Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54616.1
JCVISYN3A_0107
Transcription antitermination factor.
M. mycoides homolog: Q6MUD0.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 4
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 603
Unique PROST Homologs: 71
Unique BLAST Homologs: 6
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A1SJD8
(Transcription antitermination protein NusB) with a FATCAT P-Value: 3.55e-15 and RMSD of 1.85 angstrom. The sequence alignment identity is 27.5%.
Structural alignment shown in left. Query protein AVX54616.1 colored as red in alignment, homolog A1SJD8 colored as blue.
Query protein AVX54616.1 is also shown in right top, homolog A1SJD8 showed in right bottom. They are colored based on secondary structures.
AVX54616.1 METKISFSKKRKLLIQTFYKYQLLNASIDYIH-QD---ILD----DVQNINNKD---VLFE--IEQIAKKQTD-LINHININVSSSWKWDRIPAVIRAIL 86 A1SJD8 MSAR-SKARKRAL--------DVLFAS-D-VRGEDAVAALDRAIAEGEGPTN-DYTATLVRGVVEHQAR--IDELLS----SYSHGWALDRMPAVDRNVL 82 AVX54616.1 IVGTYEILYT-NTPKPVTINEMVKYVKEIEPDFDYKFVNAVLDKLVK------ 132 A1SJD8 RLGVWELLYADDVPDAVAVSEAMALVTDLSTDESPQFVNGILGSIVRNKPSLA 135
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006353 | DNA-templated transcription, termination |
| 1. PBF | GO:0003723 | RNA binding |
| 1. PBF | GO:0031564 | transcription antitermination |
| 1. PBF | GO:0006355 | regulation of transcription, DNA-templated |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006353 | DNA-templated transcription, termination |
| GO:0003723 | RNA binding |
| GO:0031564 | transcription antitermination |
| GO:0006355 | regulation of transcription, DNA-templated |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A4Y960 | Transcription antitermination protein NusB | 3.43e-12 | 3.24e-38 | 4.50e-10 | 0.7133 |
| 1. PBF | Q0SS00 | Transcription antitermination protein NusB | 3.36e-13 | 2.42e-30 | 7.16e-07 | 0.7894 |
| 1. PBF | A7GWZ7 | Transcription antitermination protein NusB | 7.88e-15 | 2.61e-34 | 9.73e-08 | 0.7667 |
| 1. PBF | B5Z3S0 | Transcription antitermination protein NusB | 5.48e-12 | 4.99e-26 | 0.003 | 0.7362 |
| 1. PBF | B9JV80 | Transcription antitermination protein NusB | 9.98e-13 | 2.97e-24 | 2.32e-04 | 0.7544 |
| 1. PBF | Q325I5 | Transcription antitermination protein NusB | 5.58e-12 | 4.99e-26 | 0.003 | 0.7363 |
| 1. PBF | C3M9I9 | Transcription antitermination protein NusB | 3.52e-12 | 1.64e-19 | 3.84e-06 | 0.753 |
| 1. PBF | Q32JH0 | Transcription antitermination protein NusB | 5.36e-12 | 4.99e-26 | 0.003 | 0.7369 |
| 1. PBF | A8FKG9 | Transcription antitermination protein NusB | 1.69e-11 | 8.59e-45 | 2.51e-11 | 0.787 |
| 1. PBF | A4VHT5 | Transcription antitermination protein NusB | 3.60e-11 | 8.71e-17 | 1.56e-05 | 0.7514 |
| 1. PBF | B7UJN9 | Transcription antitermination protein NusB | 5.13e-12 | 4.99e-26 | 0.003 | 0.7368 |
| 1. PBF | Q741J2 | Transcription antitermination protein NusB | 1.40e-13 | 7.13e-19 | 8.07e-12 | 0.7306 |
| 1. PBF | B2U4L9 | Transcription antitermination protein NusB | 5.55e-12 | 4.99e-26 | 0.003 | 0.7366 |
| 1. PBF | A6Q4Q9 | Transcription antitermination protein NusB | 3.03e-13 | 1.22e-28 | 2.61e-13 | 0.7847 |
| 1. PBF | A6U1Z6 | Transcription antitermination protein NusB | 8.68e-14 | 8.47e-35 | 1.65e-07 | 0.772 |
| 1. PBF | B1LJG6 | Transcription antitermination protein NusB | 5.57e-12 | 4.99e-26 | 0.003 | 0.7347 |
| 1. PBF | Q086C3 | Transcription antitermination protein NusB | 5.30e-12 | 4.24e-38 | 6.00e-09 | 0.738 |
| 1. PBF | Q5HP28 | Transcription antitermination protein NusB | 1.69e-13 | 2.52e-35 | 2.00e-09 | 0.7557 |
| 1. PBF | Q7N0J0 | Transcription antitermination protein NusB | 6.78e-12 | 5.77e-29 | 1.04e-04 | 0.7456 |
| 1. PBF | A1KLN0 | Transcription antitermination protein NusB | 3.83e-14 | 1.47e-21 | 1.01e-09 | 0.7171 |
| 1. PBF | Q6AF91 | Transcription antitermination protein NusB | 5.33e-15 | 1.66e-26 | 3.87e-06 | 0.7523 |
| 1. PBF | B2TRN6 | Transcription antitermination protein NusB | 8.12e-14 | 8.59e-37 | 6.32e-05 | 0.7246 |
| 1. PBF | Q8UG69 | Transcription antitermination protein NusB | 4.61e-12 | 4.08e-17 | 8.29e-05 | 0.759 |
| 1. PBF | B7MQD1 | Transcription antitermination protein NusB | 5.51e-12 | 4.99e-26 | 0.003 | 0.7362 |
| 1. PBF | Q3SRV8 | Transcription antitermination protein NusB | 5.24e-11 | 2.85e-23 | 1.45e-04 | 0.702 |
| 1. PBF | A3QC63 | Transcription antitermination protein NusB | 3.51e-12 | 4.59e-36 | 4.62e-08 | 0.6886 |
| 1. PBF | Q9KXR0 | Transcription antitermination protein NusB | 6.82e-14 | 3.94e-34 | 1.21e-08 | 0.8061 |
| 1. PBF | A8H1Q6 | Transcription antitermination protein NusB | 3.05e-12 | 1.40e-37 | 5.11e-09 | 0.7736 |
| 1. PBF | Q485J1 | Transcription antitermination protein NusB | 6.71e-10 | 1.26e-31 | 8.02e-06 | 0.7546 |
| 1. PBF | Q49XW9 | Transcription antitermination protein NusB | 1.49e-13 | 1.21e-34 | 3.05e-07 | 0.7473 |
| 1. PBF | A0JX79 | Transcription antitermination protein NusB | 1.31e-13 | 6.59e-26 | 2.36e-07 | 0.7932 |
| 1. PBF | A7H4Z5 | Transcription antitermination protein NusB | 1.82e-11 | 1.51e-43 | 5.41e-12 | 0.7855 |
| 1. PBF | A8FSR5 | Transcription antitermination protein NusB | 3.07e-12 | 4.48e-37 | 1.45e-08 | 0.7326 |
| 1. PBF | B9E6Q9 | Transcription antitermination protein NusB | 1.25e-12 | 6.20e-37 | 2.15e-10 | 0.7681 |
| 1. PBF | Q73M53 | Transcription antitermination protein NusB | 6.01e-13 | 4.81e-39 | 2.14e-07 | 0.7411 |
| 1. PBF | C4K7H4 | Transcription antitermination protein NusB | 9.88e-12 | 1.45e-13 | 0.001 | 0.7483 |
| 1. PBF | A9KYJ0 | Transcription antitermination protein NusB | 3.17e-12 | 3.24e-38 | 4.50e-10 | 0.7148 |
| 1. PBF | A6QH69 | Transcription antitermination protein NusB | 9.11e-14 | 8.47e-35 | 1.65e-07 | 0.7723 |
| 1. PBF | Q2YYB7 | Transcription antitermination protein NusB | 1.92e-14 | 9.35e-35 | 1.64e-07 | 0.7761 |
| 1. PBF | B7N8W8 | Transcription antitermination protein NusB | 5.38e-12 | 4.99e-26 | 0.003 | 0.7349 |
| 1. PBF | P0A782 | Transcription antitermination protein NusB | 5.39e-12 | 4.99e-26 | 0.003 | 0.7364 |
| 1. PBF | C0ZZC1 | Transcription antitermination protein NusB | 3.83e-10 | 2.07e-16 | 2.25e-06 | 0.7582 |
| 1. PBF | Q2FGK9 | Transcription antitermination protein NusB | 1.03e-13 | 4.06e-35 | 1.64e-07 | 0.7506 |
