Exodeoxyribonuclease 7 small subunit	3.65e-07	6.33e-30	0.001	NA
4. PB	B2K6T9	Exodeoxyribonuclease 7 small subunit	3.22e-07	4.72e-26	0.042	NA
4. PB	Q8ZC47	Exodeoxyribonuclease 7 small subunit	5.48e-07	4.72e-26	0.042	NA
4. PB	A0RIH1	Exodeoxyribonuclease 7 small subunit	2.89e-07	3.13e-30	0.002	NA
4. PB	C3P7V8	Exodeoxyribonuclease 7 small subunit	3.40e-07	3.13e-30	0.002	NA
4. PB	C4LAC2	Exodeoxyribonuclease 7 small subunit	7.99e-11	1.74e-18	0.006	NA
4. PB	C3LJV3	Exodeoxyribonuclease 7 small subunit	3.83e-07	3.13e-30	0.002	NA
4. PB	Q5E6Y8	Exodeoxyribonuclease 7 small subunit	1.72e-09	1.35e-31	0.031	NA
4. PB	C1ERQ2	Exodeoxyribonuclease 7 small subunit	3.79e-07	3.13e-30	0.002	NA
4. PB	B7JM30	Exodeoxyribonuclease 7 small subunit	3.62e-07	3.13e-30	0.002	NA
4. PB	A7FLE2	Exodeoxyribonuclease 7 small subunit	4.85e-07	4.72e-26	0.042	NA
4. PB	A9VGD3	Exodeoxyribonuclease 7 small subunit	3.73e-07	2.87e-29	0.010	NA
4. PB	Q8DVB4	Exodeoxyribonuclease 7 small subunit	2.12e-12	5.05e-32	0.021	NA
4. PB	B7HNU2	Exodeoxyribonuclease 7 small subunit	3.50e-07	3.13e-30	0.002	NA
4. PB	Q81M52	Exodeoxyribonuclease 7 small subunit	3.55e-07	3.13e-30	0.002	NA
4. PB	B9IXH2	Exodeoxyribonuclease 7 small subunit	3.43e-07	3.13e-30	0.002	NA
4. PB	Q635A5	Exodeoxyribonuclease 7 small subunit	3.48e-07	3.13e-30	0.002	NA
4. PB	A1JNR4	Exodeoxyribonuclease 7 small subunit	2.46e-07	3.16e-23	0.002	NA
4. PB	B1JID6	Exodeoxyribonuclease 7 small subunit	1.95e-07	1.22e-24	0.010	NA
4. PB	A7GSJ7	Exodeoxyribonuclease 7 small subunit	3.56e-07	1.49e-29	0.006	NA
4. PB	A4J3F7	Exodeoxyribonuclease 7 small subunit	1.87e-12	5.89e-18	0.032	NA
4. PB	Q818R7	Exodeoxyribonuclease 7 small subunit	3.14e-07	3.13e-30	0.002	NA
4. PB	Q731B4	Exodeoxyribonuclease 7 small subunit	4.21e-07	9.52e-30	0.015	NA
4. PB	B5FBG8	Exodeoxyribonuclease 7 small subunit	3.47e-14	1.35e-31	0.031	NA
4. PB	Q66DV2	Exodeoxyribonuclease 7 small subunit	4.29e-07	4.72e-26	0.042	NA
5. P	A3PVC9	50S ribosomal protein L29	4.12e-05	3.59e-02	NA	NA
5. P	B6I248	Protein SlyX	1.56e-04	3.29e-02	NA	NA
5. P	Q5LX40	Exodeoxyribonuclease 7 small subunit	2.00e-08	3.99e-16	NA	NA
5. P	A7GKT9	UPF0435 protein Bcer98_0391	1.56e-03	7.78e-03	NA	NA
5. P	Q8RAC8	Exodeoxyribonuclease 7 small subunit	5.41e-07	6.58e-30	NA	NA
5. P	Q4QLV1	UPF0270 protein NTHI1129	3.53e-05	2.48e-02	NA	NA
5. P	A6TAY2	UPF0181 protein KPN78578_22920	1.49e-03	4.92e-05	NA	NA
5. P	Q1RH98	UPF0335 protein RBE_1185	6.18e-07	4.78e-05	NA	NA
5. P	B5Z9A1	Exodeoxyribonuclease 7 small subunit	2.19e-09	4.47e-04	NA	NA
5. P	B2K5Q7	UPF0270 protein YPTS_3917	7.28e-04	1.18e-02	NA	NA
5. P	Q2RY87	Protein SlyX homolog	2.71e-05	4.07e-02	NA	NA
5. P	P60074	UPF0291 protein SAV1341	1.37e-04	3.03e-03	NA	NA
5. P	Q1J5U7	Exodeoxyribonuclease 7 small subunit	2.09e-11	7.49e-35	NA	NA
5. P	A8FF13	Exodeoxyribonuclease 7 small subunit	1.00e-08	2.11e-23	NA	NA
5. P	A8GRQ8	Exodeoxyribonuclease 7 small subunit	1.25e-13	4.11e-34	NA	NA
5. P	B2TRM7	Exodeoxyribonuclease 7 small subunit	7.01e-13	4.15e-29	NA	NA
5. P	Q71ZW0	Exodeoxyribonuclease 7 small subunit	1.52e-12	5.60e-34	NA	NA
5. P	Q8UHD5	Exodeoxyribonuclease 7 small subunit	8.99e-15	1.82e-20	NA	NA
5. P	P64457	Uncharacterized protein YdcY	6.32e-07	5.58e-03	NA	NA
5. P	P58001	Exodeoxyribonuclease 7 small subunit	7.38e-13	3.42e-21	NA	NA
5. P	Q8FYV6	UPF0335 protein BR1752/BS1330_I1746	8.00e-05	1.64e-03	NA	NA
5. P	B0U3Y1	Exodeoxyribonuclease 7 small subunit	2.44e-11	8.86e-18	NA	NA
5. P	Q6A6N4	50S ribosomal protein L29	3.68e-06	1.46e-02	NA	NA
5. P	A0LI55	Exodeoxyribonuclease 7 small subunit	2.36e-08	1.05e-17	NA	NA
5. P	B1XH79	UPF0181 protein YoaH	5.29e-03	1.53e-05	NA	NA
5. P	B2FP36	Exodeoxyribonuclease 7 small subunit	6.02e-12	3.72e-21	NA	NA
5. P	B0BW80	UPF0335 protein RrIowa_0193	8.99e-07	5.62e-05	NA	NA
5. P	A5UL82	50S ribosomal protein L29	8.41e-07	2.07e-02	NA	NA
5. P	Q8XX93	Exodeoxyribonuclease 7 small subunit	4.68e-10	1.32e-11	NA	NA
5. P	Q6HFI9	Small, acid-soluble spore protein Tlp	1.27e-08	3.74e-05	NA	NA
5. P	A5EEQ1	Exodeoxyribonuclease 7 small subunit	7.55e-15	9.45e-25	NA	NA
5. P	P06154	Probable regulatory protein N	NA	1.80e-02	NA	NA
5. P	Q839T8	UPF0291 protein EF_0064	5.21e-05	7.30e-03	NA	NA
5. P	A8EXH9	UPF0335 protein A1E_00570	5.64e-07	3.85e-05	NA	NA
5. P	Q130G8	Exodeoxyribonuclease 7 small subunit	2.68e-13	1.46e-23	NA	NA
5. P	A7MYC1	Exodeoxyribonuclease 7 small subunit	8.77e-15	1.13e-30	NA	NA
5. P	Q5HDW6	50S ribosomal protein L29	5.59e-07	1.14e-02	NA	NA
5. P	A7MUJ3	UPF0352 protein VIBHAR_03027	1.77e-04	1.35e-03	NA	NA
5. P	A8A5F5	Protein SlyX	1.60e-04	3.29e-02	NA	NA
5. P	P96637	Uncharacterized protein YdcT	2.52e-02	5.88e-09	NA	NA
5. P	B6JC05	UPF0335 protein OCAR_5086/OCA5_c28780	5.13e-05	9.80e-04	NA	NA
5. P	B7NLQ3	Protein SlyX	1.40e-04	3.29e-02	NA	NA
5. P	A9MRK3	Transcriptional repressor RcnR	7.43e-06	1.58e-03	NA	NA
5. P	A5F6M2	UPF0352 protein VC0395_A1625/VC395_2155	1.08e-04	1.47e-02	NA	NA
5. P	P0A8H1	Exodeoxyribonuclease 7 small subunit	5.57e-08	1.04e-30	NA	NA
5. P	B4SQZ7	Exodeoxyribonuclease 7 small subunit	7.85e-12	1.30e-21	NA	NA
5. P	P0CP04	Mitotic-spindle organizing protein 1	2.14e-07	1.77e-05	NA	NA
5. P	B9K852	Exodeoxyribonuclease 7 small subunit	1.52e-14	1.65e-11	NA	NA
5. P	Q97FL0	UPF0291 protein CA_C2726	1.09e-06	5.62e-05	NA	NA
5. P	B1KXR9	UPF0291 protein CLK_1994	3.17e-05	2.07e-05	NA	NA
5. P	P45905	Uncharacterized protein YqaH	2.35e-06	1.61e-06	NA	NA
5. P	B1IMN7	Exodeoxyribonuclease 7 small subunit	9.60e-13	1.80e-34	NA	NA
5. P	P0AAP3	Transcriptional repressor FrmR	1.11e-07	4.51e-02	NA	NA
5. P	B6J1L1	Exodeoxyribonuclease 7 small subunit	1.32e-08	1.95e-26	NA	NA
5. P	A9KEC8	Exodeoxyribonuclease 7 small subunit	1.09e-10	1.95e-26	NA	NA
5. P	Q975I8	50S ribosomal protein L29	2.87e-06	2.70e-02	NA	NA
5. P	B7MD80	Exodeoxyribonuclease 7 small subunit	2.69e-11	1.04e-30	NA	NA
5. P	A1SAW5	Cell division protein ZapB	2.22e-05	4.78e-03	NA	NA
5. P	Q4L8A6	50S ribosomal protein L29	7.01e-07	1.26e-02	NA	NA
5. P	B7M1P9	Protein SlyX	1.48e-04	3.29e-02	NA	NA
5. P	A3N0G6	Exodeoxyribonuclease 7 small subunit	8.88e-16	1.12e-41	NA	NA
5. P	Q9JSM1	Exodeoxyribonuclease 7 small subunit	1.03e-09	1.08e-31	NA	NA
5. P	B5F3R8	UPF0181 protein YoaH	5.84e-03	7.24e-05	NA	NA
5. P	B1KT52	Exodeoxyribonuclease 7 small subunit	6.30e-13	2.26e-34	NA	NA
5. P	B0K9E2	Exodeoxyribonuclease 7 small subunit	1.69e-10	9.12e-25	NA	NA
5. P	A8M521	50S ribosomal protein L29	3.21e-06	2.57e-02	NA	NA
5. P	B1KJ42	UPF0352 protein Swoo_2786	3.55e-04	7.85e-05	NA	NA
5. P	P0DOY4	Arcadin-3	2.36e-03	2.50e-03	NA	NA
5. P	B8H4R9	UPF0335 protein CCNA_03428	3.31e-06	2.13e-04	NA	NA
5. P	Q8FS74	50S ribosomal protein L29	5.94e-05	7.43e-04	NA	NA
5. P	Q4UKA4	UPF0335 protein RF_1180	7.56e-07	4.73e-05	NA	NA
5. P	P67457	Exodeoxyribonuclease 7 small subunit	2.74e-12	7.47e-08	NA	NA
5. P	B1LD62	UPF0181 protein YoaH	2.51e-04	1.61e-06	NA	NA
5. P	Q6G4D2	Exodeoxyribonuclease 7 small subunit	2.56e-14	5.63e-24	NA	NA
5. P	C3PN64	Exodeoxyribonuclease 7 small subunit	2.88e-12	6.75e-34	NA	NA
5. P	C3LTE1	Exodeoxyribonuclease 7 small subunit	2.79e-12	1.34e-28	NA	NA
5. P	A4WBG9	UPF0181 protein Ent638_2380	8.31e-04	4.06e-04	NA	NA
5. P	Q8ER04	UPF0435 protein OB1527	2.84e-03	2.38e-03	NA	NA
5. P	B7MVU0	UPF0181 protein YoaH	4.65e-03	1.53e-05	NA	NA
5. P	Q82VD5	Exodeoxyribonuclease 7 small subunit	1.13e-09	5.44e-17	NA	NA
5. P	Q68W86	50S ribosomal protein L29	9.40e-07	2.66e-02	NA	NA
5. P	B1WQR8	50S ribosomal protein L29	8.47e-08	6.44e-04	NA	NA
5. P	Q03RR3	Exodeoxyribonuclease 7 small subunit	4.80e-07	5.09e-19	NA	NA
5. P	A5IT51	Exodeoxyribonuclease 7 small subunit	1.67e-15	2.38e-27	NA	NA
5. P	Q393P2	Exodeoxyribonuclease 7 small subunit	1.90e-08	3.22e-12	NA	NA
5. P	A1SWW4	Exodeoxyribonuclease 7 small subunit	7.74e-14	6.44e-37	NA	NA
5. P	B5Z3S7	Exodeoxyribonuclease 7 small subunit	4.39e-12	1.04e-30	NA	NA
5. P	A9WWM7	UPF0335 protein BSUIS_B1228	4.28e-05	2.64e-03	NA	NA
5. P	A8GM75	UPF0335 protein A1C_00850	8.98e-07	6.61e-05	NA	NA
5. P	B0KL81	Exodeoxyribonuclease 7 small subunit	1.13e-13	5.47e-26	NA	NA
5. P	B7V7R6	Exodeoxyribonuclease 7 small subunit	1.56e-08	4.02e-27	NA	NA
5. P	B5ZB48	50S ribosomal protein L29	4.54e-10	5.18e-05	NA	NA
5. P	P60076	UPF0291 protein SA1176	1.58e-04	3.03e-03	NA	NA
5. P	Q18AS6	UPF0291 protein CD630_10710	4.01e-05	2.44e-02	NA	NA
5. P	Q88V12	UPF0297 protein lp_2275	1.11e-02	4.04e-02	NA	NA
5. P	Q2YYN0	50S ribosomal protein L29	5.66e-07	1.14e-02	NA	NA
5. P	P56507	UPF0181 protein HI_1434.2	5.46e-04	1.26e-03	NA	NA
5. P	Q7WL39	Exodeoxyribonuclease 7 small subunit	1.47e-07	2.18e-16	NA	NA
5. P	Q8EF26	UPF0352 protein SO_2176	1.26e-04	1.77e-03	NA	NA
5. P	Q8PM80	Protein SlyX homolog	9.26e-06	2.57e-03	NA	NA
5. P	A5VKR5	Exodeoxyribonuclease 7 small subunit	2.43e-06	2.38e-03	NA	NA
5. P	B4TXZ4	UPF0181 protein YoaH	6.87e-03	7.24e-05	NA	NA
5. P	C1FJY8	Protein Tlp homolog	4.10e-09	3.53e-02	NA	NA
5. P	B2ITP7	50S ribosomal protein L29	4.06e-09	4.87e-02	NA	NA
5. P	Q46229	50S ribosomal protein L22 (Fragment)	2.29e-02	1.98e-03	NA	NA
5. P	O48400	Putative gene 46 protein	NA	3.74e-03	NA	NA
5. P	O31819	Aspartyl-phosphate phosphatase YnzD	4.38e-05	2.00e-03	NA	NA
5. P	Q63JF2	Exodeoxyribonuclease 7 small subunit	2.75e-08	1.13e-12	NA	NA
5. P	A1W247	Cell division topological specificity factor	2.41e-01	2.20e-02	NA	NA
5. P	P67466	Exodeoxyribonuclease 7 small subunit	1.20e-11	1.95e-36	NA	NA
5. P	A8EZ91	Exodeoxyribonuclease 7 small subunit	2.87e-13	5.15e-32	NA	NA
5. P	A7ZP12	UPF0352 protein YejL	1.09e-04	3.94e-02	NA	NA
5. P	Q03550	Eai protein	NA	1.29e-03	NA	NA
5. P	A9BH97	50S ribosomal protein L29	1.49e-06	1.41e-02	NA	NA
5. P	A1U3R1	Protein SlyX homolog	4.55e-04	1.43e-02	NA	NA
5. P	Q65TM9	UPF0181 protein MS1074	5.53e-07	2.12e-02	NA	NA
5. P	Q7CR17	Hemolysin expression-modulating protein Hha	1.93e-03	6.63e-04	NA	NA
5. P	B8CNP8	UPF0352 protein swp_2271	5.16e-04	3.18e-02	NA	NA
5. P	Q9KTN0	UPF0253 protein VC_0872	8.85e-04	5.47e-04	NA	NA
5. P	P22665	50S ribosomal protein L29	5.59e-05	1.95e-02	NA	NA
5. P	B0UWB7	Protein SlyX homolog	2.59e-05	9.89e-04	NA	NA
5. P	B6JNY0	Exodeoxyribonuclease 7 small subunit	1.01e-12	9.09e-08	NA	NA
5. P	C6BYY0	Exodeoxyribonuclease 7 small subunit	9.19e-12	2.02e-16	NA	NA
5. P	Q7CPV3	Transcriptional repressor RcnR	7.90e-06	7.58e-04	NA	NA
5. P	B8GXC6	Exodeoxyribonuclease 7 small subunit	3.55e-14	5.08e-26	NA	NA
5. P	Q8PAH9	Protein SlyX homolog	3.90e-05	8.10e-04	NA	NA
5. P	A7MFH4	Exodeoxyribonuclease 7 small subunit	6.21e-10	5.31e-31	NA	NA
5. P	A6VUE7	Exodeoxyribonuclease 7 small subunit	2.56e-09	4.28e-25	NA	NA
5. P	Q6LU05	Exodeoxyribonuclease 7 small subunit	1.69e-12	1.15e-33	NA	NA
5. P	Q5WD36	Small, acid-soluble spore protein Tlp	1.55e-08	7.47e-05	NA	NA
5. P	Q1QQ39	Exodeoxyribonuclease 7 small subunit	4.59e-14	4.04e-23	NA	NA
5. P	Q2RIB6	Exodeoxyribonuclease 7 small subunit	1.04e-11	6.75e-17	NA	NA
5. P	B5BDA8	Exodeoxyribonuclease 7 small subunit	5.62e-12	3.37e-31	NA	NA
5. P	Q481H1	Cell division topological specificity factor	2.03e-02	2.33e-02	NA	NA
5. P	B8I4S8	UPF0297 protein Ccel_2240	5.45e-03	3.13e-02	NA	NA
5. P	B7N2U6	Protein SlyX	1.52e-04	3.29e-02	NA	NA
5. P	P0CP05	Mitotic-spindle organizing protein 1	2.13e-07	1.77e-05	NA	NA
5. P	Q5GXL9	Exodeoxyribonuclease 7 small subunit	4.49e-12	4.97e-20	NA	NA
5. P	C6E2U6	Exodeoxyribonuclease 7 small subunit	3.97e-12	5.72e-23	NA	NA
5. P	P39237	Uncharacterized 6.8 kDa protein in mobD-ri intergenic region	NA	5.48e-03	NA	NA
5. P	Q6G9L7	UPF0291 protein SAS1281	1.38e-04	3.03e-03	NA	NA
5. P	A4YQ37	Exodeoxyribonuclease 7 small subunit	3.77e-15	5.92e-25	NA	NA
5. P	B6EIA9	Exodeoxyribonuclease 7 small subunit	1.23e-09	1.20e-32	NA	NA
5. P	A8AP75	Transcriptional repressor RcnR	9.01e-06	3.44e-04	NA	NA
5. P	A4XLS2	50S ribosomal protein L29	4.36e-08	6.05e-03	NA	NA
5. P	Q8DCS6	UPF0270 protein VV1_1320	3.80e-04	2.05e-02	NA	NA
5. P	P67338	UPF0181 protein YoaH	3.51e-04	1.53e-05	NA	NA
5. P	B7LPN6	UPF0181 protein YoaH	5.19e-03	1.53e-05	NA	NA
5. P	C3PKR0	50S ribosomal protein L29	5.62e-05	1.75e-02	NA	NA
5. P	Q07J51	UPF0335 protein RPE_4107	1.92e-04	8.35e-03	NA	NA
5. P	Q81Y88	Small, acid-soluble spore protein Tlp	1.51e-08	3.74e-05	NA	NA
5. P	A7ZIA5	Transcriptional repressor FrmR	1.06e-07	4.51e-02	NA	NA
5. P	A6LU46	Exodeoxyribonuclease 7 small subunit	1.82e-11	8.81e-30	NA	NA
5. P	Q32JI0	Exodeoxyribonuclease 7 small subunit	7.06e-09	1.04e-30	NA	NA
5. P	B5ZS73	Exodeoxyribonuclease 7 small subunit	3.24e-13	5.43e-24	NA	NA
5. P	Q44361	Conjugal transfer protein TraD	4.48e-05	4.43e-04	NA	NA
5. P	A8AFP7	UPF0181 protein CKO_01169	9.45e-03	4.91e-03	NA	NA
5. P	Q1RIG7	Exodeoxyribonuclease 7 small subunit	1.10e-12	3.48e-33	NA	NA
5. P	B8DFW6	Exodeoxyribonuclease 7 small subunit	1.37e-12	5.60e-34	NA	NA
5. P	B0TEJ2	Exodeoxyribonuclease 7 small subunit	9.08e-10	2.17e-21	NA	NA
5. P	Q9CL92	Protein SlyX homolog	1.71e-04	1.29e-02	NA	NA
5. P	Q6FRP0	DASH complex subunit DAD4	1.27e-05	4.04e-02	NA	NA
5. P	B4RGV8	Exodeoxyribonuclease 7 small subunit	4.49e-11	4.05e-25	NA	NA
5. P	Q8F3P4	Exodeoxyribonuclease 7 small subunit	1.35e-09	1.48e-04	NA	NA
5. P	B7I056	Small, acid-soluble spore protein Tlp	1.12e-08	3.74e-05	NA	NA
5. P	P0A8R4	Protein SlyX	1.39e-04	3.29e-02	NA	NA
5. P	P54052	50S ribosomal protein L18Ae	2.51e-01	4.36e-02	NA	NA
5. P	Q1QNZ8	UPF0335 protein Nham_1221	1.64e-04	4.51e-02	NA	NA
5. P	B4SWR6	Exodeoxyribonuclease 7 small subunit	1.18e-10	3.37e-31	NA	NA
5. P	Q5ZT36	Exodeoxyribonuclease 7 small subunit	2.45e-10	7.47e-24	NA	NA
5. P	Q5QVD9	Exodeoxyribonuclease 7 small subunit	1.33e-08	4.72e-30	NA	NA
5. P	B1LIP2	Transcriptional repressor FrmR	1.03e-07	4.51e-02	NA	NA
5. P	Q5HM07	50S ribosomal protein L29	5.45e-07	1.14e-02	NA	NA
5. P	Q7TD12	Uncharacterized protein 1a	NA	3.06e-03	NA	NA
5. P	Q1R9W7	Transcriptional repressor RcnR	8.05e-06	3.18e-04	NA	NA
5. P	A1WYI6	Exodeoxyribonuclease 7 small subunit	2.13e-12	2.75e-20	NA	NA
5. P	Q3AAM6	Exodeoxyribonuclease 7 small subunit	3.02e-11	2.47e-05	NA	NA
5. P	Q836W5	Exodeoxyribonuclease 7 small subunit	6.61e-12	6.45e-26	NA	NA
5. P	Q97IZ9	Protein Tlp homolog	1.18e-08	1.49e-06	NA	NA
5. P	P55696	UPF0437 protein y4xE	3.45e-06	1.93e-04	NA	NA
5. P	P67461	Exodeoxyribonuclease 7 small subunit	1.33e-15	2.38e-27	NA	NA
5. P	Q1RAY1	UPF0181 protein YoaH	3.59e-04	1.53e-05	NA	NA
5. P	A6V060	Exodeoxyribonuclease 7 small subunit	1.27e-07	5.78e-26	NA	NA
5. P	B7UJP5	Exodeoxyribonuclease 7 small subunit	2.28e-11	1.04e-30	NA	NA
5. P	Q6MR96	Exodeoxyribonuclease 7 small subunit	3.10e-09	1.45e-15	NA	NA
5. P	Q0AQF4	Protein SlyX homolog	3.59e-05	3.09e-04	NA	NA
5. P	Q2FGL1	Exodeoxyribonuclease 7 small subunit	1.89e-15	2.38e-27	NA	NA
5. P	P39502	Uncharacterized 8.8 kDa protein in pseT-alc intergenic region	NA	4.40e-02	NA	NA
5. P	Q03QR3	UPF0291 protein LVIS_1359	2.49e-05	3.46e-06	NA	NA
5. P	A1W4U7	Exodeoxyribonuclease 7 small subunit	1.86e-09	1.12e-04	NA	NA
5. P	Q65J23	Small, acid-soluble spore protein Tlp	1.47e-06	1.23e-02	NA	NA
5. P	P24795	Uncharacterized protein gp14	NA	1.30e-05	NA	NA
5. P	Q03K99	Exodeoxyribonuclease 7 small subunit	1.12e-11	2.08e-32	NA	NA
5. P	Q6NG70	UPF0337 protein DIP1660	1.49e-04	2.79e-03	NA	NA
5. P	A4G1W7	Exodeoxyribonuclease 7 small subunit	8.74e-10	3.35e-20	NA	NA
5. P	B3CLT6	UPF0335 protein WP0746	1.96e-05	9.25e-04	NA	NA
5. P	C4K2H1	50S ribosomal protein L29	1.03e-06	1.52e-02	NA	NA
5. P	B1J3G6	Exodeoxyribonuclease 7 small subunit	5.56e-14	5.99e-26	NA	NA
5. P	D3WAD0	Chaperone protein gp12	NA	4.29e-02	NA	NA
5. P	C4ZTH9	Exodeoxyribonuclease 7 small subunit	3.53e-08	1.04e-30	NA	NA
5. P	Q6QW47	UPF0335 protein pRhico085	4.81e-05	1.80e-02	NA	NA
5. P	A3N2T7	Protein SlyX homolog	2.17e-04	3.57e-04	NA	NA
5. P	A5UEV0	UPF0181 protein CGSHiGG_01050	5.79e-04	1.41e-02	NA	NA
5. P	B5XM82	Exodeoxyribonuclease 7 small subunit	2.76e-11	7.49e-35	NA	NA
5. P	B1K3T1	Exodeoxyribonuclease 7 small subunit	1.64e-08	4.89e-12	NA	NA
5. P	A5IV26	50S ribosomal protein L29	5.85e-07	1.14e-02	NA	NA
5. P	B8F4R9	Exodeoxyribonuclease 7 small subunit	4.87e-14	4.41e-40	NA	NA
5. P	Q9CIE9	PTS system cellobiose-specific EIIA component	1.44e-04	1.03e-02	NA	NA
5. P	Q67NB3	Exodeoxyribonuclease 7 small subunit	3.77e-13	9.43e-31	NA	NA
5. P	A9MX07	Exodeoxyribonuclease 7 small subunit	3.93e-10	3.37e-31	NA	NA
5. P	B1IIA6	Protein Tlp homolog	3.84e-09	1.25e-02	NA	NA
5. P	A4IQR9	Exodeoxyribonuclease 7 small subunit	3.91e-07	8.64e-30	NA	NA
5. P	B5R8X8	UPF0181 protein YoaH	6.78e-03	7.24e-05	NA	NA
5. P	A8FU97	UPF0352 protein Ssed_1809	6.10e-05	1.78e-04	NA	NA
5. P	A5IEC9	Exodeoxyribonuclease 7 small subunit	5.11e-13	2.23e-24	NA	NA