| 1. PBF | A1VYA2 | Transcription antitermination protein NusB | 1.86e-11 | 8.59e-45 | 2.51e-11 | 0.7879 |
| 1. PBF | A7GEJ8 | Transcription antitermination protein NusB | 6.38e-14 | 3.27e-29 | 0.002 | 0.7153 |
| 1. PBF | B2UW05 | Transcription antitermination protein NusB | 3.24e-13 | 1.88e-31 | 9.54e-09 | 0.7617 |
| 1. PBF | A7ZX68 | Transcription antitermination protein NusB | 5.37e-12 | 4.99e-26 | 0.003 | 0.7362 |
| 1. PBF | Q6GGH4 | Transcription antitermination protein NusB | 1.43e-13 | 1.93e-36 | 1.36e-07 | 0.754 |
| 1. PBF | A6WCD3 | Transcription antitermination protein NusB | 2.01e-14 | 3.12e-24 | 5.31e-10 | 0.8009 |
| 1. PBF | A1SJD8 | Transcription antitermination protein NusB | 3.55e-15 | 1.11e-26 | 8.47e-08 | 0.8091 |
| 1. PBF | Q8EBP4 | Transcription antitermination protein NusB | 3.17e-12 | 3.99e-39 | 1.82e-09 | 0.7147 |
| 1. PBF | A6T5E9 | Transcription antitermination protein NusB | 5.23e-12 | 1.81e-26 | 0.029 | 0.7374 |
| 1. PBF | Q7VK55 | Transcription antitermination protein NusB | 8.11e-13 | 8.46e-08 | 4.60e-12 | 0.7714 |
| 1. PBF | Q3JCY0 | Transcription antitermination protein NusB | 3.35e-12 | 8.30e-19 | 1.72e-06 | 0.7485 |
| 1. PBF | Q17Z26 | Transcription antitermination protein NusB | 2.35e-13 | 5.17e-32 | 8.14e-09 | 0.766 |
| 1. PBF | P0A781 | Transcription antitermination protein NusB | 5.61e-12 | 4.99e-26 | 0.003 | 0.7348 |
| 1. PBF | B5Y0X5 | Transcription antitermination protein NusB | 5.02e-12 | 2.23e-26 | 0.028 | 0.7373 |
| 1. PBF | Q9ZN57 | Transcription antitermination protein NusB | 3.77e-13 | 8.34e-31 | 8.40e-09 | 0.7662 |
| 1. PBF | B1J033 | Transcription antitermination protein NusB | 5.53e-12 | 4.99e-26 | 0.003 | 0.7366 |
| 1. PBF | Q1J0I4 | Transcription antitermination protein NusB | 1.08e-11 | 7.04e-18 | 2.39e-04 | 0.7076 |
| 1. PBF | A8Z464 | Transcription antitermination protein NusB | 5.55e-14 | 4.06e-35 | 1.64e-07 | 0.7745 |
| 1. PBF | B7L650 | Transcription antitermination protein NusB | 5.22e-12 | 4.99e-26 | 0.003 | 0.7365 |
| 1. PBF | A6U7P8 | Transcription antitermination protein NusB | 3.13e-12 | 4.51e-21 | 1.37e-07 | 0.759 |
| 1. PBF | Q2KA07 | Transcription antitermination protein NusB | 2.08e-12 | 1.47e-21 | 2.71e-05 | 0.7594 |
| 1. PBF | Q894G5 | Transcription antitermination protein NusB | 2.60e-12 | 4.56e-28 | 9.85e-07 | 0.7414 |
| 1. PBF | Q3Z4Z3 | Transcription antitermination protein NusB | 5.68e-12 | 4.99e-26 | 0.003 | 0.7364 |
| 1. PBF | B2K6T4 | Transcription antitermination protein NusB | 4.80e-12 | 3.48e-28 | 6.72e-04 | 0.7378 |
| 1. PBF | B9JCY3 | Transcription antitermination protein NusB | 3.47e-12 | 3.47e-17 | 1.15e-06 | 0.758 |
| 1. PBF | Q5HW85 | Transcription antitermination protein NusB | 1.80e-11 | 1.46e-44 | 2.38e-11 | 0.7498 |
| 1. PBF | Q5HFP7 | Transcription antitermination protein NusB | 1.15e-13 | 8.47e-35 | 1.65e-07 | 0.7543 |
| 1. PBF | Q2NV97 | Transcription antitermination protein NusB | 3.10e-12 | 6.87e-27 | 0.047 | 0.7371 |
| 1. PBF | Q18B61 | Transcription antitermination protein NusB | 1.35e-11 | 9.24e-19 | 1.65e-06 | 0.6963 |
| 1. PBF | B6JPA0 | Transcription antitermination protein NusB | 2.93e-13 | 3.38e-31 | 6.26e-09 | 0.7421 |
| 1. PBF | B1KJK5 | Transcription antitermination protein NusB | 3.49e-12 | 1.91e-35 | 2.22e-09 | 0.716 |
| 1. PBF | A1RHD6 | Transcription antitermination protein NusB | 3.16e-12 | 5.78e-38 | 1.35e-09 | 0.7143 |
| 1. PBF | A0QI54 | Transcription antitermination protein NusB | 1.53e-13 | 7.13e-19 | 8.07e-12 | 0.7323 |
| 1. PBF | P65577 | Transcription antitermination protein NusB | 2.17e-13 | 8.47e-35 | 1.65e-07 | 0.7609 |
| 1. PBF | Q8XJD6 | Transcription antitermination protein NusB | 1.65e-13 | 6.72e-30 | 6.72e-07 | 0.7895 |
| 1. PBF | B7MD74 | Transcription antitermination protein NusB | 5.37e-12 | 4.99e-26 | 0.003 | 0.7364 |
| 1. PBF | A1T8G0 | Transcription antitermination protein NusB | 2.17e-12 | 4.61e-15 | 6.44e-10 | 0.7836 |
| 1. PBF | B0TJZ1 | Transcription antitermination protein NusB | 3.49e-12 | 3.88e-37 | 1.43e-08 | 0.7734 |
| 1. PBF | B9KFP0 | Transcription antitermination protein NusB | 6.98e-10 | 6.41e-38 | 3.07e-11 | 0.7949 |
| 1. PBF | Q8CP37 | Transcription antitermination protein NusB | 3.76e-10 | 2.52e-35 | 2.00e-09 | 0.7549 |
| 1. PBF | A7ZBS7 | Transcription antitermination protein NusB | 2.03e-09 | 2.23e-34 | 9.06e-07 | 0.7834 |
| 1. PBF | Q0TPD3 | Transcription antitermination protein NusB | 1.83e-13 | 6.72e-30 | 6.72e-07 | 0.7888 |
| 1. PBF | B5Z6D7 | Transcription antitermination protein NusB | 3.25e-13 | 5.27e-32 | 7.03e-09 | 0.7621 |
| 1. PBF | A3D7C4 | Transcription antitermination protein NusB | 3.29e-12 | 3.24e-38 | 4.50e-10 | 0.7122 |
| 1. PBF | A0QWR5 | Transcription antitermination protein NusB | 2.31e-11 | 3.28e-17 | 1.66e-11 | 0.7812 |
| 1. PBF | Q0S0M6 | Transcription antitermination protein NusB | 4.03e-12 | 1.04e-10 | 3.25e-06 | 0.733 |
| 1. PBF | Q1RFC4 | Transcription antitermination protein NusB | 5.50e-12 | 4.99e-26 | 0.003 | 0.7348 |
| 1. PBF | C4ZTH3 | Transcription antitermination protein NusB | 5.65e-12 | 4.99e-26 | 0.003 | 0.7365 |
| 1. PBF | B1W456 | Transcription antitermination protein NusB | 2.01e-14 | 1.08e-30 | 9.39e-09 | 0.798 |
| 1. PBF | Q7TYC8 | Transcription antitermination protein NusB | 1.37e-13 | 1.47e-21 | 1.01e-09 | 0.7212 |
| 1. PBF | Q7MAE9 | Transcription antitermination protein NusB | 9.64e-14 | 1.07e-33 | 2.51e-10 | 0.7823 |
| 1. PBF | P0A783 | Transcription antitermination protein NusB | 5.49e-12 | 4.99e-26 | 0.003 | 0.7368 |
| 1. PBF | C3PGM1 | Transcription antitermination protein NusB | 2.20e-10 | 1.58e-10 | 2.51e-05 | 0.7786 |
| 1. PBF | Q15W97 | Transcription antitermination protein NusB | 5.16e-12 | 5.08e-28 | 1.38e-06 | 0.7587 |
| 1. PBF | B8CJN3 | Transcription antitermination protein NusB | 4.01e-12 | 1.74e-36 | 2.61e-08 | 0.7722 |
| 1. PBF | A1UFJ6 | Transcription antitermination protein NusB | 3.46e-11 | 1.38e-15 | 3.99e-11 | 0.785 |
| 1. PBF | A5N7I8 | Transcription antitermination protein NusB | 2.10e-12 | 1.19e-25 | 1.58e-06 | 0.7494 |
| 1. PBF | Q5YTL2 | Transcription antitermination protein NusB | 2.33e-10 | 2.10e-14 | 8.75e-07 | 0.7587 |
| 1. PBF | Q2RTC4 | Transcription antitermination protein NusB | 1.18e-08 | 2.33e-12 | 3.34e-08 | 0.7402 |