5. P	Q3E7Y6	N-terminal-borealin-like protein	1.71e-06	3.06e-04	NA	NA
5. P	A1UR66	UPF0335 protein BARBAKC583_0130	2.63e-05	1.91e-02	NA	NA
5. P	Q68X23	Exodeoxyribonuclease 7 small subunit	3.02e-12	1.18e-32	NA	NA
5. P	Q1IFK9	Exodeoxyribonuclease 7 small subunit	1.80e-13	1.81e-26	NA	NA
5. P	Q83PY1	Protein SlyX	1.62e-04	1.34e-02	NA	NA
5. P	A1BJ57	Exodeoxyribonuclease 7 small subunit	4.18e-13	6.47e-21	NA	NA
5. P	P9WKP4	Uncharacterized protein MT0921.1	2.07e-07	1.60e-05	NA	NA
5. P	Q89EF0	UPF0335 protein bsl7135	4.50e-05	2.20e-02	NA	NA
5. P	Q325H9	Exodeoxyribonuclease 7 small subunit	8.46e-09	1.04e-30	NA	NA
5. P	A9R484	UPF0270 protein YpAngola_A3698	7.13e-04	7.99e-03	NA	NA
5. P	P73545	Phasin PhaP	1.22e-05	2.27e-02	NA	NA
5. P	Q9I0D9	Immune protein Tsi2	4.04e-07	8.83e-04	NA	NA
5. P	B1KPD1	Cell division protein ZapB	2.22e-05	9.46e-03	NA	NA
5. P	Q558Y7	Protein costars	3.73e-02	1.36e-02	NA	NA
5. P	P54522	Exodeoxyribonuclease 7 small subunit	2.33e-07	1.64e-25	NA	NA
5. P	Q49YS5	UPF0435 protein SSP0913	4.04e-04	1.31e-04	NA	NA
5. P	Q02SK9	Exodeoxyribonuclease 7 small subunit	6.59e-13	4.02e-27	NA	NA
5. P	C4K1R7	UPF0335 protein RPR_04100	8.74e-07	4.73e-05	NA	NA
5. P	Q8U9H0	UPF0335 protein Atu3758	3.80e-05	2.30e-03	NA	NA
5. P	A4TGW5	UPF0270 protein YPDSF_0104	6.67e-04	7.99e-03	NA	NA
5. P	Q5BDL9	Mitotic-spindle organizing protein 1	2.91e-06	1.93e-02	NA	NA
5. P	A6U1Z4	Exodeoxyribonuclease 7 small subunit	1.67e-15	2.38e-27	NA	NA
5. P	Q98F28	UPF0335 protein mll3968	3.17e-06	1.29e-03	NA	NA
5. P	B7VLC8	UPF0352 protein VS_0950	6.11e-05	6.76e-04	NA	NA
5. P	Q89RW0	Exodeoxyribonuclease 7 small subunit	5.77e-15	4.18e-23	NA	NA
5. P	O06722	Aspartyl-phosphate phosphatase YisI	6.65e-06	7.99e-03	NA	NA
5. P	A4J5G4	Protein Tlp homolog	2.47e-10	3.41e-08	NA	NA
5. P	B7HAY0	Small, acid-soluble spore protein Tlp	6.39e-09	9.34e-04	NA	NA
5. P	P03051	Regulatory protein rop	1.53e-06	3.84e-02	NA	NA
5. P	Q9KNW8	UPF0270 protein VC_2612	5.20e-04	4.74e-03	NA	NA
5. P	A6WY25	UPF0335 protein Oant_1161	3.90e-06	1.60e-03	NA	NA
5. P	Q72RZ8	Exodeoxyribonuclease 7 small subunit	1.63e-09	1.48e-04	NA	NA
5. P	B4EYB8	UPF0181 protein PMI1604	1.00e-03	2.24e-04	NA	NA
5. P	C1CEG9	Exodeoxyribonuclease 7 small subunit	1.46e-11	1.95e-36	NA	NA
5. P	Q0AA37	Exodeoxyribonuclease 7 small subunit	6.12e-10	4.56e-23	NA	NA
5. P	Q92GX4	50S ribosomal protein L29	1.10e-06	1.52e-02	NA	NA
5. P	P69852	DASH complex subunit HSK3	7.65e-05	9.74e-06	NA	NA
5. P	Q8ETS4	Small, acid-soluble spore protein Tlp	1.94e-08	1.01e-04	NA	NA
5. P	C4K6M5	Exodeoxyribonuclease 7 small subunit	1.31e-06	6.15e-14	NA	NA
5. P	Q9A6M3	Exodeoxyribonuclease 7 small subunit	8.14e-14	5.08e-26	NA	NA
5. P	A7ZIH5	Exodeoxyribonuclease 7 small subunit	3.80e-11	1.04e-30	NA	NA
5. P	B9DUT8	Exodeoxyribonuclease 7 small subunit	1.72e-11	7.49e-35	NA	NA
5. P	C1FTL9	UPF0291 protein CLM_2971	3.33e-05	5.14e-08	NA	NA
5. P	A5I540	UPF0291 protein CBO2609/CLC_2481	3.74e-05	9.24e-06	NA	NA
5. P	Q664P4	UPF0270 protein YPTB3725	6.86e-04	1.18e-02	NA	NA
5. P	Q3BV87	Protein SlyX homolog	3.59e-05	1.02e-02	NA	NA
5. P	A1A836	Transcriptional repressor FrmR	1.12e-07	4.51e-02	NA	NA
5. P	A4JLT2	Exodeoxyribonuclease 7 small subunit	2.15e-08	7.45e-13	NA	NA
5. P	A5U1F4	Exodeoxyribonuclease 7 small subunit	1.22e-13	7.47e-08	NA	NA
5. P	Q5PNL7	UPF0181 protein YoaH	1.86e-03	7.24e-05	NA	NA
5. P	Q6D842	Exodeoxyribonuclease 7 small subunit	3.03e-10	1.77e-29	NA	NA
5. P	Q5WF61	Exodeoxyribonuclease 7 small subunit	3.33e-15	2.38e-27	NA	NA
5. P	Q9PQQ2	50S ribosomal protein L29	3.50e-10	5.18e-05	NA	NA
5. P	Q0TH22	UPF0181 protein YoaH	4.57e-03	1.53e-05	NA	NA
5. P	B9JS29	UPF0335 protein Avi_3695	7.25e-05	3.57e-04	NA	NA
5. P	B1LHE8	Protein SlyX	1.44e-04	3.29e-02	NA	NA
5. P	C0Q7U9	Exodeoxyribonuclease 7 small subunit	7.40e-12	3.37e-31	NA	NA
5. P	B7M3R1	Exodeoxyribonuclease 7 small subunit	2.08e-08	1.04e-30	NA	NA
5. P	B5BHD3	UPF0181 protein YoaH	9.26e-03	7.24e-05	NA	NA
5. P	A4TEB6	50S ribosomal protein L29	4.46e-05	3.71e-02	NA	NA
5. P	Q5WG05	UPF0291 protein ABC2165	1.41e-04	1.21e-02	NA	NA
5. P	A7Z2G8	UPF0435 protein RBAM_008100	1.07e-03	2.09e-04	NA	NA
5. P	B0BRW5	Protein SlyX homolog	2.16e-04	3.57e-04	NA	NA
5. P	P60083	UPF0291 protein CTC_01690.1	2.53e-06	1.17e-08	NA	NA
5. P	Q5PEQ5	Transcriptional repressor RcnR	7.40e-06	7.58e-04	NA	NA
5. P	B8HNJ0	DNA-directed RNA polymerase subunit omega	1.32e-04	3.07e-02	NA	NA
5. P	B3E479	Exodeoxyribonuclease 7 small subunit	4.56e-06	1.49e-20	NA	NA
5. P	A1UBP4	50S ribosomal protein L29	7.20e-05	3.59e-02	NA	NA
5. P	P0ACE6	Hemolysin expression-modulating protein Hha	1.98e-03	1.24e-03	NA	NA
5. P	Q7W7Q2	Exodeoxyribonuclease 7 small subunit	3.57e-08	2.18e-16	NA	NA
5. P	A9IQP0	Exodeoxyribonuclease 7 small subunit	2.22e-16	3.02e-24	NA	NA
5. P	P67455	Exodeoxyribonuclease 7 small subunit	5.50e-14	1.64e-25	NA	NA
5. P	Q4QKG4	Exodeoxyribonuclease 7 small subunit	1.21e-12	1.00e-26	NA	NA
5. P	Q6GGH6	Exodeoxyribonuclease 7 small subunit	1.33e-15	1.60e-27	NA	NA
5. P	Q9Z7J5	Uncharacterized protein CPn_0710/CP_0036/CPj0710/CpB0737	1.34e-07	9.21e-03	NA	NA
5. P	A4QBI9	50S ribosomal protein L29	5.88e-05	3.09e-04	NA	NA
5. P	B8ITT7	UPF0335 protein Mnod_5968	4.48e-06	3.94e-04	NA	NA
5. P	Q31R15	Exodeoxyribonuclease 7 small subunit	1.78e-10	1.10e-28	NA	NA
5. P	P64456	Uncharacterized protein YdcY	6.91e-07	5.58e-03	NA	NA
5. P	Q4L6M3	Exodeoxyribonuclease 7 small subunit	5.88e-12	7.89e-31	NA	NA
5. P	A5I308	Exodeoxyribonuclease 7 small subunit	9.10e-15	6.28e-36	NA	NA
5. P	A7GGJ6	UPF0291 protein CLI_2672	3.36e-05	1.33e-07	NA	NA
5. P	A7MKK2	UPF0270 protein ESA_04379	6.06e-04	1.46e-02	NA	NA
5. P	A0QSD9	50S ribosomal protein L29	4.04e-05	1.30e-02	NA	NA
5. P	B7JI37	Small, acid-soluble spore protein Tlp	1.31e-08	3.74e-05	NA	NA
5. P	B0K0U9	Exodeoxyribonuclease 7 small subunit	1.87e-10	5.22e-27	NA	NA
5. P	A4SJQ1	Exodeoxyribonuclease 7 small subunit	3.33e-16	4.16e-24	NA	NA
5. P	B6JFI3	Exodeoxyribonuclease 7 small subunit	7.68e-13	2.45e-22	NA	NA
5. P	Q32B18	Protein SlyX	1.35e-04	3.29e-02	NA	NA
5. P	Q0BPK2	30S ribosomal protein S15	1.16e-04	4.87e-02	NA	NA
5. P	Q9KAK0	Small, acid-soluble spore protein Tlp	6.79e-11	3.46e-06	NA	NA
5. P	B6HZM5	Exodeoxyribonuclease 7 small subunit	4.78e-12	5.52e-30	NA	NA
5. P	Q9X290	Exodeoxyribonuclease 7 small subunit	5.10e-13	1.54e-12	NA	NA
5. P	C3K2Q9	Exodeoxyribonuclease 7 small subunit	1.46e-07	4.67e-27	NA	NA
5. P	P66173	50S ribosomal protein L29	5.82e-07	1.14e-02	NA	NA
5. P	Q3K2M3	Exodeoxyribonuclease 7 small subunit	4.65e-12	1.23e-32	NA	NA
5. P	B3H2N6	Protein SlyX homolog	2.14e-04	3.57e-04	NA	NA
5. P	Q73SA6	50S ribosomal protein L29	2.60e-05	2.75e-02	NA	NA
5. P	P67463	Exodeoxyribonuclease 7 small subunit	6.23e-12	1.23e-32	NA	NA
5. P	A8MF68	UPF0291 protein Clos_1191	3.11e-05	2.11e-03	NA	NA
5. P	Q823U9	Exodeoxyribonuclease 7 small subunit	7.69e-13	2.45e-20	NA	NA
5. P	A9ITB6	Exodeoxyribonuclease 7 small subunit	1.67e-08	1.94e-15	NA	NA
5. P	B4T8R5	Exodeoxyribonuclease 7 small subunit	2.82e-09	3.37e-31	NA	NA
5. P	A8AK32	Exodeoxyribonuclease 7 small subunit	6.19e-09	1.84e-29	NA	NA
5. P	B5YQV2	UPF0181 protein YoaH	7.06e-03	1.53e-05	NA	NA
5. P	Q7N3M2	UPF0181 protein plu2693	5.24e-04	2.52e-04	NA	NA
5. P	Q74CA8	Exodeoxyribonuclease 7 small subunit	1.36e-07	2.31e-24	NA	NA
5. P	Q9L0D2	50S ribosomal protein L29	2.70e-06	2.09e-03	NA	NA
5. P	A5F333	Exodeoxyribonuclease 7 small subunit	3.05e-10	1.34e-28	NA	NA
5. P	P0A8H0	Exodeoxyribonuclease 7 small subunit	7.81e-11	1.04e-30	NA	NA
5. P	Q32E99	Transcriptional repressor RcnR	8.50e-06	3.18e-04	NA	NA
5. P	B8ZQ75	Exodeoxyribonuclease 7 small subunit	1.29e-11	1.95e-36	NA	NA
5. P	B2SQ45	Protein SlyX homolog	4.03e-05	1.32e-03	NA	NA
5. P	Q321V7	UPF0181 protein YoaH	5.59e-03	1.53e-05	NA	NA
5. P	C0R2N9	UPF0335 protein WRi_003770	1.06e-04	8.50e-04	NA	NA
5. P	A3NMF8	Exodeoxyribonuclease 7 small subunit	2.61e-08	1.13e-12	NA	NA
5. P	Q8XFV2	Transcriptional repressor RcnR homolog	7.05e-06	7.58e-04	NA	NA
5. P	Q0ANQ8	50S ribosomal protein L29	6.09e-08	1.18e-02	NA	NA
5. P	Q9UTP3	Inner kinetochore subunit fta6	9.43e-05	2.95e-03	NA	NA
5. P	A8FDR4	Small, acid-soluble spore protein Tlp	3.77e-09	1.28e-04	NA	NA
5. P	Q6GEJ1	50S ribosomal protein L29	5.66e-07	1.14e-02	NA	NA