| 1. PBF | B9DNQ0 | Transcription antitermination protein NusB | 1.08e-09 | 2.15e-37 | 1.57e-05 | 0.7455 |
| 1. PBF | Q6G941 | Transcription antitermination protein NusB | 7.70e-14 | 8.47e-35 | 1.65e-07 | 0.7716 |
| 1. PBF | Q0TKM5 | Transcription antitermination protein NusB | 5.38e-12 | 4.99e-26 | 0.003 | 0.7362 |
| 1. PBF | A0RQJ6 | Transcription antitermination protein NusB | 6.89e-13 | 2.75e-38 | 3.07e-11 | 0.7658 |
| 1. PBF | Q8Z8X6 | Transcription antitermination protein NusB | 5.84e-12 | 9.61e-27 | 0.004 | 0.7365 |
| 1. PBF | B7M3Q5 | Transcription antitermination protein NusB | 5.57e-12 | 4.99e-26 | 0.003 | 0.7363 |
| 1. PBF | Q1CVF4 | Transcription antitermination protein NusB | 3.09e-13 | 5.27e-32 | 7.03e-09 | 0.762 |
| 1. PBF | A5U5N2 | Transcription antitermination protein NusB | 1.12e-13 | 1.78e-21 | 1.07e-09 | 0.714 |
| 1. PBF | B8E6W7 | Transcription antitermination protein NusB | 3.12e-12 | 3.24e-38 | 4.50e-10 | 0.7686 |
| 1. PBF | Q0AD60 | Transcription antitermination protein NusB | 1.74e-11 | 6.41e-13 | 0.005 | 0.7755 |
| 1. PBF | Q4L6M5 | Transcription antitermination protein NusB | 3.35e-13 | 6.21e-36 | 2.55e-07 | 0.7513 |
| 1. PBF | Q9HWX6 | Transcription antitermination protein NusB | 1.49e-08 | 3.33e-16 | 0.024 | 0.7376 |
| 1. PBF | Q827R4 | Transcription antitermination protein NusB | 7.69e-14 | 8.09e-30 | 5.20e-09 | 0.8059 |
| 1. PBF | Q92QT9 | Transcription antitermination protein NusB | 9.48e-12 | 1.82e-20 | 1.37e-07 | 0.7474 |
| 1. PBF | O24853 | Transcription antitermination protein NusB | 3.30e-13 | 6.29e-31 | 8.95e-09 | 0.7408 |
| 1. PBF | Q12Q42 | Transcription antitermination protein NusB | 4.10e-12 | 1.07e-39 | 1.04e-08 | 0.7633 |
| 1. PBF | B3PVD4 | Transcription antitermination protein NusB | 5.35e-12 | 1.82e-20 | 1.29e-04 | 0.758 |
| 1. PBF | Q0C0J1 | Transcription antitermination protein NusB | 1.11e-08 | 2.43e-22 | 0.006 | 0.6784 |
| 1. PBF | B8H8V2 | Transcription antitermination protein NusB | 1.60e-13 | 1.49e-27 | 9.08e-08 | 0.7933 |
| 1. PBF | Q9PIC0 | Transcription antitermination protein NusB | 1.87e-11 | 1.46e-44 | 2.38e-11 | 0.7872 |
| 1. PBF | P65578 | Transcription antitermination protein NusB | 1.09e-13 | 8.47e-35 | 1.65e-07 | 0.7548 |
| 1. PBF | C1B4I5 | Transcription antitermination protein NusB | 4.56e-12 | 1.28e-10 | 3.52e-06 | 0.7323 |
| 1. PBF | P65579 | Transcription antitermination protein NusB | 1.07e-13 | 8.47e-35 | 1.65e-07 | 0.7533 |
| 1. PBF | Q6G3K8 | Transcription antitermination protein NusB | 1.97e-12 | 6.77e-25 | 2.11e-05 | 0.7344 |
| 1. PBF | P9WIV0 | Transcription antitermination protein NusB | 1.10e-13 | 1.78e-21 | 1.07e-09 | 0.7207 |
| 1. PBF | C1AF01 | Transcription antitermination protein NusB | 1.58e-13 | 1.47e-21 | 1.01e-09 | 0.731 |
| 1. PBF | Q0APG4 | Transcription antitermination protein NusB | 1.34e-11 | 4.61e-24 | 9.36e-08 | 0.7233 |
| 1. PBF | A7X2Q3 | Transcription antitermination protein NusB | 5.57e-13 | 8.47e-35 | 1.65e-07 | 0.7249 |
| 1. PBF | Q4JVG6 | Transcription antitermination protein NusB | 6.45e-10 | 2.56e-04 | 3.79e-06 | 0.7381 |
| 1. PBF | Q2W4S5 | Transcription antitermination protein NusB | 6.25e-09 | 3.52e-24 | 3.89e-07 | 0.6872 |
| 1. PBF | A5IT53 | Transcription antitermination protein NusB | 9.06e-14 | 8.47e-35 | 1.65e-07 | 0.7482 |
| 1. PBF | Q03FZ6 | Transcription antitermination protein NusB | 2.43e-13 | 2.47e-39 | 1.22e-07 | 0.748 |
| 1. PBF | A5CRY5 | Transcription antitermination protein NusB | 1.47e-14 | 7.73e-31 | 2.42e-06 | 0.7543 |
| 1. PBF | A7ZIG9 | Transcription antitermination protein NusB | 5.65e-12 | 4.99e-26 | 0.003 | 0.7364 |
| 1. PBF | A4FBF8 | Transcription antitermination protein NusB | 9.36e-14 | 1.04e-14 | 3.63e-08 | 0.783 |
| 1. PBF | Q0HL87 | Transcription antitermination protein NusB | 3.22e-12 | 1.21e-37 | 1.84e-09 | 0.7123 |
| 1. PBF | Q8RII1 | Transcription antitermination protein NusB | 8.02e-12 | 7.87e-29 | 1.16e-09 | 0.8135 |
| 1. PBF | A6WR46 | Transcription antitermination protein NusB | 3.33e-12 | 3.24e-38 | 4.50e-10 | 0.7143 |
| 1. PBF | Q6G004 | Transcription antitermination protein NusB | 1.37e-12 | 1.49e-25 | 1.33e-05 | 0.6992 |
| 1. PBF | Q0T7H3 | Transcription antitermination protein NusB | 5.87e-12 | 4.99e-26 | 0.003 | 0.7364 |
| 1. PBF | B3DWQ3 | Transcription antitermination protein NusB | 5.77e-13 | 1.23e-24 | 1.18e-10 | 0.7503 |
| 1. PBF | B0S1M1 | Transcription antitermination protein NusB | 1.28e-13 | 6.06e-31 | 1.52e-10 | 0.7641 |
| 2. PF | Q11J90 | Transcription antitermination protein NusB | 7.10e-11 | 8.91e-22 | NA | 0.7304 |
| 2. PF | B4T8Q9 | Transcription antitermination protein NusB | 5.29e-12 | 5.54e-26 | NA | 0.7371 |
| 2. PF | B5BDB4 | Transcription antitermination protein NusB | 5.25e-12 | 5.54e-26 | NA | 0.7368 |
| 2. PF | B5EXF9 | Transcription antitermination protein NusB | 6.94e-12 | 5.54e-26 | NA | 0.7396 |
| 2. PF | A8AK38 | Transcription antitermination protein NusB | 5.76e-12 | 5.54e-26 | NA | 0.7367 |
| 2. PF | B5R6R9 | Transcription antitermination protein NusB | 5.14e-12 | 5.54e-26 | NA | 0.7368 |
| 2. PF | Q5PFS9 | Transcription antitermination protein NusB | 5.21e-12 | 5.54e-26 | NA | 0.7368 |
| 2. PF | B5FKS3 | Transcription antitermination protein NusB | 5.30e-12 | 5.54e-26 | NA | 0.737 |
| 2. PF | C0QT45 | Transcription antitermination protein NusB | 2.56e-11 | 1.60e-25 | NA | 0.7039 |
| 2. PF | A9MM45 | Transcription antitermination protein NusB | 5.70e-12 | 5.54e-26 | NA | 0.7363 |
| 2. PF | Q57SE6 | Transcription antitermination protein NusB | 5.19e-12 | 5.54e-26 | NA | 0.7374 |
| 2. PF | A4W788 | Transcription antitermination protein NusB | 4.66e-12 | 1.04e-25 | NA | 0.7454 |
| 2. PF | B5QTG6 | Transcription antitermination protein NusB | 5.45e-12 | 5.54e-26 | NA | 0.7368 |
| 2. PF | A9MX13 | Transcription antitermination protein NusB | 5.08e-12 | 5.54e-26 | NA | 0.737 |
| 2. PF | B4TM98 | Transcription antitermination protein NusB | 5.25e-12 | 5.54e-26 | NA | 0.7371 |
| 2. PF | Q8ZRD3 | Transcription antitermination protein NusB | 5.37e-12 | 5.54e-26 | NA | 0.7367 |
| 2. PF | A7MFG4 | Transcription antitermination protein NusB | 5.62e-12 | 2.27e-26 | NA | 0.7359 |