5. P	P48606	Tubulin-specific chaperone A	1.69e-07	4.63e-02	NA	NA
5. P	Q3BRG7	Exodeoxyribonuclease 7 small subunit	6.86e-07	6.79e-20	NA	NA
5. P	O32073	Uncharacterized protein YtzC	4.91e-04	1.05e-04	NA	NA
5. P	Q8P7L2	Exodeoxyribonuclease 7 small subunit	1.60e-12	3.53e-21	NA	NA
5. P	Q1DRC2	Mitotic-spindle organizing protein 1	1.30e-06	1.85e-02	NA	NA
5. P	B1IPC1	UPF0181 protein YoaH	4.90e-03	1.53e-05	NA	NA
5. P	C0QQP1	50S ribosomal protein L30	1.57e-01	2.44e-02	NA	NA
5. P	Q4ZYU6	Exodeoxyribonuclease 7 small subunit	1.27e-07	6.60e-25	NA	NA
5. P	B2A5M4	UPF0291 protein Nther_1806	4.41e-05	3.93e-05	NA	NA
5. P	B0BBW2	Exodeoxyribonuclease 7 small subunit	1.27e-13	1.28e-20	NA	NA
5. P	Q637L7	Small, acid-soluble spore protein Tlp	1.45e-08	3.74e-05	NA	NA
5. P	A7MX95	UPF0270 protein VIBHAR_00073	3.86e-04	8.83e-04	NA	NA
5. P	Q57687	Uncharacterized protein MJ0235	7.19e-05	1.46e-02	NA	NA
5. P	A1WUG8	N(2)-fixation sustaining protein CowN	1.16e-02	3.15e-02	NA	NA
5. P	Q50HP4	DASH complex subunit dad4	1.32e-05	4.37e-03	NA	NA
5. P	A4IJK6	50S ribosomal protein L30	1.37e-01	1.72e-02	NA	NA
5. P	P0A8H2	Exodeoxyribonuclease 7 small subunit	3.62e-08	1.04e-30	NA	NA
5. P	Q9PQZ3	Uncharacterized protein UU151	1.11e-04	8.43e-05	NA	NA
5. P	Q0TFY7	Transcriptional repressor RcnR	9.82e-06	3.18e-04	NA	NA
5. P	P02431	50S ribosomal protein L30	1.60e-01	3.99e-03	NA	NA
5. P	B9MKH3	50S ribosomal protein L29	4.85e-08	1.59e-02	NA	NA
5. P	C4ZUK3	Protein SlyX	1.44e-04	3.29e-02	NA	NA
5. P	B2SWE7	Exodeoxyribonuclease 7 small subunit	4.90e-07	4.97e-20	NA	NA
5. P	Q4UM15	Exodeoxyribonuclease 7 small subunit	2.13e-13	2.78e-34	NA	NA
5. P	B1ZEG3	UPF0335 protein Mpop_2872	2.31e-04	2.54e-02	NA	NA
5. P	A8F1C1	Exodeoxyribonuclease 7 small subunit	1.33e-12	3.60e-35	NA	NA
5. P	C4XTC8	Exodeoxyribonuclease 7 small subunit	5.97e-07	1.16e-03	NA	NA
5. P	Q52278	Protein KleA	3.52e-05	2.84e-03	NA	NA
5. P	P13306	Uncharacterized 7.2 kDa protein in tk-vs intergenic region	NA	6.38e-03	NA	NA
5. P	Q250M4	50S ribosomal protein L29	1.17e-06	2.61e-02	NA	NA
5. P	Q9CNA0	Exodeoxyribonuclease 7 small subunit	6.70e-12	3.88e-30	NA	NA
5. P	B2I7B1	Exodeoxyribonuclease 7 small subunit	6.93e-13	1.63e-17	NA	NA
5. P	Q1CRC4	Exodeoxyribonuclease 7 small subunit	4.20e-13	7.64e-03	NA	NA
5. P	Q9KQF8	UPF0352 protein VC_2040	1.16e-04	1.47e-02	NA	NA
5. P	Q2P0Q1	Exodeoxyribonuclease 7 small subunit	1.70e-12	4.97e-20	NA	NA
5. P	B2U2V5	Protein SlyX	1.42e-04	3.29e-02	NA	NA
5. P	B1IC08	Exodeoxyribonuclease 7 small subunit	1.52e-11	1.95e-36	NA	NA
5. P	Q7NUK7	Exodeoxyribonuclease 7 small subunit	3.91e-11	3.20e-21	NA	NA
5. P	Q1BLY5	Exodeoxyribonuclease 7 small subunit	4.59e-10	4.89e-12	NA	NA
5. P	Q92IE5	Exodeoxyribonuclease 7 small subunit	2.21e-12	4.11e-34	NA	NA
5. P	B1J027	Exodeoxyribonuclease 7 small subunit	8.60e-09	1.04e-30	NA	NA
5. P	A3Q9J1	Cell division protein ZapB	2.38e-05	4.11e-02	NA	NA
5. P	A3N0M3	UPF0181 protein APL_0863	2.21e-05	3.94e-02	NA	NA
5. P	B7NBF7	UPF0181 protein YoaH	3.44e-04	1.53e-05	NA	NA
5. P	Q8CRV4	UPF0435 protein SE_1565	2.54e-03	8.35e-03	NA	NA
5. P	Q75TB9	Exodeoxyribonuclease 7 small subunit	1.52e-07	1.16e-32	NA	NA
5. P	Q2JT83	Exodeoxyribonuclease 7 small subunit	2.42e-12	2.21e-32	NA	NA
5. P	Q8YW43	Exodeoxyribonuclease 7 small subunit	5.74e-08	1.72e-18	NA	NA
5. P	C0H3Y5	Uncharacterized protein YizC	1.34e-04	4.18e-02	NA	NA
5. P	P66172	50S ribosomal protein L29	6.07e-07	1.14e-02	NA	NA
5. P	Q5L712	50S ribosomal protein L29	3.30e-06	4.14e-03	NA	NA
5. P	Q72CD5	Exodeoxyribonuclease 7 small subunit	3.83e-07	1.65e-23	NA	NA
5. P	C1KVF0	UPF0297 protein Lm4b_01513	2.22e-02	3.81e-02	NA	NA
5. P	A5ILK1	Exodeoxyribonuclease 7 small subunit	2.29e-13	1.54e-12	NA	NA
5. P	A6SUS2	Exodeoxyribonuclease 7 small subunit	1.01e-09	4.58e-20	NA	NA
5. P	Q04KB1	Exodeoxyribonuclease 7 small subunit	1.29e-11	1.95e-36	NA	NA
5. P	Q87BE3	Exodeoxyribonuclease 7 small subunit	3.20e-12	1.63e-17	NA	NA
5. P	P67459	Exodeoxyribonuclease 7 small subunit	6.97e-12	3.37e-31	NA	NA
5. P	Q9RME6	Exodeoxyribonuclease 7 small subunit	0.00e+00	2.20e-28	NA	NA
5. P	P67458	Exodeoxyribonuclease 7 small subunit	6.18e-11	3.37e-31	NA	NA
5. P	P0ACE4	Hemolysin expression-modulating protein Hha	1.90e-03	1.24e-03	NA	NA
5. P	A0AJG3	UPF0435 protein lwe1727	2.23e-02	2.52e-02	NA	NA
5. P	B4EN27	Exodeoxyribonuclease 7 small subunit	5.12e-10	4.89e-12	NA	NA
5. P	C1FPB1	Exodeoxyribonuclease 7 small subunit	1.11e-14	2.51e-33	NA	NA
5. P	C1CKV2	Exodeoxyribonuclease 7 small subunit	1.29e-07	1.95e-36	NA	NA
5. P	A5G3J6	Exodeoxyribonuclease 7 small subunit	1.44e-07	2.27e-23	NA	NA
5. P	A4ZUD8	Uncharacterized protein ORF83	NA	8.09e-05	NA	NA
5. P	Q9CNF2	UPF0181 protein PM0480	1.49e-06	8.83e-04	NA	NA
5. P	Q3E7C1	General transcription and DNA repair factor IIH subunit TFB5	1.15e-02	3.00e-02	NA	NA
5. P	Q8CP39	Exodeoxyribonuclease 7 small subunit	3.11e-15	3.86e-26	NA	NA
5. P	Q0AWH0	Cell division topological specificity factor 2	6.06e-02	2.22e-02	NA	NA
5. P	Q9KA06	UPF0435 protein BH2488	1.85e-03	3.95e-03	NA	NA
5. P	Q1IX80	50S ribosomal protein L29	2.09e-07	8.21e-03	NA	NA
5. P	B5E4U4	Exodeoxyribonuclease 7 small subunit	1.50e-11	1.95e-36	NA	NA
5. P	Q3SG76	Protein SlyX homolog	2.73e-04	1.21e-03	NA	NA
5. P	Q87L25	UPF0270 protein VP2791	3.79e-04	4.14e-04	NA	NA
5. P	P73312	50S ribosomal protein L29	5.36e-06	1.52e-02	NA	NA
5. P	Q5HG78	UPF0291 protein SACOL1376	1.36e-04	3.03e-03	NA	NA
5. P	Q7MH24	UPF0270 protein VV3048	5.30e-04	2.05e-02	NA	NA
5. P	B0RVR1	Protein SlyX homolog	4.01e-05	8.10e-04	NA	NA
5. P	A5VSA3	UPF0335 protein BOV_1691	7.77e-05	2.64e-03	NA	NA
5. P	A5UDB2	UPF0270 protein CGSHiEE_07180	3.31e-05	2.48e-02	NA	NA
5. P	B7NSW4	UPF0181 protein YoaH	4.82e-03	1.53e-05	NA	NA
5. P	C1C7H5	Exodeoxyribonuclease 7 small subunit	1.42e-11	1.95e-36	NA	NA
5. P	Q1C2R7	UPF0270 protein YPA_3293	6.69e-04	7.99e-03	NA	NA
5. P	Q9K1Y4	Exodeoxyribonuclease 7 small subunit	3.69e-11	2.77e-25	NA	NA
5. P	Q9LXG5	Transcription factor PRE2	9.18e-04	2.15e-03	NA	NA
5. P	Q3YWS4	Protein SlyX	1.43e-04	3.29e-02	NA	NA
5. P	A0AYY8	Exodeoxyribonuclease 7 small subunit	1.20e-08	4.89e-12	NA	NA
5. P	Q57SE0	Exodeoxyribonuclease 7 small subunit	6.93e-11	3.37e-31	NA	NA
5. P	B7MBL7	UPF0181 protein YoaH	5.88e-03	1.53e-05	NA	NA
5. P	Q0I544	Protein SlyX homolog	1.67e-04	1.31e-03	NA	NA
5. P	Q5FUB3	Exodeoxyribonuclease 7 small subunit	1.72e-14	1.69e-18	NA	NA
5. P	B2G848	Exodeoxyribonuclease 7 small subunit	1.52e-06	2.38e-03	NA	NA
5. P	Q9HWY5	Exodeoxyribonuclease 7 small subunit	1.89e-07	4.02e-27	NA	NA
5. P	Q0T7G7	Exodeoxyribonuclease 7 small subunit	1.89e-08	1.04e-30	NA	NA
5. P	A4W793	Exodeoxyribonuclease 7 small subunit	1.85e-10	2.32e-29	NA	NA
5. P	Q05HZ7	Protein SlyX homolog	3.63e-05	1.32e-03	NA	NA
5. P	Q6CDG5	DASH complex subunit DAD4	1.12e-06	8.67e-06	NA	NA
5. P	Q1RFI6	Transcriptional repressor FrmR	1.01e-07	4.51e-02	NA	NA
5. P	B7L4M4	Protein SlyX	1.45e-04	3.29e-02	NA	NA
5. P	Q5HM17	50S ribosomal protein L30	1.42e-01	3.07e-02	NA	NA
5. P	P67469	Exodeoxyribonuclease 7 small subunit	1.41e-11	7.49e-35	NA	NA
5. P	A6VP37	Exodeoxyribonuclease 7 small subunit	9.79e-14	6.42e-33	NA	NA
5. P	B3H1K2	UPF0181 protein APP7_0922	4.01e-06	3.94e-02	NA	NA
5. P	B3QFY8	Exodeoxyribonuclease 7 small subunit	6.66e-15	1.15e-22	NA	NA
5. P	C0ZES4	UPF0291 protein BBR47_33060	7.40e-06	1.01e-06	NA	NA
5. P	Q5WUB9	Exodeoxyribonuclease 7 small subunit	2.89e-11	7.47e-24	NA	NA
5. P	P44211	Putative uncharacterized protein HI_1484 in Mu-like prophage FluMu region	3.01e-04	2.85e-02	NA	NA
5. P	Q0TKS6	Transcriptional repressor FrmR	1.03e-07	4.51e-02	NA	NA
5. P	Q1R5T5	Protein SlyX	1.50e-04	3.29e-02	NA	NA
5. P	A8AW36	Exodeoxyribonuclease 7 small subunit	6.04e-12	1.96e-35	NA	NA
5. P	Q6NI38	Exodeoxyribonuclease 7 small subunit	3.59e-12	3.34e-06	NA	NA
5. P	Q7VLU0	Exodeoxyribonuclease 7 small subunit	5.33e-14	3.75e-42	NA	NA
5. P	A6VI47	50S ribosomal protein L18Ae	2.52e-01	4.63e-02	NA	NA
5. P	P66175	50S ribosomal protein L29	5.83e-07	1.14e-02	NA	NA
5. P	B2V4R5	Exodeoxyribonuclease 7 small subunit	1.35e-12	4.15e-29	NA	NA
5. P	B7M285	UPF0181 protein YoaH	5.20e-03	1.53e-05	NA	NA
5. P	Q8DFA5	Exodeoxyribonuclease 7 small subunit	9.31e-13	1.23e-27	NA	NA
5. P	Q0TRN4	UPF0291 protein CPF_1260	2.47e-05	1.04e-03	NA	NA
5. P	A1URW5	Exodeoxyribonuclease 7 small subunit	1.83e-11	1.24e-24	NA	NA