| 3. BF | Q6A8H8 | Transcription antitermination protein NusB | 3.88e-10 | NA | 7.31e-08 | 0.8256 |
| 3. BF | Q8NQ33 | Transcription antitermination protein NusB | 3.08e-09 | NA | 1.60e-04 | 0.7536 |
| 3. BF | B3QV72 | Transcription antitermination protein NusB | 2.51e-10 | NA | 8.09e-08 | 0.7221 |
| 4. PB | A7FLE7 | Transcription antitermination protein NusB | 5.09e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | Q057F3 | Transcription antitermination protein NusB | 1.58e-09 | 1.21e-26 | 0.046 | NA |
| 4. PB | A3DDP0 | Transcription antitermination protein NusB | 2.93e-12 | 7.54e-20 | 1.01e-04 | NA |
| 4. PB | Q2S9S0 | Transcription antitermination protein NusB | 3.29e-13 | 8.67e-18 | 2.24e-04 | NA |
| 4. PB | Q6MNX9 | Transcription antitermination protein NusB | 4.90e-11 | 3.33e-36 | 0.002 | NA |
| 4. PB | Q0BTF1 | Transcription antitermination protein NusB | 3.05e-09 | 1.93e-21 | 3.92e-04 | NA |
| 4. PB | Q8Y7C6 | Transcription antitermination protein NusB | 5.51e-13 | 1.13e-25 | 6.18e-05 | NA |
| 4. PB | B6IZ82 | Transcription antitermination protein NusB | 3.33e-13 | 9.33e-32 | 0.023 | NA |
| 4. PB | B9E100 | Transcription antitermination protein NusB | 6.50e-13 | 1.19e-25 | 1.58e-06 | NA |
| 4. PB | A5VKR8 | Transcription antitermination protein NusB | 1.73e-12 | 4.25e-33 | 3.16e-04 | NA |
| 4. PB | B1IMN9 | Transcription antitermination protein NusB | 6.29e-14 | 3.27e-29 | 0.002 | NA |
| 4. PB | A1KSU6 | Transcription antitermination protein NusB | 4.70e-12 | 2.77e-22 | 0.001 | NA |
| 4. PB | Q5FNA1 | Transcription antitermination protein NusB | 1.39e-11 | 1.71e-20 | 0.003 | NA |
| 4. PB | Q136T4 | Transcription antitermination protein NusB | 3.63e-11 | 2.26e-15 | 1.97e-05 | NA |
| 4. PB | A0AIG0 | Transcription antitermination protein NusB | 9.76e-13 | 5.42e-25 | 9.63e-05 | NA |
| 4. PB | A0Q099 | Transcription antitermination protein NusB | 7.10e-10 | 1.58e-37 | 4.89e-05 | NA |
| 4. PB | Q9ZE01 | Transcription antitermination protein NusB | 2.95e-08 | 4.08e-31 | 0.002 | NA |
| 4. PB | Q6AP93 | Transcription antitermination protein NusB | 1.11e-08 | 2.37e-33 | 5.00e-06 | NA |
| 4. PB | A1JNS2 | Transcription antitermination protein NusB | 4.71e-12 | 1.91e-27 | 0.002 | NA |
| 4. PB | B4RVY5 | Transcription antitermination protein NusB | 1.51e-11 | 1.69e-28 | 0.006 | NA |
| 4. PB | O51134 | Transcription antitermination protein NusB | 4.99e-11 | 3.95e-28 | 9.24e-06 | NA |
| 4. PB | A8MFJ3 | Transcription antitermination protein NusB | 1.11e-11 | 1.09e-31 | 2.71e-04 | NA |
| 4. PB | Q92J65 | Transcription antitermination protein NusB | 2.04e-11 | 6.29e-31 | 8.54e-04 | NA |
| 4. PB | A7FUU1 | Transcription antitermination protein NusB | 7.91e-13 | 3.27e-29 | 0.002 | NA |
| 4. PB | Q1GRI6 | Transcription antitermination protein NusB | 5.84e-12 | 1.55e-30 | 7.52e-05 | NA |
| 4. PB | A8GMD2 | Transcription antitermination protein NusB | 2.17e-11 | 2.70e-32 | 3.92e-05 | NA |
| 4. PB | Q8EQ42 | Transcription antitermination protein NusB | 2.84e-12 | 5.83e-34 | 4.26e-05 | NA |
| 4. PB | B5E1P3 | Transcription antitermination protein NusB | 8.13e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | C0MED0 | Transcription antitermination protein NusB | 3.53e-08 | 2.80e-37 | 1.48e-05 | NA |
| 4. PB | B4EBT9 | Transcription antitermination protein NusB | 1.70e-12 | 6.60e-21 | 9.71e-07 | NA |
| 4. PB | A4TPG6 | Transcription antitermination protein NusB | 4.76e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | A1ANJ5 | Transcription antitermination protein NusB | 3.96e-13 | 1.13e-25 | 3.92e-04 | NA |
| 4. PB | A0KU66 | Transcription antitermination protein NusB | 3.68e-12 | 1.21e-37 | 1.84e-09 | NA |
| 4. PB | A9IVB9 | Transcription antitermination protein NusB | 3.43e-11 | 3.26e-27 | 1.73e-04 | NA |
| 4. PB | Q2S6K8 | Transcription antitermination protein NusB | 4.25e-12 | 4.87e-09 | 0.017 | NA |
| 4. PB | Q0HXJ0 | Transcription antitermination protein NusB | 3.19e-12 | 1.21e-37 | 1.84e-09 | NA |
| 4. PB | Q7USA9 | Transcription antitermination protein NusB | 1.80e-12 | 3.67e-32 | 3.60e-10 | NA |
| 4. PB | Q03IW6 | Transcription antitermination protein NusB | 1.39e-08 | 1.56e-39 | 5.99e-05 | NA |
| 4. PB | B1HRY0 | Transcription antitermination protein NusB | 3.24e-12 | 1.64e-33 | 2.21e-07 | NA |
| 4. PB | P65581 | Transcription antitermination protein NusB | 3.56e-08 | 1.43e-36 | 1.30e-05 | NA |
| 4. PB | B3H044 | Transcription antitermination protein NusB | 1.39e-11 | 8.29e-34 | 0.003 | NA |
| 4. PB | Q8DSE9 | Transcription antitermination protein NusB | 3.03e-08 | 1.37e-41 | 3.67e-07 | NA |
| 4. PB | Q39IR3 | Transcription antitermination protein NusB | 2.47e-12 | 4.04e-20 | 4.60e-07 | NA |
| 4. PB | Q92BZ5 | Transcription antitermination protein NusB | 3.57e-12 | 1.57e-25 | 2.46e-04 | NA |
| 4. PB | C1C5G8 | Transcription antitermination protein NusB | 1.29e-09 | 3.24e-42 | 9.17e-06 | NA |
| 4. PB | Q88QH5 | Transcription antitermination protein NusB | 2.00e-09 | 1.73e-13 | 0.012 | NA |
| 4. PB | B1KT54 | Transcription antitermination protein NusB | 2.72e-08 | 1.31e-30 | 1.34e-05 | NA |
| 4. PB | A5D319 | Transcription antitermination protein NusB | 4.94e-12 | 7.70e-22 | 8.23e-04 | NA |
| 4. PB | P0DC76 | Transcription antitermination protein NusB | 1.04e-08 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | C6E3M6 | Transcription antitermination protein NusB | 7.00e-08 | 1.77e-32 | 6.93e-05 | NA |
| 4. PB | Q0SP57 | Transcription antitermination protein NusB | 4.31e-11 | 8.32e-32 | 8.92e-05 | NA |
| 4. PB | B2A534 | Transcription antitermination protein NusB | 9.17e-10 | 1.52e-30 | 2.92e-04 | NA |
| 4. PB | Q5KXA4 | Transcription antitermination protein NusB | 1.04e-12 | 3.93e-29 | 0.004 | NA |
| 4. PB | A9MAF0 | Transcription antitermination protein NusB | 4.14e-12 | 4.80e-19 | 0.003 | NA |
| 4. PB | A4SJP2 | Transcription antitermination protein NusB | 1.13e-11 | 8.24e-30 | 3.43e-05 | NA |
| 4. PB | B8G2S7 | Transcription antitermination protein NusB | 2.44e-11 | 1.55e-30 | 3.50e-04 | NA |
| 4. PB | B8FJ78 | Transcription antitermination protein NusB | 1.24e-12 | 2.19e-20 | 0.014 | NA |
| 4. PB | A1WVG0 | Transcription antitermination protein NusB | 8.10e-12 | 9.43e-11 | 7.14e-05 | NA |
| 4. PB | Q1B9G7 | Transcription antitermination protein NusB | 3.44e-11 | 1.38e-15 | 3.99e-11 | NA |