5. P	O31893	SPbeta prophage-derived uncharacterized protein YorV	1.14e-06	1.07e-05	NA	NA
5. P	A5N7J0	Exodeoxyribonuclease 7 small subunit	1.01e-10	1.61e-31	NA	NA
5. P	A8F0L8	UPF0335 protein RMA_0160	1.07e-06	4.73e-05	NA	NA
5. P	A7FWP0	UPF0291 protein CLB_2550	3.71e-05	9.24e-06	NA	NA
5. P	Q88WM6	Exodeoxyribonuclease 7 small subunit	1.03e-07	1.89e-25	NA	NA
5. P	Q4QKG0	UPF0181 protein NTHI1697	5.60e-04	2.87e-02	NA	NA
5. P	A0LW38	Exodeoxyribonuclease 7 small subunit	6.38e-07	2.50e-14	NA	NA
5. P	A5G009	Cell division topological specificity factor	2.37e-01	3.65e-02	NA	NA
5. P	P0A8G9	Exodeoxyribonuclease 7 small subunit	4.62e-08	1.04e-30	NA	NA
5. P	P50841	Uncharacterized protein YptA	1.76e-04	4.57e-06	NA	NA
5. P	C0RF11	UPF0335 protein BMEA_A1804	8.34e-05	2.64e-03	NA	NA
5. P	Q7MMA6	UPF0352 protein VV1166	1.48e-04	1.17e-02	NA	NA
5. P	Q9XJS2	Transcription factor P13	NA	3.84e-07	NA	NA
5. P	P64531	Transcriptional repressor RcnR	8.37e-06	3.18e-04	NA	NA
5. P	A1AWD0	Exodeoxyribonuclease 7 small subunit	1.51e-07	8.80e-26	NA	NA
5. P	Q2GLP1	Exodeoxyribonuclease 7 small subunit	8.69e-12	1.43e-29	NA	NA
5. P	C0M7V3	Exodeoxyribonuclease 7 small subunit	1.39e-12	3.89e-32	NA	NA
5. P	O35041	Uncharacterized protein YfjT	2.81e-04	3.44e-03	NA	NA
5. P	Q57K94	Transcriptional repressor RcnR homolog	7.41e-06	5.91e-04	NA	NA
5. P	P0A8R6	Protein SlyX	1.48e-04	3.29e-02	NA	NA
5. P	Q57NI8	UPF0181 protein YoaH	5.18e-03	7.24e-05	NA	NA
5. P	Q82DN7	50S ribosomal protein L29	2.68e-06	9.25e-04	NA	NA
5. P	Q12LR0	UPF0352 protein Sden_2336	3.62e-04	2.07e-02	NA	NA
5. P	P26486	UPF0437 protein AZC_3451	3.31e-06	1.69e-03	NA	NA
5. P	B5KM66	Synaptonemal complex central element protein 3	1.90e-04	1.74e-03	NA	NA
5. P	Q8YNB4	UPF0337 protein asr4653	1.69e-06	2.73e-02	NA	NA
5. P	Q824P3	50S ribosomal protein L29	2.62e-08	3.79e-04	NA	NA
5. P	O66570	DNA-directed RNA polymerase subunit omega	2.49e-02	1.81e-02	NA	NA
5. P	Q47BJ2	Exodeoxyribonuclease 7 small subunit	8.19e-13	4.25e-23	NA	NA
5. P	P67340	UPF0181 protein YoaH	5.04e-03	1.53e-05	NA	NA
5. P	P64533	Transcriptional repressor RcnR homolog	4.93e-06	3.18e-04	NA	NA
5. P	Q6FY24	Biogenesis of lysosome-related organelles complex 1 subunit CNL1	3.23e-07	7.50e-03	NA	NA
5. P	B0TKD2	Cell division protein ZapB	2.19e-05	2.20e-02	NA	NA
5. P	B2HT44	Exodeoxyribonuclease 7 small subunit	3.01e-13	4.78e-09	NA	NA
5. P	Q3II11	Exodeoxyribonuclease 7 small subunit	1.72e-09	5.65e-36	NA	NA
5. P	Q30Z97	Exodeoxyribonuclease 7 small subunit	4.18e-07	6.50e-22	NA	NA
5. P	Q7N0J8	Exodeoxyribonuclease 7 small subunit	6.20e-08	1.78e-13	NA	NA
5. P	C3PP99	50S ribosomal protein L29	1.16e-06	1.52e-02	NA	NA
5. P	Q6NB75	Exodeoxyribonuclease 7 small subunit	6.11e-15	1.15e-22	NA	NA
5. P	B7N8X5	Exodeoxyribonuclease 7 small subunit	7.46e-08	1.04e-30	NA	NA
5. P	Q253R9	Exodeoxyribonuclease 7 small subunit	1.08e-11	8.61e-24	NA	NA
5. P	B1X6J7	Protein SlyX	1.49e-04	3.29e-02	NA	NA
5. P	Q8CSP4	UPF0291 protein SE_1024	1.72e-04	7.44e-03	NA	NA
5. P	A1KRU1	Exodeoxyribonuclease 7 small subunit	1.35e-08	1.16e-32	NA	NA
5. P	A7FUT9	Exodeoxyribonuclease 7 small subunit	5.55e-15	6.28e-36	NA	NA
5. P	C1L2R8	Exodeoxyribonuclease 7 small subunit	1.22e-12	5.60e-34	NA	NA
5. P	Q8KAE9	Exodeoxyribonuclease 7 small subunit	1.40e-11	2.89e-12	NA	NA
5. P	Q8D204	50S ribosomal protein L29	1.76e-06	3.13e-02	NA	NA
5. P	B0BUQ2	50S ribosomal protein L29	1.04e-06	1.52e-02	NA	NA
5. P	B3PS72	Exodeoxyribonuclease 7 small subunit	2.22e-16	1.54e-23	NA	NA
5. P	Q8EQ45	Exodeoxyribonuclease 7 small subunit	1.44e-11	9.83e-28	NA	NA
5. P	B2IPS4	Exodeoxyribonuclease 7 small subunit	1.71e-12	1.95e-36	NA	NA
5. P	Q0BAM0	Exodeoxyribonuclease 7 small subunit	2.23e-09	4.63e-12	NA	NA
5. P	Q01246	Putative Yop proteins translocation protein E	3.79e-08	9.22e-05	NA	NA
5. P	Q92RI9	Exodeoxyribonuclease 7 small subunit	4.66e-14	2.19e-25	NA	NA
5. P	P0A2M4	UPF0181 protein YoaH	7.03e-03	7.24e-05	NA	NA
5. P	O31959	SPbeta prophage-derived uncharacterized protein YomY	6.82e-04	1.07e-03	NA	NA
5. P	Q9PCZ7	Protein SlyX homolog	2.91e-05	1.98e-02	NA	NA
5. P	B5R2U7	UPF0181 protein YoaH	3.46e-04	7.24e-05	NA	NA
5. P	Q6CKH5	DASH complex subunit DAD3	4.88e-09	1.11e-06	NA	NA
5. P	B4U1W8	Exodeoxyribonuclease 7 small subunit	1.48e-11	1.07e-32	NA	NA
5. P	P64754	Uncharacterized protein Mb0922c	2.26e-07	1.60e-05	NA	NA
5. P	B2KAR1	Exodeoxyribonuclease 7 small subunit	1.43e-13	5.36e-32	NA	NA
5. P	Q7P0W0	Protein SlyX homolog	2.15e-04	1.71e-02	NA	NA
5. P	B1AIM8	50S ribosomal protein L29	3.24e-10	5.18e-05	NA	NA
5. P	A0JYU5	Exodeoxyribonuclease 7 small subunit	7.32e-11	1.20e-19	NA	NA
5. P	B4TMA4	Exodeoxyribonuclease 7 small subunit	3.20e-11	3.37e-31	NA	NA
5. P	B9E102	Exodeoxyribonuclease 7 small subunit	8.03e-11	1.61e-31	NA	NA
5. P	P55420	Probable conjugal transfer protein TraD	7.55e-06	3.26e-02	NA	NA
5. P	C0MD33	Exodeoxyribonuclease 7 small subunit	3.05e-11	1.07e-32	NA	NA
5. P	Q2KBQ9	Exodeoxyribonuclease 7 small subunit	3.19e-08	8.80e-25	NA	NA
5. P	B4SUL6	UPF0181 protein YoaH	5.53e-03	7.24e-05	NA	NA
5. P	B9DM39	50S ribosomal protein L29	5.89e-07	1.14e-02	NA	NA
5. P	Q32FR8	UPF0181 protein YoaH	5.12e-03	1.53e-05	NA	NA
5. P	A8AQQ4	UPF0270 protein CKO_04772	4.71e-04	8.86e-05	NA	NA
5. P	C5BCI1	Exodeoxyribonuclease 7 small subunit	1.00e-09	2.56e-28	NA	NA
5. P	Q3Z0A5	Transcriptional repressor RcnR	8.64e-06	3.18e-04	NA	NA
5. P	Q1MBX8	UPF0335 protein RL4065	6.90e-05	7.36e-04	NA	NA
5. P	A7Z571	Small, acid-soluble spore protein Tlp	6.54e-09	7.47e-05	NA	NA
5. P	O07919	Spore coat protein F-like protein YraG	1.30e-04	2.16e-02	NA	NA
5. P	A2RLU3	Exodeoxyribonuclease 7 small subunit	2.89e-10	3.86e-26	NA	NA
5. P	Q3SUZ0	Exodeoxyribonuclease 7 small subunit	3.34e-12	2.36e-24	NA	NA
5. P	P64458	Uncharacterized protein YdcY	6.35e-07	5.58e-03	NA	NA
5. P	C1DDV7	Protein SlyX homolog	2.49e-05	7.57e-03	NA	NA
5. P	B0KTK1	Protein SlyX homolog	1.26e-05	4.63e-02	NA	NA
5. P	A6X972	EKC/KEOPS complex subunit gon7	9.75e-05	8.43e-03	NA	NA
5. P	P67464	Exodeoxyribonuclease 7 small subunit	5.70e-12	1.23e-32	NA	NA
5. P	C3MIM2	UPF0335 protein NGR_c28390	9.42e-08	2.64e-03	NA	NA
5. P	B9JSL3	Exodeoxyribonuclease 7 small subunit	0.00e+00	2.23e-23	NA	NA
5. P	Q5PFR8	Exodeoxyribonuclease 7 small subunit	1.83e-11	3.37e-31	NA	NA
5. P	B9JRA5	Cell division topological specificity factor	2.06e-01	3.47e-04	NA	NA
5. P	Q0SZW9	Protein SlyX	1.44e-04	3.29e-02	NA	NA
5. P	B0JHZ5	50S ribosomal protein L29	3.34e-06	1.02e-04	NA	NA
5. P	A8GQT4	UPF0335 protein A1G_00885	8.51e-07	5.62e-05	NA	NA
5. P	Q1RFB8	Exodeoxyribonuclease 7 small subunit	1.71e-08	1.04e-30	NA	NA
5. P	A0QL10	50S ribosomal protein L29	2.51e-05	2.75e-02	NA	NA
5. P	Q48SM9	Exodeoxyribonuclease 7 small subunit	1.65e-11	7.49e-35	NA	NA
5. P	Q5M3Z2	Exodeoxyribonuclease 7 small subunit	7.66e-12	2.08e-32	NA	NA
5. P	Q57800	Uncharacterized protein MJ0354	1.10e-05	1.65e-05	NA	NA
5. P	Q9A385	UPF0335 protein CC_3319	3.11e-06	2.13e-04	NA	NA
5. P	Q92JB4	UPF0335 protein RC0153	1.95e-06	4.73e-05	NA	NA
5. P	Q9ZDH8	Exodeoxyribonuclease 7 small subunit	2.40e-12	1.76e-34	NA	NA
5. P	Q04TB2	Exodeoxyribonuclease 7 small subunit	1.63e-11	3.85e-05	NA	NA
5. P	Q9T1X4	Uncharacterized protein gp15	NA	9.51e-05	NA	NA
5. P	Q5YQ91	Exodeoxyribonuclease 7 small subunit	3.54e-11	2.52e-17	NA	NA
5. P	Q03FU2	UPF0291 protein PEPE_0871	6.83e-05	1.25e-02	NA	NA
5. P	A7ZSM3	Protein SlyX	1.48e-04	3.18e-02	NA	NA
5. P	Q4UT42	Protein SlyX homolog	4.19e-05	8.10e-04	NA	NA
5. P	Q83E63	Exodeoxyribonuclease 7 small subunit	3.91e-10	1.95e-26	NA	NA
5. P	P0ACE3	Hemolysin expression-modulating protein Hha	1.94e-03	1.24e-03	NA	NA
5. P	Q2IRL8	Exodeoxyribonuclease 7 small subunit	3.40e-14	1.18e-23	NA	NA
5. P	Q4L7J0	UPF0435 protein SH1076	1.70e-03	3.07e-02	NA	NA
5. P	A4XRR1	Protein SlyX homolog	1.09e-04	4.87e-04	NA	NA
5. P	Q9PLQ8	Uncharacterized protein TC_0037	5.22e-08	9.60e-05	NA	NA
5. P	Q11CY7	UPF0335 protein Meso_3367	4.71e-04	6.86e-03	NA	NA
5. P	B5YTQ5	Protein SlyX	1.46e-04	3.29e-02	NA	NA
5. P	A8GAP4	Exodeoxyribonuclease 7 small subunit	2.36e-13	1.09e-22	NA	NA
5. P	Q1CCR5	UPF0270 protein YPN_3888	6.04e-04	7.99e-03	NA	NA
5. P	A7X5F2	50S ribosomal protein L29	5.80e-07	1.14e-02	NA	NA
5. P	P67460	Exodeoxyribonuclease 7 small subunit	1.11e-15	2.38e-27	NA	NA