| 4. PB | Q81M49 | Transcription antitermination protein NusB | 1.98e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | Q038F8 | Transcription antitermination protein NusB | 3.43e-12 | 8.31e-29 | 1.45e-04 | NA |
| 4. PB | Q3MGI4 | Transcription antitermination protein NusB | 3.49e-07 | 1.85e-02 | 2.26e-05 | NA |
| 4. PB | Q818R4 | Transcription antitermination protein NusB | 1.73e-11 | 6.95e-34 | 1.17e-04 | NA |
| 4. PB | B3EFQ8 | Transcription antitermination protein NusB | 3.65e-10 | 5.34e-10 | 0.002 | NA |
| 4. PB | A6LU43 | Transcription antitermination protein NusB | 3.32e-13 | 7.45e-39 | 7.67e-06 | NA |
| 4. PB | B8J194 | Transcription antitermination protein NusB | 4.70e-12 | 2.19e-19 | 0.027 | NA |
| 4. PB | B0K0U6 | Transcription antitermination protein NusB | 5.96e-13 | 2.93e-21 | 2.12e-05 | NA |
| 4. PB | B7KFR8 | Transcription antitermination protein NusB | 2.10e-07 | 1.05e-03 | 1.51e-06 | NA |
| 4. PB | A4JC81 | Transcription antitermination protein NusB | 1.16e-12 | 7.38e-21 | 6.82e-08 | NA |
| 4. PB | Q47QY5 | Transcription antitermination protein NusB | 2.57e-12 | 3.74e-28 | 1.04e-06 | NA |
| 4. PB | Q1RHG4 | Transcription antitermination protein NusB | 2.23e-07 | 1.64e-30 | 0.016 | NA |
| 4. PB | Q607V0 | Transcription antitermination protein NusB | 2.56e-08 | 3.47e-12 | 4.21e-04 | NA |
| 4. PB | B2SNW5 | Transcription antitermination protein NusB | 6.05e-11 | 3.78e-21 | 0.001 | NA |
| 4. PB | A3MYS3 | Transcription antitermination protein NusB | 1.33e-11 | 8.29e-34 | 0.003 | NA |
| 4. PB | B8D9P0 | Transcription antitermination protein NusB | 2.73e-11 | 8.95e-27 | 0.024 | NA |
| 4. PB | B5YE05 | Transcription antitermination protein NusB | 3.07e-10 | 2.35e-11 | 6.05e-05 | NA |
| 4. PB | A1V1K4 | Transcription antitermination protein NusB | 2.71e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | B8DJF1 | Transcription antitermination protein NusB | 3.48e-11 | 1.47e-23 | 0.002 | NA |
| 4. PB | A8F0S0 | Transcription antitermination protein NusB | 2.25e-11 | 5.07e-32 | 8.72e-04 | NA |
| 4. PB | B4RJT3 | Transcription antitermination protein NusB | 4.13e-12 | 3.26e-23 | 0.001 | NA |
| 4. PB | Q7W142 | Transcription antitermination protein NusB | 1.16e-11 | 3.57e-20 | 2.39e-04 | NA |
| 4. PB | B8I3B0 | Transcription antitermination protein NusB | 1.39e-12 | 1.08e-18 | 1.95e-04 | NA |
| 4. PB | B7NJ81 | Transcription antitermination protein NusB | 5.39e-12 | 4.99e-26 | 0.003 | NA |
| 4. PB | B7HNU5 | Transcription antitermination protein NusB | 1.90e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | Q5P3H4 | Transcription antitermination protein NusB | 2.14e-12 | 7.03e-21 | 3.34e-04 | NA |
| 4. PB | A9M2W7 | Transcription antitermination protein NusB | 4.10e-12 | 2.77e-22 | 0.001 | NA |
| 4. PB | Q0BHJ8 | Transcription antitermination protein NusB | 1.62e-12 | 1.37e-20 | 2.88e-07 | NA |
| 4. PB | B0KL71 | Transcription antitermination protein NusB | 6.15e-11 | 1.73e-13 | 0.012 | NA |
| 4. PB | Q71ZW3 | Transcription antitermination protein NusB | 9.52e-13 | 1.13e-25 | 6.18e-05 | NA |
| 4. PB | B2T6D1 | Transcription antitermination protein NusB | 1.48e-12 | 9.82e-20 | 6.86e-04 | NA |
| 4. PB | C4LAE0 | Transcription antitermination protein NusB | 9.62e-12 | 2.86e-32 | 2.59e-06 | NA |
| 4. PB | Q3BXH9 | Transcription antitermination protein NusB | 1.80e-11 | 2.59e-17 | 8.26e-04 | NA |
| 4. PB | B8FQ61 | Transcription antitermination protein NusB | 1.76e-12 | 3.54e-18 | 1.72e-06 | NA |
| 4. PB | A2RCS4 | Transcription antitermination protein NusB | 6.28e-09 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | Q3K652 | Transcription antitermination protein NusB | 8.99e-09 | 1.13e-13 | 0.012 | NA |
| 4. PB | Q01T72 | Transcription antitermination protein NusB | 3.75e-12 | 1.37e-22 | 2.41e-08 | NA |
| 4. PB | A3PZ57 | Transcription antitermination protein NusB | 3.22e-11 | 1.38e-15 | 3.99e-11 | NA |
| 4. PB | Q6HDY3 | Transcription antitermination protein NusB | 1.68e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | A7NP12 | Transcription antitermination protein NusB | 5.21e-11 | 1.15e-25 | 0.005 | NA |
| 4. PB | P9WIV1 | Transcription antitermination protein NusB | 1.02e-13 | 1.78e-21 | 1.07e-09 | NA |
| 4. PB | A8EVW4 | Transcription antitermination protein NusB | 1.64e-13 | 5.69e-42 | 5.04e-09 | NA |
| 4. PB | A9R2J9 | Transcription antitermination protein NusB | 4.89e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | Q1JA39 | Transcription antitermination protein NusB | 1.12e-08 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | Q8ZC42 | Transcription antitermination protein NusB | 5.04e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | B0BSK4 | Transcription antitermination protein NusB | 1.20e-11 | 8.29e-34 | 0.003 | NA |
| 4. PB | B7JM33 | Transcription antitermination protein NusB | 1.99e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | C1CCJ6 | Transcription antitermination protein NusB | 1.12e-11 | 4.03e-42 | 2.24e-06 | NA |
| 4. PB | Q89K81 | Transcription antitermination protein NusB | 6.10e-11 | 6.56e-20 | 4.74e-04 | NA |
| 4. PB | C1CIT2 | Transcription antitermination protein NusB | 6.28e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | A5FQ51 | Transcription antitermination protein NusB | 9.08e-11 | 2.76e-26 | 3.69e-07 | NA |
| 4. PB | Q5XA94 | Transcription antitermination protein NusB | 1.59e-08 | 9.85e-36 | 3.26e-04 | NA |
| 4. PB | Q474N5 | Transcription antitermination protein NusB | 5.99e-12 | 1.50e-09 | 1.11e-06 | NA |
| 4. PB | C4K0Q5 | Transcription antitermination protein NusB | 2.30e-11 | 8.99e-31 | 8.72e-04 | NA |
| 4. PB | A0K5D1 | Transcription antitermination protein NusB | 1.66e-12 | 6.60e-21 | 9.71e-07 | NA |
| 4. PB | O83979 | Transcription antitermination protein NusB | 9.70e-11 | 4.16e-38 | 0.002 | NA |
| 4. PB | Q1C4I5 | Transcription antitermination protein NusB | 4.25e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | Q5QVE5 | Transcription antitermination protein NusB | 4.29e-12 | 2.44e-29 | 0.004 | NA |
| 4. PB | A6VPE8 | Transcription antitermination protein NusB | 6.23e-10 | 1.99e-32 | 0.020 | NA |
| 4. PB | B8DTW1 | Transcription antitermination protein NusB | 2.68e-13 | 1.55e-08 | 1.44e-04 | NA |
| 4. PB | Q2RIA9 | Transcription antitermination protein NusB | 2.09e-11 | 5.38e-18 | 3.95e-05 | NA |
| 4. PB | Q8F8T8 | Transcription antitermination protein NusB | 5.64e-11 | 3.81e-32 | 2.76e-08 | NA |
| 4. PB | A7Z6K0 | Transcription antitermination protein NusB | 1.70e-12 | 2.27e-29 | 3.58e-07 | NA |
| 4. PB | Q1CL91 | Transcription antitermination protein NusB | 4.77e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | Q9RSQ7 | Transcription antitermination protein NusB | 2.27e-08 | 1.86e-04 | 2.99e-04 | NA |
| 4. PB | Q6NH08 | Transcription antitermination protein NusB | 2.70e-10 | 8.67e-07 | 0.014 | NA |
| 4. PB | Q8Y1H9 | Transcription antitermination protein NusB | 7.63e-12 | 2.05e-23 | 2.17e-07 | NA |
| 4. PB | P65582 | Transcription antitermination protein NusB | 1.39e-09 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | B8DFW9 | Transcription antitermination protein NusB | 2.83e-12 | 2.18e-25 | 1.29e-04 | NA |
| 4. PB | A5EKH8 | Transcription antitermination protein NusB | 2.28e-08 | 1.21e-18 | 0.001 | NA |
| 4. PB | Q1BYB7 | Transcription antitermination protein NusB | 1.86e-12 | 6.60e-21 | 9.71e-07 | NA |
| 4. PB | A3NCG0 | Transcription antitermination protein NusB | 1.03e-09 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | Q9K0D0 | Transcription antitermination protein NusB | 3.87e-12 | 9.08e-23 | 0.001 | NA |
| 4. PB | Q62HV3 | Transcription antitermination protein NusB | 2.53e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | Q662Q5 | Transcription antitermination protein NusB | 2.55e-10 | 8.87e-28 | 0.001 | NA |
| 4. PB | Q2NZ92 | Transcription antitermination protein NusB | 5.98e-11 | 3.78e-21 | 0.001 | NA |
| 4. PB | P65585 | Transcription antitermination protein NusB | 1.28e-08 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | B0BWD7 | Transcription antitermination protein NusB | 2.42e-11 | 2.88e-29 | 8.46e-04 | NA |
| 4. PB | Q8RAD1 | Transcription antitermination protein NusB | 5.20e-13 | 1.12e-21 | 3.41e-07 | NA |
| 4. PB | Q67NA9 | Transcription antitermination protein NusB | 1.83e-11 | 8.81e-20 | 1.59e-04 | NA |
| 4. PB | A4IQS1 | Transcription antitermination protein NusB | 2.31e-12 | 2.40e-29 | 0.006 | NA |
| 4. PB | Q65HI7 | Transcription antitermination protein NusB | 2.12e-12 | 8.49e-31 | 3.00e-06 | NA |
| 4. PB | B2KE32 | Transcription antitermination protein NusB | 3.62e-11 | 9.33e-32 | 1.13e-05 | NA |
| 4. PB | B5E853 | Transcription antitermination protein NusB | 4.43e-08 | 8.20e-33 | 1.16e-04 | NA |
| 4. PB | B2U7E9 | Transcription antitermination protein NusB | 1.53e-12 | 3.55e-21 | 3.60e-07 | NA |
| 4. PB | B4SJC1 | Transcription antitermination protein NusB | 1.04e-11 | 9.97e-21 | 0.007 | NA |
| 4. PB | B7IXH3 | Transcription antitermination protein NusB | 1.79e-11 | 6.95e-34 | 1.17e-04 | NA |
| 4. PB | Q24UY9 | Transcription antitermination protein NusB | 1.45e-12 | 3.54e-18 | 1.72e-06 | NA |
| 4. PB | C6DB34 | Transcription antitermination protein NusB | 5.29e-12 | 1.49e-25 | 0.020 | NA |
| 4. PB | Q04Q78 | Transcription antitermination protein NusB | 7.00e-11 | 6.41e-31 | 3.33e-07 | NA |
| 4. PB | A1TYX3 | Transcription antitermination protein NusB | 1.73e-11 | 4.37e-18 | 0.009 | NA |
| 4. PB | A8GQY9 | Transcription antitermination protein NusB | 2.83e-11 | 2.88e-29 | 8.46e-04 | NA |
| 4. PB | Q57DY0 | Transcription antitermination protein NusB | 6.43e-09 | 1.77e-19 | 0.003 | NA |
| 4. PB | A7GSK0 | Transcription antitermination protein NusB | 1.07e-11 | 2.27e-34 | 2.48e-04 | NA |
| 4. PB | Q1AW09 | Transcription antitermination protein NusB | 3.27e-13 | 2.78e-20 | 0.007 | NA |
| 4. PB | B1J3F6 | Transcription antitermination protein NusB | 1.93e-09 | 2.20e-13 | 0.021 | NA |
| 4. PB | A5VXW1 | Transcription antitermination protein NusB | 2.07e-09 | 1.73e-13 | 0.012 | NA |
| 4. PB | B4UIM1 | Transcription antitermination protein NusB | 1.04e-11 | 1.01e-26 | 2.92e-07 | NA |
| 4. PB | B1JX75 | Transcription antitermination protein NusB | 1.66e-12 | 6.60e-21 | 9.71e-07 | NA |
| 4. PB | Q1LJV8 | Transcription antitermination protein NusB | 7.61e-12 | 4.19e-09 | 5.95e-07 | NA |
| 4. PB | A8F7D4 | Transcription antitermination protein NusB | 3.94e-13 | 1.11e-26 | 1.53e-09 | NA |
| 4. PB | C0MBK2 | Transcription antitermination protein NusB | 3.23e-08 | 7.92e-37 | 6.30e-06 | NA |
| 4. PB | B1XIZ3 | Transcription antitermination protein NusB | 8.92e-08 | 1.10e-03 | 1.94e-06 | NA |
| 4. PB | Q0VMI0 | Transcription antitermination protein NusB | 1.03e-12 | 1.11e-20 | 3.72e-05 | NA |
| 4. PB | Q1J532 | Transcription antitermination protein NusB | 3.17e-08 | 4.86e-35 | 3.13e-04 | NA |
| 4. PB | Q87AS8 | Transcription antitermination protein NusB | 7.80e-14 | 2.53e-20 | 2.84e-04 | NA |
| 4. PB | C1ERQ5 | Transcription antitermination protein NusB | 1.78e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | Q9CHN4 | Transcription antitermination protein NusB | 2.14e-08 | 1.32e-03 | 4.60e-10 | NA |
| 4. PB | Q1WUJ4 | Transcription antitermination protein NusB | 1.16e-13 | 2.58e-37 | 5.52e-08 | NA |
| 4. PB | B0CL95 | Transcription antitermination protein NusB | 2.39e-09 | 2.03e-19 | 0.003 | NA |
| 4. PB | A0LI21 | Transcription antitermination protein NusB | 6.76e-12 | 4.58e-20 | 0.004 | NA |
| 4. PB | Q30YL1 | Transcription antitermination protein NusB | 1.16e-10 | 7.15e-28 | 5.21e-04 | NA |
| 4. PB | B9DVJ4 | Transcription antitermination protein NusB | 1.81e-08 | 1.80e-43 | 1.27e-04 | NA |
| 4. PB | Q48RL8 | Transcription antitermination protein NusB | 2.12e-08 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | C5BS84 | Transcription antitermination protein NusB | 2.67e-12 | 5.23e-25 | 0.030 | NA |
| 4. PB | A5G3J8 | Transcription antitermination protein NusB | 2.80e-12 | 2.32e-36 | 0.002 | NA |
| 4. PB | B1I9M4 | Transcription antitermination protein NusB | 6.82e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | C3LJV6 | Transcription antitermination protein NusB | 1.58e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | C3P7W1 | Transcription antitermination protein NusB | 1.56e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | Q493G9 | Transcription antitermination protein NusB | 9.21e-12 | 4.80e-21 | 0.011 | NA |