5. P	A8GT61	50S ribosomal protein L29	1.12e-06	1.52e-02	NA	NA
5. P	Q71ZG7	UPF0297 protein LMOf2365_1522	7.30e-03	3.81e-02	NA	NA
5. P	Q67JV1	50S ribosomal protein L29	8.52e-07	4.47e-04	NA	NA
5. P	B1W3Z9	50S ribosomal protein L29	2.65e-06	9.43e-04	NA	NA
5. P	Q3SN92	Protein SlyX homolog	3.56e-05	3.74e-02	NA	NA
5. P	A0A384E126	1-carboxybiuret hydrolase subunit AtzG	8.61e-05	6.50e-03	NA	NA
5. P	Q044H8	Exodeoxyribonuclease 7 small subunit	2.45e-11	3.64e-20	NA	NA
5. P	Q7VM62	UPF0181 protein HD_1137	3.18e-06	1.94e-03	NA	NA
5. P	Q5XB26	Exodeoxyribonuclease 7 small subunit	2.00e-11	7.49e-35	NA	NA
5. P	Q3MGJ7	Exodeoxyribonuclease 7 small subunit	3.02e-11	1.21e-17	NA	NA
5. P	Q5N384	Exodeoxyribonuclease 7 small subunit	1.95e-10	1.10e-28	NA	NA
5. P	Q8L1H9	Exodeoxyribonuclease 7 small subunit	3.33e-16	4.98e-28	NA	NA
5. P	B1Z1G0	Exodeoxyribonuclease 7 small subunit	9.50e-09	4.63e-12	NA	NA
5. P	C3L195	UPF0291 protein CLJ_B2839	2.65e-05	8.67e-06	NA	NA
5. P	Q754U2	DASH complex subunit DAD3	1.59e-07	4.44e-07	NA	NA
5. P	P73891	Phycobilisome degradation protein NblA homolog 1	1.37e-04	1.80e-03	NA	NA
5. P	P67462	Exodeoxyribonuclease 7 small subunit	7.77e-16	2.38e-27	NA	NA
5. P	P07114	Mobilization protein C	1.34e-04	1.59e-02	NA	NA
5. P	Q9CA64	Transcription factor PRE3	4.03e-04	1.90e-02	NA	NA
5. P	B7L6T9	UPF0181 protein YoaH	5.68e-03	1.53e-05	NA	NA
5. P	B1HMX2	50S ribosomal protein L29	9.97e-07	1.95e-02	NA	NA
5. P	C5D3T5	50S ribosomal protein L30	1.55e-01	4.21e-02	NA	NA
5. P	C3LTC2	UPF0253 protein VCM66_0829	9.21e-04	5.47e-04	NA	NA
5. P	Q3ITD6	50S ribosomal protein L31e	2.29e-01	1.70e-04	NA	NA
5. P	Q8D866	UPF0352 protein VV1_3121	1.48e-04	2.70e-02	NA	NA
5. P	P0A1T4	Fumarase D	4.66e-04	4.18e-02	NA	NA
5. P	Q889P9	Exodeoxyribonuclease 7 small subunit	1.00e-12	1.08e-25	NA	NA
5. P	C6DB39	Exodeoxyribonuclease 7 small subunit	1.95e-07	3.29e-29	NA	NA
5. P	B7VJ99	Exodeoxyribonuclease 7 small subunit	2.55e-15	4.63e-33	NA	NA
5. P	A9ANA4	Exodeoxyribonuclease 7 small subunit	5.27e-10	2.66e-12	NA	NA
5. P	A0RH02	Small, acid-soluble spore protein Tlp	1.35e-08	3.74e-05	NA	NA
5. P	Q080H8	UPF0352 protein Sfri_2492	3.68e-04	5.99e-03	NA	NA
5. P	Q63ZV7	DNA repair protein SWI5 homolog	1.15e-05	1.52e-05	NA	NA
5. P	C5BGV9	UPF0181 protein NT01EI_1861	4.17e-04	1.84e-03	NA	NA
5. P	Q4UWI8	Exodeoxyribonuclease 7 small subunit	3.37e-12	3.53e-21	NA	NA
5. P	O26016	Exodeoxyribonuclease 7 small subunit	3.15e-08	2.61e-03	NA	NA
5. P	A2RDN1	Exodeoxyribonuclease 7 small subunit	2.32e-11	7.49e-35	NA	NA
5. P	A5UEV4	Exodeoxyribonuclease 7 small subunit	3.35e-14	9.62e-31	NA	NA
5. P	A7MKF0	UPF0181 protein ESA_01442	6.57e-03	9.90e-05	NA	NA
5. P	P44954	UPF0270 protein HI_0956	2.96e-05	2.48e-02	NA	NA
5. P	P44759	Protein SlyX homolog	2.95e-05	3.24e-02	NA	NA
5. P	Q0SS03	Exodeoxyribonuclease 7 small subunit	4.60e-13	4.45e-31	NA	NA
5. P	B7NJ75	Exodeoxyribonuclease 7 small subunit	1.03e-08	1.04e-30	NA	NA
5. P	P39252	Uncharacterized 9.4 kDa protein in nrdC-mobD intergenic region	NA	7.93e-05	NA	NA
5. P	A7EXZ2	Mitotic-spindle organizing protein 1	1.67e-06	3.61e-04	NA	NA
5. P	Q5HP30	Exodeoxyribonuclease 7 small subunit	1.33e-15	3.86e-26	NA	NA
5. P	B9IUC0	Small, acid-soluble spore protein Tlp	1.32e-08	3.74e-05	NA	NA
5. P	P50832	Uncharacterized protein YppD	1.08e-06	1.03e-04	NA	NA
5. P	A2S0N4	Exodeoxyribonuclease 7 small subunit	1.99e-08	1.13e-12	NA	NA
5. P	Q8XLN8	UPF0291 protein CPE1003	1.12e-05	1.04e-03	NA	NA
5. P	B9M0X4	Exodeoxyribonuclease 7 small subunit	3.07e-10	5.82e-25	NA	NA
5. P	A8Z349	50S ribosomal protein L29	6.12e-07	1.14e-02	NA	NA
5. P	C4K2Q1	Exodeoxyribonuclease 7 small subunit	2.43e-12	4.11e-34	NA	NA
5. P	P75992	Probable two-component-system connector protein YmgA	1.40e-04	7.11e-03	NA	NA
5. P	Q733N0	Small, acid-soluble spore protein Tlp	1.43e-08	3.74e-05	NA	NA
5. P	Q6G943	Exodeoxyribonuclease 7 small subunit	9.99e-16	2.38e-27	NA	NA
5. P	B8DE07	UPF0297 protein LMHCC_1066	2.33e-02	3.81e-02	NA	NA
5. P	A7ZNS4	Transcriptional repressor RcnR homolog	8.04e-06	3.18e-04	NA	NA
5. P	Q0SU12	UPF0291 protein CPR_1073	3.79e-07	1.04e-03	NA	NA
5. P	A4YMG9	UPF0335 protein BRADO1188	6.31e-05	2.79e-03	NA	NA
5. P	Q2P425	Protein SlyX homolog	3.90e-05	1.32e-03	NA	NA
5. P	Q8KAI0	50S ribosomal protein L29	4.16e-07	1.89e-03	NA	NA
5. P	Q60AM9	Exodeoxyribonuclease 7 small subunit	8.58e-10	2.81e-28	NA	NA
5. P	A1KHP7	Exodeoxyribonuclease 7 small subunit	3.32e-12	7.47e-08	NA	NA
5. P	Q81AG2	Small, acid-soluble spore protein Tlp	8.88e-09	9.34e-04	NA	NA
5. P	B1YE74	UPF0291 protein Exig_1097	1.17e-04	3.65e-02	NA	NA
5. P	Q985Y6	Exodeoxyribonuclease 7 small subunit	1.89e-15	8.61e-24	NA	NA
5. P	Q03VS7	Exodeoxyribonuclease 7 small subunit	2.83e-10	1.52e-27	NA	NA
5. P	Q04G77	50S ribosomal protein L29	1.02e-06	7.57e-03	NA	NA
5. P	Q2YYB9	Exodeoxyribonuclease 7 small subunit	6.66e-16	2.38e-27	NA	NA
5. P	A0QC35	Exodeoxyribonuclease 7 small subunit	2.16e-13	2.28e-10	NA	NA
5. P	B8GN64	Exodeoxyribonuclease 7 small subunit	1.63e-12	2.65e-21	NA	NA
5. P	Q8ZJD4	UPF0270 protein YPO0179/y3960/YP_0178	6.95e-04	7.99e-03	NA	NA
5. P	Q9FLE9	Transcription factor PRE1	1.95e-04	1.46e-03	NA	NA
5. P	P0AAP4	Transcriptional repressor FrmR	1.08e-07	4.51e-02	NA	NA
5. P	C3L9C5	Small, acid-soluble spore protein Tlp	1.32e-08	3.74e-05	NA	NA
5. P	A6S6H9	Mitotic-spindle organizing protein 1	6.59e-05	9.51e-05	NA	NA
5. P	Q9K1A5	Exodeoxyribonuclease 7 small subunit	1.34e-09	4.63e-33	NA	NA
5. P	Q73WH3	Exodeoxyribonuclease 7 small subunit	2.45e-13	2.28e-10	NA	NA
5. P	Q9FBM4	Exodeoxyribonuclease 7 small subunit	7.82e-10	4.19e-17	NA	NA
5. P	Q38W55	UPF0291 protein LCA_1274	9.08e-05	8.02e-04	NA	NA
5. P	A0L6H5	Exodeoxyribonuclease 7 small subunit	2.38e-07	9.52e-30	NA	NA
5. P	O21880	Chaperone protein gp12	NA	4.29e-02	NA	NA
5. P	Q0TKL9	Exodeoxyribonuclease 7 small subunit	1.54e-08	9.03e-32	NA	NA
5. P	B0BPE7	UPF0181 protein APJL_0874	2.89e-06	3.94e-02	NA	NA
5. P	Q2JQ26	Exodeoxyribonuclease 7 small subunit	1.08e-13	7.59e-31	NA	NA
5. P	A8GWU6	Exodeoxyribonuclease 7 small subunit	1.43e-12	3.48e-33	NA	NA
5. P	A9MM40	Exodeoxyribonuclease 7 small subunit	8.72e-11	3.37e-31	NA	NA
5. P	A6T7Z3	UPF0509 protein KPN78578_12530	3.11e-05	4.32e-02	NA	NA
5. P	Q1AU47	50S ribosomal protein L30	1.41e-01	1.63e-02	NA	NA
5. P	A8GN45	Exodeoxyribonuclease 7 small subunit	2.98e-13	2.55e-34	NA	NA
5. P	B9JAL9	Exodeoxyribonuclease 7 small subunit	3.31e-08	3.20e-21	NA	NA
5. P	C5C0V6	Exodeoxyribonuclease 7 small subunit	6.23e-10	4.58e-20	NA	NA
5. P	A3P7W6	Exodeoxyribonuclease 7 small subunit	3.75e-08	1.13e-12	NA	NA
5. P	P67339	UPF0181 protein YoaH	5.27e-03	1.53e-05	NA	NA
5. P	A9MVU3	UPF0181 protein YoaH	5.79e-03	7.24e-05	NA	NA
5. P	Q45060	Small, acid-soluble spore protein Tlp	2.48e-08	4.73e-04	NA	NA
5. P	B2U932	Exodeoxyribonuclease 7 small subunit	1.33e-09	2.25e-10	NA	NA
5. P	B2IWI8	Exodeoxyribonuclease 7 small subunit	2.67e-13	2.29e-11	NA	NA
5. P	C3KXC5	Exodeoxyribonuclease 7 small subunit	8.18e-13	1.80e-34	NA	NA
5. P	B6J8G8	Exodeoxyribonuclease 7 small subunit	4.02e-08	1.95e-26	NA	NA
5. P	Q5L6H2	Exodeoxyribonuclease 7 small subunit	2.07e-11	8.64e-25	NA	NA
5. P	Q39UA9	Exodeoxyribonuclease 7 small subunit	2.57e-06	1.35e-24	NA	NA
5. P	P60078	UPF0291 protein MW1228	1.24e-04	3.03e-03	NA	NA
5. P	A2RIE7	PTS system galactose-specific EIIA component	1.43e-04	2.12e-02	NA	NA
5. P	Q4UMS1	50S ribosomal protein L29	1.01e-06	2.66e-02	NA	NA
5. P	Q9PK64	Exodeoxyribonuclease 7 small subunit	6.69e-14	4.11e-21	NA	NA
5. P	A0AIG3	Exodeoxyribonuclease 7 small subunit	1.34e-12	2.58e-35	NA	NA
5. P	C3P449	Small, acid-soluble spore protein Tlp	1.29e-08	3.74e-05	NA	NA
5. P	Q6MDK5	Exodeoxyribonuclease 7 small subunit	9.57e-08	8.08e-16	NA	NA
5. P	A7GEJ6	Exodeoxyribonuclease 7 small subunit	1.57e-14	2.51e-33	NA	NA
5. P	B2U4M5	Exodeoxyribonuclease 7 small subunit	1.05e-08	1.04e-30	NA	NA
5. P	B0T3Y0	Exodeoxyribonuclease 7 small subunit	1.67e-15	5.79e-28	NA	NA
5. P	Q2FY47	Exodeoxyribonuclease 7 small subunit	7.57e-10	2.38e-27	NA	NA
5. P	A1UYQ2	Exodeoxyribonuclease 7 small subunit	2.03e-08	1.13e-12	NA	NA
5. P	B8IZD4	Exodeoxyribonuclease 7 small subunit	1.24e-07	1.04e-05	NA	NA
5. P	Q9K968	Exodeoxyribonuclease 7 small subunit	5.04e-13	9.83e-28	NA	NA
5. P	B5EI11	Exodeoxyribonuclease 7 small subunit	1.87e-07	1.14e-23	NA	NA
5. P	C3PME9	UPF0335 protein RAF_ORF0142	7.99e-07	4.73e-05	NA	NA
5. P	Q57BC9	UPF0335 protein BruAb1_1737	4.05e-05	2.64e-03	NA	NA
5. P	P67467	Exodeoxyribonuclease 7 small subunit	2.17e-11	7.49e-35	NA	NA
5. P	P60357	UPF0297 protein lmo1503	1.67e-02	3.81e-02	NA	NA
5. P	P66174	50S ribosomal protein L29	5.85e-07	1.14e-02	NA	NA
5. P	Q9ZJD7	Exodeoxyribonuclease 7 small subunit	3.09e-08	2.13e-03	NA	NA
5. P	P13964	Protein KleA	3.37e-05	3.11e-03	NA	NA
5. P	B1IPB7	Protein SlyX	1.43e-04	3.29e-02	NA	NA
5. P	Q20ZD1	UPF0335 protein RPC_3979	9.10e-05	8.97e-03	NA	NA
5. P	Q8K3D3	DNA repair protein SWI5 homolog	1.43e-05	7.17e-05	NA	NA
5. P	Q5HPK0	UPF0291 protein SERP0911	1.33e-04	7.44e-03	NA	NA
5. P	B9MA02	Cell division topological specificity factor	2.38e-01	2.20e-02	NA	NA
5. P	B1KYP3	Protein Tlp homolog	7.26e-09	3.53e-02	NA	NA
5. P	Q6G0D5	Exodeoxyribonuclease 7 small subunit	2.50e-11	7.84e-22	NA	NA
5. P	Q46GA2	50S ribosomal protein L29	4.40e-05	2.24e-02	NA	NA
5. P	Q1QT72	Cell division protein ZapB	5.94e-06	4.91e-02	NA	NA
5. P	P0DH52	Exodeoxyribonuclease 7 small subunit	2.02e-11	7.49e-35	NA	NA
5. P	A5ERF9	UPF0335 protein BBta_6866	6.51e-05	2.79e-03	NA	NA
5. P	C1CR92	Exodeoxyribonuclease 7 small subunit	1.38e-07	1.95e-36	NA	NA
5. P	P0DH53	Exodeoxyribonuclease 7 small subunit	2.59e-11	7.49e-35	NA	NA
5. P	A9M7P7	UPF0335 protein BCAN_A1790	7.83e-05	1.64e-03	NA	NA
5. P	A7ZX05	Transcriptional repressor FrmR	1.00e-07	4.51e-02	NA	NA
5. P	B5R6S5	Exodeoxyribonuclease 7 small subunit	2.28e-10	3.37e-31	NA	NA
5. P	C3PFD4	Exodeoxyribonuclease 7 small subunit	1.02e-11	2.55e-11	NA	NA
5. P	B7NDV6	Protein SlyX	1.43e-04	3.77e-02	NA	NA
5. P	C0Q311	UPF0181 protein YoaH	4.88e-03	7.24e-05	NA	NA
5. P	A5F359	UPF0253 protein VC0395_A0398/VC395_0888	9.08e-04	5.47e-04	NA	NA
5. P	B3PF20	Exodeoxyribonuclease 7 small subunit	1.33e-13	1.35e-27	NA	NA
5. P	Q24V01	Exodeoxyribonuclease 7 small subunit	4.63e-06	2.96e-22	NA	NA
5. P	P0A2M3	UPF0181 protein YoaH	6.04e-03	7.24e-05	NA	NA
5. P	O34498	SPbeta prophage-derived uncharacterized protein YopT	1.48e-01	4.55e-02	NA	NA
5. P	P9WF29	Exodeoxyribonuclease 7 small subunit	2.96e-12	7.47e-08	NA	NA
5. P	A8Z462	Exodeoxyribonuclease 7 small subunit	1.89e-15	2.38e-27	NA	NA
5. P	Q051N4	Exodeoxyribonuclease 7 small subunit	1.78e-11	3.85e-05	NA	NA
5. P	B8G1X4	50S ribosomal protein L29	1.16e-06	9.30e-03	NA	NA
5. P	B2VHS1	Exodeoxyribonuclease 7 small subunit	5.96e-07	4.75e-29	NA	NA
5. P	A6U3W7	50S ribosomal protein L29	5.94e-07	1.14e-02	NA	NA
5. P	Q82IE6	Exodeoxyribonuclease 7 small subunit	7.91e-10	1.15e-18	NA	NA
5. P	P21320	DinI-like protein in retron EC67	3.27e-02	6.08e-04	NA	NA
5. P	A1ARP1	Exodeoxyribonuclease 7 small subunit	1.66e-07	2.58e-24	NA	NA
5. P	Q9CK59	Uncharacterized protein PM1775	8.27e-07	1.31e-02	NA	NA
5. P	B7MCW3	Protein SlyX	1.40e-04	3.29e-02	NA	NA
5. P	C3L3A3	Protein Tlp homolog	3.14e-09	3.53e-02	NA	NA
5. P	P05043	Aspartyl-phosphate phosphatase Spo0E	5.17e-04	1.06e-03	NA	NA
5. P	Q3K662	Exodeoxyribonuclease 7 small subunit	3.40e-13	4.52e-25	NA	NA
5. P	Q7VV85	Exodeoxyribonuclease 7 small subunit	1.44e-07	2.18e-16	NA	NA
5. P	A8GPE2	50S ribosomal protein L29	8.77e-07	1.02e-02	NA	NA
5. P	Q2W369	Exodeoxyribonuclease 7 small subunit	1.12e-09	2.15e-24	NA	NA
5. P	B0B7P7	Exodeoxyribonuclease 7 small subunit	1.49e-13	1.28e-20	NA	NA
5. P	P0C7I3	Transcriptional repressor RcnR	9.57e-06	3.18e-04	NA	NA
5. P	B1HRX6	Exodeoxyribonuclease 7 small subunit	1.19e-12	3.20e-25	NA	NA
5. P	Q9ZCR3	50S ribosomal protein L29	1.01e-06	2.66e-02	NA	NA
5. P	C3LNZ1	UPF0352 protein VCM66_1964	1.07e-04	1.47e-02	NA	NA
5. P	C1EN48	Small, acid-soluble spore protein Tlp	1.47e-08	3.74e-05	NA	NA
5. P	C1AMA1	Exodeoxyribonuclease 7 small subunit	1.18e-13	7.47e-08	NA	NA
5. P	A5UC49	Exodeoxyribonuclease 7 small subunit	7.17e-14	3.59e-27	NA	NA
5. P	A0Q0A2	Exodeoxyribonuclease 7 small subunit	6.15e-13	9.99e-36	NA	NA
5. P	O28043	Uncharacterized protein AF_2240	1.15e-08	2.45e-03	NA	NA
5. P	A5D2Z3	Exodeoxyribonuclease 7 small subunit	4.43e-11	3.47e-10	NA	NA
5. P	P9WKP5	Uncharacterized protein Rv0898c	2.26e-07	1.60e-05	NA	NA
5. P	Q1JG31	Exodeoxyribonuclease 7 small subunit	1.77e-11	7.49e-35	NA	NA
5. P	Q6ADU8	Exodeoxyribonuclease 7 small subunit	4.52e-12	1.14e-04	NA	NA
5. P	Q3STZ0	UPF0335 protein Nwi_0989	4.96e-06	1.41e-02	NA	NA
5. P	B0BX65	Exodeoxyribonuclease 7 small subunit	3.08e-12	4.11e-34	NA	NA
5. P	Q5HFP9	Exodeoxyribonuclease 7 small subunit	8.45e-10	2.38e-27	NA	NA
5. P	P67454	Exodeoxyribonuclease 7 small subunit	2.42e-11	1.64e-25	NA	NA
5. P	B0S1L9	Exodeoxyribonuclease 7 small subunit	2.46e-07	1.54e-22	NA	NA
5. P	Q1JL06	Exodeoxyribonuclease 7 small subunit	1.78e-11	7.49e-35	NA	NA
5. P	Q1GCG2	Exodeoxyribonuclease 7 small subunit	2.92e-09	6.29e-27	NA	NA
5. P	B5FTL0	UPF0181 protein YoaH	5.52e-03	7.24e-05	NA	NA
5. P	Q54U55	Putative uncharacterized protein DDB_G0281267	9.87e-04	5.73e-03	NA	NA
5. P	P10309	DNA maturase A	NA	9.38e-03	NA	NA
5. P	A7FNR1	UPF0270 protein YpsIP31758_3941	6.90e-04	1.18e-02	NA	NA
5. P	B2UMV0	Exodeoxyribonuclease 7 small subunit	1.76e-13	2.74e-16	NA	NA
5. P	Q9KTL1	Exodeoxyribonuclease 7 small subunit	6.26e-11	1.34e-28	NA	NA
5. P	Q32B11	UPF0270 protein YheU	4.90e-04	1.51e-02	NA	NA
5. P	Q5LZE0	Exodeoxyribonuclease 7 small subunit	5.79e-12	2.08e-32	NA	NA
5. P	Q6AJQ3	Exodeoxyribonuclease 7 small subunit	3.50e-12	1.49e-27	NA	NA
5. P	Q8WHX2	30S ribosomal protein S15, chloroplastic	1.60e-03	3.13e-02	NA	NA
5. P	P0ACE5	Hemolysin expression-modulating protein Hha	1.93e-03	1.24e-03	NA	NA
5. P	P69850	DASH complex subunit DAD3	2.63e-05	2.67e-04	NA	NA
5. P	Q6CZV1	Protein SlyX	3.57e-05	4.14e-02	NA	NA
5. P	B4TKF5	UPF0181 protein YoaH	5.45e-03	7.24e-05	NA	NA
5. P	A4XBN8	50S ribosomal protein L29	3.30e-06	2.57e-02	NA	NA
5. P	Q0TPD6	Exodeoxyribonuclease 7 small subunit	7.58e-09	4.45e-31	NA	NA
5. P	Q2NV92	Exodeoxyribonuclease 7 small subunit	9.16e-08	4.05e-25	NA	NA
5. P	C3LRS3	UPF0270 protein VCM66_2532	5.09e-04	4.74e-03	NA	NA
5. P	P10971	50S ribosomal protein L29	1.04e-04	3.35e-02	NA	NA
5. P	Q18CH8	50S ribosomal protein L30	1.65e-01	3.53e-02	NA	NA
5. P	A1K4R2	Exodeoxyribonuclease 7 small subunit	7.55e-08	1.57e-21	NA	NA
5. P	A4SP90	UPF0352 protein ASA_2693	1.03e-04	5.29e-05	NA	NA
5. P	Q9ZE35	UPF0335 protein RP113	6.58e-08	5.45e-05	NA	NA
5. P	Q74IM2	Exodeoxyribonuclease 7 small subunit	6.73e-07	4.22e-20	NA	NA
5. P	B5QTH2	Exodeoxyribonuclease 7 small subunit	3.45e-08	3.37e-31	NA	NA
5. P	Q07SR2	Exodeoxyribonuclease 7 small subunit	1.02e-13	5.27e-26	NA	NA
5. P	Q0T504	UPF0181 protein YoaH	1.72e-03	9.34e-06	NA	NA
5. P	A7ZMT4	UPF0181 protein YoaH	5.53e-03	1.53e-05	NA	NA
5. P	Q5E739	UPF0253 protein VF_0662	9.24e-04	2.48e-02	NA	NA
5. P	O19907	Putative DNA-directed RNA polymerase subunit omega	3.23e-03	3.10e-02	NA	NA
5. P	A6TR39	Exodeoxyribonuclease 7 small subunit	1.40e-13	2.40e-25	NA	NA
5. P	Q3K7V1	Protein SlyX homolog	5.06e-05	2.92e-03	NA	NA
5. P	A6U6S1	Exodeoxyribonuclease 7 small subunit	1.11e-15	3.20e-25	NA	NA
5. P	Q8PIY4	Exodeoxyribonuclease 7 small subunit	4.10e-12	3.25e-21	NA	NA
5. P	O07434	Copper-sensing transcriptional repressor RicR	7.90e-07	4.14e-02	NA	NA
5. P	Q62DU3	Exodeoxyribonuclease 7 small subunit	1.83e-10	1.13e-12	NA	NA
5. P	A3CLQ8	Exodeoxyribonuclease 7 small subunit	5.75e-12	2.92e-35	NA	NA
5. P	Q83L75	UPF0181 protein YoaH	4.19e-03	1.11e-05	NA	NA
5. P	Q2FW14	50S ribosomal protein L29	5.61e-07	1.14e-02	NA	NA
5. P	P39418	Uncharacterized 9.5 kDa protein in dexA-dda intergenic region	NA	1.95e-02	NA	NA
5. P	B7LMG5	Exodeoxyribonuclease 7 small subunit	5.16e-08	1.04e-30	NA	NA
5. P	A6LEH3	50S ribosomal protein L30	1.50e-01	3.10e-02	NA	NA
5. P	Q49ZG0	50S ribosomal protein L29	7.01e-07	4.07e-02	NA	NA
5. P	B7UK58	Protein SlyX	1.52e-04	3.29e-02	NA	NA
5. P	B1MXR1	Exodeoxyribonuclease 7 small subunit	1.05e-11	3.96e-30	NA	NA
5. P	Q8Y7C3	Exodeoxyribonuclease 7 small subunit	1.29e-12	5.60e-34	NA	NA
5. P	Q7MN47	Exodeoxyribonuclease 7 small subunit	3.18e-12	1.23e-27	NA	NA
5. P	Q73HK1	UPF0335 protein WD_0557	9.24e-05	1.22e-03	NA	NA
5. P	Q0BUX9	Cell division topological specificity factor	2.12e-01	3.59e-02	NA	NA
5. P	Q1JAV6	Exodeoxyribonuclease 7 small subunit	3.47e-11	7.49e-35	NA	NA