| 4. PB | P74395 | Transcription antitermination protein NusB | 2.29e-07 | 6.15e-03 | 0.014 | NA |
| 4. PB | P57535 | Transcription antitermination protein NusB | 2.20e-11 | 4.57e-26 | 0.025 | NA |
| 4. PB | A6QBK6 | Transcription antitermination protein NusB | 2.62e-13 | 1.11e-39 | 1.70e-09 | NA |
| 4. PB | A0RIH4 | Transcription antitermination protein NusB | 1.95e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | B2I8Q4 | Transcription antitermination protein NusB | 1.18e-13 | 2.53e-20 | 2.84e-04 | NA |
| 4. PB | Q83BT5 | Transcription antitermination protein NusB | 3.28e-13 | 9.33e-32 | 0.023 | NA |
| 4. PB | Q1QMB4 | Transcription antitermination protein NusB | 7.20e-11 | 3.52e-24 | 1.47e-04 | NA |
| 4. PB | Q3A4L2 | Transcription antitermination protein NusB | 3.93e-11 | 7.37e-34 | 0.002 | NA |
| 4. PB | A6W2L6 | Transcription antitermination protein NusB | 7.75e-10 | 1.72e-11 | 0.002 | NA |
| 4. PB | A8ZTU6 | Transcription antitermination protein NusB | 2.11e-13 | 1.09e-14 | 3.12e-08 | NA |
| 4. PB | Q8G1E7 | Transcription antitermination protein NusB | 4.98e-11 | 4.80e-19 | 0.003 | NA |
| 4. PB | Q9PES3 | Transcription antitermination protein NusB | 1.45e-13 | 1.38e-19 | 3.70e-04 | NA |
| 4. PB | B8D7Z2 | Transcription antitermination protein NusB | 2.32e-11 | 8.95e-27 | 0.024 | NA |
| 4. PB | Q04M45 | Transcription antitermination protein NusB | 6.45e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | B3WEY5 | Transcription antitermination protein NusB | 3.49e-12 | 5.27e-29 | 1.04e-04 | NA |
| 4. PB | A9ET18 | Transcription antitermination protein NusB | 2.56e-12 | 4.32e-28 | 6.22e-04 | NA |
| 4. PB | B0RVD1 | Transcription antitermination protein NusB | 2.69e-11 | 1.03e-18 | 0.001 | NA |
| 4. PB | Q214H2 | Transcription antitermination protein NusB | 2.18e-08 | 1.14e-18 | 4.52e-05 | NA |
| 4. PB | A1VEL1 | Transcription antitermination protein NusB | 1.02e-12 | 2.41e-27 | 2.84e-05 | NA |
| 4. PB | Q7WNT2 | Transcription antitermination protein NusB | 1.08e-11 | 3.57e-20 | 2.39e-04 | NA |
| 4. PB | B1LAQ8 | Transcription antitermination protein NusB | 4.86e-12 | 5.84e-31 | 3.61e-06 | NA |
| 4. PB | C4ZCZ0 | Transcription antitermination protein NusB | 3.83e-13 | 2.67e-36 | 1.26e-04 | NA |
| 4. PB | B1JIE1 | Transcription antitermination protein NusB | 5.04e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | Q9X286 | Transcription antitermination protein NusB | 6.16e-11 | 3.13e-31 | 2.09e-05 | NA |
| 4. PB | A4X612 | Transcription antitermination protein NusB | 8.93e-14 | 1.64e-36 | 1.29e-04 | NA |
| 4. PB | B0REX0 | Transcription antitermination protein NusB | 2.33e-14 | 8.18e-31 | 3.01e-06 | NA |
| 4. PB | Q635A2 | Transcription antitermination protein NusB | 1.86e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | B9LDT2 | Transcription antitermination protein NusB | 2.84e-11 | 6.78e-28 | 0.002 | NA |
| 4. PB | P45150 | Transcription antitermination protein NusB | 1.23e-09 | 2.93e-27 | 0.018 | NA |
| 4. PB | P54520 | Transcription antitermination protein NusB | 1.83e-12 | 9.53e-28 | 1.82e-06 | NA |
| 4. PB | Q8YGH3 | Transcription antitermination protein NusB | 2.16e-11 | 5.61e-20 | 0.003 | NA |
| 4. PB | B2S518 | Transcription antitermination protein NusB | 4.68e-11 | 1.77e-19 | 0.003 | NA |
| 4. PB | B9M1E7 | Transcription antitermination protein NusB | 4.77e-11 | 2.78e-36 | 0.007 | NA |
| 4. PB | Q4UQU4 | Transcription antitermination protein NusB | 4.45e-11 | 1.03e-18 | 0.001 | NA |
| 4. PB | A7HZG1 | Transcription antitermination protein NusB | 1.04e-12 | 7.75e-41 | 1.15e-08 | NA |
| 4. PB | B2JED0 | Transcription antitermination protein NusB | 2.17e-12 | 7.93e-19 | 3.28e-05 | NA |
| 4. PB | B2S4Q2 | Transcription antitermination protein NusB | 2.99e-13 | 4.16e-38 | 0.002 | NA |
| 4. PB | A1SUU6 | Transcription antitermination protein NusB | 1.73e-11 | 1.05e-26 | 1.74e-05 | NA |
| 4. PB | A9KMC2 | Transcription antitermination protein NusB | 7.22e-13 | 1.07e-40 | 2.38e-05 | NA |
| 4. PB | A1K279 | Transcription antitermination protein NusB | 1.11e-11 | 6.24e-14 | 1.02e-04 | NA |
| 4. PB | Q72V97 | Transcription antitermination protein NusB | 7.95e-11 | 3.81e-32 | 2.76e-08 | NA |
| 4. PB | Q054N4 | Transcription antitermination protein NusB | 7.12e-11 | 6.41e-31 | 3.33e-07 | NA |
| 4. PB | Q65TX8 | Transcription antitermination protein NusB | 1.31e-09 | 2.29e-30 | 0.008 | NA |
| 4. PB | A0KNG6 | Transcription antitermination protein NusB | 1.16e-11 | 1.76e-30 | 2.15e-05 | NA |
| 4. PB | Q2LQK4 | Transcription antitermination protein NusB | 6.00e-11 | 1.16e-19 | 0.005 | NA |
| 4. PB | A9AF25 | Transcription antitermination protein NusB | 2.24e-12 | 1.21e-20 | 1.13e-07 | NA |
| 4. PB | B5ZXV2 | Transcription antitermination protein NusB | 7.58e-13 | 4.04e-20 | 6.62e-05 | NA |
| 4. PB | Q63RP4 | Transcription antitermination protein NusB | 2.79e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | B2FNL4 | Transcription antitermination protein NusB | 1.35e-11 | 1.08e-20 | 0.007 | NA |
| 4. PB | Q6N688 | Transcription antitermination protein NusB | 8.63e-11 | 8.59e-17 | 0.010 | NA |
| 4. PB | Q1QUC9 | Transcription antitermination protein NusB | 6.51e-11 | 1.13e-18 | 0.004 | NA |
| 4. PB | A9N8T6 | Transcription antitermination protein NusB | 3.23e-13 | 9.33e-32 | 0.023 | NA |
| 4. PB | Q1JK87 | Transcription antitermination protein NusB | 1.14e-08 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | Q8PCM6 | Transcription antitermination protein NusB | 2.79e-11 | 1.03e-18 | 0.001 | NA |
| 4. PB | A8GAN8 | Transcription antitermination protein NusB | 5.14e-12 | 1.41e-29 | 7.07e-05 | NA |
| 4. PB | Q6D847 | Transcription antitermination protein NusB | 5.57e-12 | 1.96e-25 | 0.004 | NA |
| 4. PB | B0C5Q2 | Transcription antitermination protein NusB | 7.09e-08 | 3.08e-02 | 0.012 | NA |
| 4. PB | Q731B1 | Transcription antitermination protein NusB | 1.73e-11 | 6.38e-33 | 1.12e-04 | NA |
| 4. PB | Q1LSN4 | Transcription antitermination protein NusB | 1.51e-12 | 2.85e-28 | 1.95e-06 | NA |
| 4. PB | B7IH57 | Transcription antitermination protein NusB | 3.47e-11 | 3.18e-33 | 8.25e-08 | NA |
| 4. PB | A2S9D3 | Transcription antitermination protein NusB | 2.71e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | B8H535 | Transcription antitermination protein NusB | 3.55e-13 | 3.83e-36 | 2.58e-09 | NA |