5. P	Q3Z2F2	UPF0181 protein YoaH	5.65e-03	1.53e-05	NA	NA
5. P	P67465	Exodeoxyribonuclease 7 small subunit	1.46e-11	1.95e-36	NA	NA
5. P	Q487D1	Exodeoxyribonuclease 7 small subunit	5.55e-16	3.69e-29	NA	NA
5. P	B7USI6	UPF0181 protein YoaH	6.23e-03	1.25e-05	NA	NA
5. P	B6IBN8	UPF0181 protein YoaH	5.01e-03	1.53e-05	NA	NA
5. P	B0RR28	Exodeoxyribonuclease 7 small subunit	1.24e-12	3.53e-21	NA	NA
5. P	Q9PFJ7	Exodeoxyribonuclease 7 small subunit	6.01e-12	3.08e-17	NA	NA
5. P	Q4K5A7	Exodeoxyribonuclease 7 small subunit	4.46e-13	4.08e-26	NA	NA
5. P	Q5F632	Exodeoxyribonuclease 7 small subunit	1.33e-09	9.78e-36	NA	NA
5. P	B1GZX5	Exodeoxyribonuclease 7 small subunit	1.71e-06	6.09e-34	NA	NA
5. P	Q97HD1	Exodeoxyribonuclease 7 small subunit	2.80e-08	4.77e-25	NA	NA
5. P	P64455	Uncharacterized protein YdcY	6.07e-07	5.58e-03	NA	NA
5. P	G2TRT5	SCOCO-like protein 1	2.00e-04	3.94e-02	NA	NA
5. P	C4ZZG7	UPF0181 protein YoaH	5.30e-03	1.53e-05	NA	NA
5. P	A9N3J4	Transcriptional repressor RcnR	8.08e-06	7.58e-04	NA	NA
5. P	Q8TX34	50S ribosomal protein L29	4.33e-07	2.15e-03	NA	NA
5. P	Q6AA93	Exodeoxyribonuclease 7 small subunit	3.26e-12	1.40e-16	NA	NA
5. P	B5FKS9	Exodeoxyribonuclease 7 small subunit	9.10e-15	3.37e-31	NA	NA
5. P	Q44148	UPF0437 protein asl1434	4.79e-06	4.34e-04	NA	NA
5. P	A7X2P9	Exodeoxyribonuclease 7 small subunit	1.44e-15	2.38e-27	NA	NA
5. P	P64532	Transcriptional repressor RcnR	8.29e-06	3.18e-04	NA	NA
5. P	P9WF28	Exodeoxyribonuclease 7 small subunit	5.64e-13	7.47e-08	NA	NA
5. P	A9HIR6	Exodeoxyribonuclease 7 small subunit	4.21e-12	1.51e-26	NA	NA
5. P	A1VMD5	Exodeoxyribonuclease 7 small subunit	3.97e-09	3.81e-05	NA	NA
5. P	P60356	UPF0297 protein lin1538	1.67e-02	3.81e-02	NA	NA
5. P	A8MFJ0	Exodeoxyribonuclease 7 small subunit	1.70e-07	8.68e-23	NA	NA
5. P	A5VXX1	Exodeoxyribonuclease 7 small subunit	2.38e-13	5.88e-26	NA	NA
5. P	A7ZX74	Exodeoxyribonuclease 7 small subunit	4.06e-08	1.04e-30	NA	NA
5. P	B1J084	Transcriptional repressor FrmR	3.39e-06	4.51e-02	NA	NA
5. P	B2U447	UPF0181 protein YoaH	4.99e-03	1.53e-05	NA	NA
5. P	Q3Z549	Transcriptional repressor FrmR	1.09e-07	4.51e-02	NA	NA
5. P	A8LM65	50S ribosomal protein L29	6.64e-07	2.77e-02	NA	NA
5. P	Q9QAZ7	Protein B	NA	1.43e-02	NA	NA
5. P	Q8NSZ9	50S ribosomal protein L29	5.86e-05	3.09e-04	NA	NA
5. P	Q2K4D4	UPF0335 protein RHE_CH03546	1.52e-04	3.17e-03	NA	NA
5. P	Q4ZWL9	Protein SlyX homolog	4.83e-05	4.60e-04	NA	NA
5. P	P43914	Exodeoxyribonuclease 7 small subunit	1.07e-12	5.08e-26	NA	NA
5. P	Q3KM30	Exodeoxyribonuclease 7 small subunit	2.72e-13	5.38e-21	NA	NA
5. P	O05113	UPF0335 protein MexAM1_META1p2947	2.82e-04	2.54e-02	NA	NA
5. P	O35019	UPF0435 protein YfkK	1.66e-03	2.33e-02	NA	NA
5. P	A1T4P7	50S ribosomal protein L29	4.03e-05	1.23e-02	NA	NA
5. P	Q8XJD9	Exodeoxyribonuclease 7 small subunit	6.84e-09	4.45e-31	NA	NA
5. P	B7L656	Exodeoxyribonuclease 7 small subunit	1.45e-09	1.04e-30	NA	NA
5. P	C4KZN8	50S ribosomal protein L29	9.88e-07	6.80e-03	NA	NA
5. P	Q92M59	UPF0335 protein R02793	5.55e-05	3.00e-03	NA	NA
5. P	P62505	DASH complex subunit dad3	2.63e-09	4.99e-02	NA	NA
5. P	A6VMF1	UPF0352 protein Asuc_0778	6.15e-05	6.10e-03	NA	NA
5. P	B1IJL2	UPF0291 protein CLD_1956	3.38e-05	7.69e-07	NA	NA
5. P	A0A0H3N8G7	Hemolysin expression-modulating protein Hha	1.95e-03	6.63e-04	NA	NA
5. P	Q5HN54	UPF0435 protein SERP1418	2.21e-03	2.76e-03	NA	NA
5. P	Q5L3S1	50S ribosomal protein L30	1.41e-01	1.41e-02	NA	NA
5. P	Q9RXJ4	50S ribosomal protein L29	1.04e-06	2.21e-03	NA	NA
5. P	B2VK22	UPF0270 protein ETA_31870	4.22e-04	4.32e-02	NA	NA
5. P	B3PZT5	UPF0335 protein RHECIAT_CH0003797	6.41e-05	1.58e-03	NA	NA
5. P	A7NR45	50S ribosomal protein L30	1.79e-01	5.10e-03	NA	NA
5. P	Q8X5J3	Transcriptional repressor FrmR	3.02e-06	4.51e-02	NA	NA
5. P	Q9NSA3	Beta-catenin-interacting protein 1	4.39e-02	4.67e-02	NA	NA
5. P	A0KIV0	UPF0352 protein AHA_1665	8.03e-05	5.52e-04	NA	NA
5. P	Q4K7D1	Protein SlyX homolog	1.06e-05	1.54e-03	NA	NA
5. P	A7Z555	UPF0291 protein RBAM_017680	7.48e-05	1.21e-02	NA	NA
5. P	Q6B8W1	50S ribosomal protein L29, chloroplastic	1.61e-06	1.37e-02	NA	NA
5. P	Q6LVD0	Protein SlyX homolog	6.83e-06	4.43e-02	NA	NA
5. P	B5YG39	50S ribosomal protein L29	1.55e-07	6.98e-03	NA	NA
5. P	Q12SJ3	Cell division protein ZapB	1.61e-05	2.61e-03	NA	NA
5. P	Q92BZ2	Exodeoxyribonuclease 7 small subunit	9.96e-13	1.63e-33	NA	NA
5. P	O31866	SPbeta prophage-derived uncharacterized protein YotK	3.09e-09	6.92e-03	NA	NA
5. P	Q2LUA0	Exodeoxyribonuclease 7 small subunit	4.60e-14	3.24e-19	NA	NA
5. P	A6UCY0	UPF0335 protein Smed_2680	6.37e-05	5.63e-04	NA	NA
5. P	B2UVM8	Exodeoxyribonuclease 7 small subunit	2.57e-08	2.76e-03	NA	NA
5. P	Q6GH65	UPF0291 protein SAR1351	1.36e-04	3.03e-03	NA	NA
5. P	Q88QG5	Exodeoxyribonuclease 7 small subunit	1.60e-13	5.88e-26	NA	NA
5. P	A9MNJ9	UPF0181 protein YoaH	4.50e-03	7.24e-05	NA	NA
5. P	Q75JC8	Tubulin-specific chaperone A	1.37e-08	4.14e-02	NA	NA
5. P	Q2YLX2	UPF0335 protein BAB1_1765	3.80e-05	2.64e-03	NA	NA
5. P	B7MQD7	Exodeoxyribonuclease 7 small subunit	7.49e-08	1.04e-30	NA	NA
5. P	A8YVW8	Exodeoxyribonuclease 7 small subunit	3.50e-07	1.87e-23	NA	NA
5. P	B1ZNE0	50S ribosomal protein L29	1.02e-06	2.95e-03	NA	NA
5. P	Q38XU7	Exodeoxyribonuclease 7 small subunit	2.39e-07	3.94e-27	NA	NA
5. P	A5CWU5	Exodeoxyribonuclease 7 small subunit	1.49e-07	1.40e-24	NA	NA
5. P	Q2G632	Exodeoxyribonuclease 7 small subunit	1.22e-15	1.14e-21	NA	NA
5. P	P0A8R5	Protein SlyX	1.48e-04	3.29e-02	NA	NA
5. P	B1XF10	Exodeoxyribonuclease 7 small subunit	1.15e-08	1.04e-30	NA	NA
5. P	Q92TZ1	Cell division topological specificity factor	1.24e-06	2.66e-02	NA	NA
5. P	P0A1T5	Fumarase D	4.49e-04	4.18e-02	NA	NA
5. P	A7Z6J7	Exodeoxyribonuclease 7 small subunit	8.06e-07	2.98e-26	NA	NA
5. P	B5EXG5	Exodeoxyribonuclease 7 small subunit	2.55e-10	3.37e-31	NA	NA
5. P	B0BP87	Exodeoxyribonuclease 7 small subunit	1.33e-15	1.12e-41	NA	NA
5. P	A4W384	Exodeoxyribonuclease 7 small subunit	1.38e-11	9.57e-34	NA	NA
5. P	P64530	Transcriptional repressor RcnR	6.91e-06	3.18e-04	NA	NA
5. P	A9NBV6	Exodeoxyribonuclease 7 small subunit	2.22e-08	1.95e-26	NA	NA
5. P	C5D2I1	Small, acid-soluble spore protein Tlp	1.88e-08	4.63e-02	NA	NA
5. P	Q5X2W0	Exodeoxyribonuclease 7 small subunit	6.51e-11	2.23e-24	NA	NA
5. P	P71066	Uncharacterized protein YvfG	4.23e-04	4.54e-05	NA	NA
5. P	Q65HJ0	Exodeoxyribonuclease 7 small subunit	1.94e-07	9.64e-28	NA	NA
5. P	Q0AZF3	Exodeoxyribonuclease 7 small subunit	4.61e-13	4.63e-31	NA	NA
5. P	B1JIT3	UPF0270 protein YPK_0255	7.55e-04	1.18e-02	NA	NA
5. P	A6T5F5	Exodeoxyribonuclease 7 small subunit	3.70e-12	1.08e-27	NA	NA
5. P	A3MBD0	Exodeoxyribonuclease 7 small subunit	2.73e-08	1.13e-12	NA	NA
5. P	A8A1X0	Transcriptional repressor RcnR	8.25e-06	3.18e-04	NA	NA
5. P	Q65TP2	Exodeoxyribonuclease 7 small subunit	1.21e-12	4.70e-28	NA	NA
5. P	Q1BD99	50S ribosomal protein L29	6.96e-05	3.59e-02	NA	NA
5. P	Q0T334	Transcriptional repressor RcnR	7.76e-06	3.18e-04	NA	NA
5. P	B1LJH2	Exodeoxyribonuclease 7 small subunit	1.57e-10	1.04e-30	NA	NA
5. P	Q03FZ3	Exodeoxyribonuclease 7 small subunit	1.21e-11	3.57e-23	NA	NA
5. P	C1CXF8	50S ribosomal protein L29	1.20e-06	4.04e-02	NA	NA
5. P	Q9X784	Exodeoxyribonuclease 7 small subunit	5.27e-13	1.29e-14	NA	NA
5. P	Q6G779	50S ribosomal protein L29	6.20e-07	1.14e-02	NA	NA
5. P	Q3Z4Y7	Exodeoxyribonuclease 7 small subunit	1.53e-12	1.22e-30	NA	NA
5. P	Q030A1	Exodeoxyribonuclease 7 small subunit	2.80e-07	1.37e-26	NA	NA
5. P	B3H1E5	Exodeoxyribonuclease 7 small subunit	6.88e-15	1.12e-41	NA	NA
5. P	B5Y0W9	Exodeoxyribonuclease 7 small subunit	6.69e-12	1.08e-27	NA	NA
5. P	Q6CSY9	DASH complex subunit DAD4	1.35e-05	1.59e-02	NA	NA
5. P	Q5FJG7	Exodeoxyribonuclease 7 small subunit	5.44e-07	8.92e-24	NA	NA
5. P	B0ULP6	UPF0335 protein M446_5200	4.54e-06	6.38e-04	NA	NA
5. P	Q9UUB7	Mating-type switching protein swi5	6.51e-04	9.52e-04	NA	NA
5. P	Q9CH83	Exodeoxyribonuclease 7 small subunit	6.35e-09	1.78e-26	NA	NA
5. P	A4VWY2	Exodeoxyribonuclease 7 small subunit	6.14e-12	9.57e-34	NA	NA
5. P	A4WFF7	UPF0270 protein Ent638_3781	5.05e-04	7.99e-03	NA	NA
5. P	A1VE71	Exodeoxyribonuclease 7 small subunit	5.36e-07	1.65e-23	NA	NA
5. P	Q87RT8	Exodeoxyribonuclease 7 small subunit	6.44e-15	5.64e-31	NA	NA
5. P	Q65R93	UPF0352 protein MS1910	2.04e-05	3.50e-02	NA	NA