| 4. PB | A7HJ80 | Transcription antitermination protein NusB | 1.85e-13 | 1.66e-26 | 1.25e-10 | NA |
| 4. PB | B5YHQ2 | Transcription antitermination protein NusB | 9.46e-13 | 4.55e-30 | 0.001 | NA |
| 4. PB | Q3SGU8 | Transcription antitermination protein NusB | 7.17e-13 | 5.91e-21 | 1.03e-05 | NA |
| 4. PB | A9KBN6 | Transcription antitermination protein NusB | 3.41e-13 | 9.33e-32 | 0.023 | NA |
| 4. PB | C0QKW6 | Transcription antitermination protein NusB | 1.03e-12 | 9.20e-30 | 1.52e-06 | NA |
| 4. PB | Q1JF82 | Transcription antitermination protein NusB | 1.21e-08 | 4.15e-36 | 3.01e-04 | NA |
| 4. PB | Q0AZF7 | Transcription antitermination protein NusB | 1.81e-12 | 6.96e-38 | 1.42e-06 | NA |
| 4. PB | B3E757 | Transcription antitermination protein NusB | 3.73e-12 | 6.66e-20 | 9.06e-06 | NA |
| 4. PB | B0U4K2 | Transcription antitermination protein NusB | 1.31e-11 | 1.45e-19 | 3.97e-04 | NA |
| 4. PB | Q8PPD5 | Transcription antitermination protein NusB | 7.68e-11 | 2.03e-20 | 8.79e-04 | NA |
| 4. PB | C3KXC7 | Transcription antitermination protein NusB | 2.34e-13 | 3.27e-29 | 0.002 | NA |
| 4. PB | Q30TJ7 | Transcription antitermination protein NusB | 1.63e-13 | 8.46e-40 | 2.27e-08 | NA |
| 4. PB | B0JGZ3 | Transcription antitermination protein NusB | 7.12e-08 | 2.48e-05 | 4.90e-07 | NA |
| 4. PB | Q13V35 | Transcription antitermination protein NusB | 1.05e-12 | 4.17e-20 | 0.001 | NA |
| 4. PB | Q4K597 | Transcription antitermination protein NusB | 7.43e-09 | 1.64e-13 | 0.041 | NA |
| 4. PB | A8FF16 | Transcription antitermination protein NusB | 3.14e-13 | 8.87e-30 | 6.56e-06 | NA |
| 4. PB | C1FPB3 | Transcription antitermination protein NusB | 6.25e-14 | 1.17e-29 | 0.001 | NA |
| 4. PB | Q72CT6 | Transcription antitermination protein NusB | 8.05e-13 | 2.41e-27 | 2.84e-05 | NA |
| 4. PB | C1CVC5 | Transcription antitermination protein NusB | 3.33e-12 | 2.79e-21 | 3.29e-04 | NA |
| 4. PB | Q7VNQ2 | Transcription antitermination protein NusB | 2.55e-12 | 3.37e-33 | 0.013 | NA |
| 4. PB | Q1MIT2 | Transcription antitermination protein NusB | 2.19e-12 | 5.79e-20 | 4.71e-04 | NA |
| 4. PB | A4J3F1 | Transcription antitermination protein NusB | 2.53e-11 | 2.00e-20 | 0.004 | NA |
| 4. PB | A7HDY2 | Transcription antitermination protein NusB | 3.86e-12 | 7.85e-26 | 9.00e-09 | NA |
| 4. PB | Q9JVD5 | Transcription antitermination protein NusB | 3.77e-12 | 4.59e-22 | 0.001 | NA |
| 4. PB | B5XI30 | Transcription antitermination protein NusB | 9.97e-09 | 6.47e-36 | 3.33e-04 | NA |
| 4. PB | Q3JZJ6 | Transcription antitermination protein NusB | 1.05e-08 | 1.43e-36 | 1.30e-05 | NA |
| 4. PB | Q99Y88 | Transcription antitermination protein NusB | 2.48e-08 | 4.15e-36 | 3.10e-04 | NA |
| 4. PB | Q3ZYI9 | Transcription antitermination protein NusB | 9.59e-11 | 2.76e-26 | 3.69e-07 | NA |
| 4. PB | B1YUJ1 | Transcription antitermination protein NusB | 1.83e-12 | 1.37e-20 | 2.88e-07 | NA |
| 4. PB | A4YW92 | Transcription antitermination protein NusB | 5.70e-11 | 9.97e-19 | 0.001 | NA |
| 4. PB | Q5LY62 | Transcription antitermination protein NusB | 2.65e-08 | 1.56e-39 | 5.99e-05 | NA |
| 4. PB | Q2FY45 | Transcription antitermination protein NusB | 8.15e-14 | 8.47e-35 | 1.65e-07 | NA |
| 4. PB | Q8GIR7 | Transcription antitermination protein NusB | 2.46e-07 | 5.60e-03 | 4.31e-05 | NA |
| 4. PB | B8E246 | Transcription antitermination protein NusB | 7.48e-10 | 7.19e-12 | 7.83e-04 | NA |
| 4. PB | Q0K7T8 | Transcription antitermination protein NusB | 1.12e-11 | 6.06e-09 | 1.39e-06 | NA |
| 4. PB | B1I3I9 | Transcription antitermination protein NusB | 2.03e-12 | 6.78e-31 | 1.64e-04 | NA |
| 4. PB | Q5WF59 | Transcription antitermination protein NusB | 1.89e-11 | 7.51e-30 | 4.88e-04 | NA |
| 4. PB | Q2YNC5 | Transcription antitermination protein NusB | 3.45e-11 | 1.77e-19 | 0.003 | NA |
| 4. PB | A1R700 | Transcription antitermination protein NusB | 2.85e-13 | 1.36e-27 | 2.73e-06 | NA |
| 4. PB | P65580 | Transcription antitermination protein NusB | 3.24e-08 | 1.43e-36 | 1.30e-05 | NA |
| 4. PB | B8ZLJ7 | Transcription antitermination protein NusB | 1.01e-11 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | C5C681 | Transcription antitermination protein NusB | 9.21e-14 | 6.66e-22 | 2.36e-08 | NA |
| 4. PB | Q1D350 | Transcription antitermination protein NusB | 7.84e-11 | 6.33e-37 | 2.49e-07 | NA |
| 4. PB | A9AXI5 | Transcription antitermination protein NusB | 5.82e-11 | 4.35e-32 | 9.45e-05 | NA |
| 4. PB | B7LMH1 | Transcription antitermination protein NusB | 5.75e-12 | 7.32e-26 | 0.014 | NA |
| 4. PB | A8GV61 | Transcription antitermination protein NusB | 2.06e-07 | 1.64e-30 | 0.016 | NA |
| 4. PB | Q2ILH8 | Transcription antitermination protein NusB | 1.21e-11 | 1.01e-26 | 2.92e-07 | NA |
| 4. PB | A5UCB7 | Transcription antitermination protein NusB | 1.09e-09 | 4.64e-28 | 0.021 | NA |
| 4. PB | Q8YW56 | Transcription antitermination protein NusB | 7.80e-07 | 7.05e-03 | 4.26e-05 | NA |
| 4. PB | Q38XV0 | Transcription antitermination protein NusB | 1.10e-09 | 8.23e-36 | 0.028 | NA |
| 4. PB | B1XF04 | Transcription antitermination protein NusB | 6.86e-12 | 4.99e-26 | 0.003 | NA |
| 4. PB | B2V4R8 | Transcription antitermination protein NusB | 1.99e-13 | 6.71e-39 | 9.84e-05 | NA |
| 4. PB | Q479L3 | Transcription antitermination protein NusB | 2.25e-09 | 9.10e-19 | 2.04e-05 | NA |
| 4. PB | A9VGW4 | Transcription antitermination protein NusB | 1.26e-11 | 5.50e-34 | 0.001 | NA |
| 4. PB | Q983A9 | Transcription antitermination protein NusB | 9.14e-12 | 4.72e-29 | 0.002 | NA |
| 4. PB | Q88WM9 | Transcription antitermination protein NusB | 2.53e-13 | 3.43e-34 | 3.51e-04 | NA |
| 4. PB | Q1ISD3 | Transcription antitermination protein NusB | 4.92e-13 | 1.15e-26 | 1.35e-10 | NA |
| 4. PB | Q66DV7 | Transcription antitermination protein NusB | 4.92e-12 | 3.48e-28 | 6.72e-04 | NA |
| 4. PB | P65583 | Transcription antitermination protein NusB | 7.91e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | Q836W8 | Transcription antitermination protein NusB | 7.60e-10 | 1.43e-29 | 8.84e-05 | NA |
| 4. PB | A4TBX3 | Transcription antitermination protein NusB | 6.89e-13 | 3.22e-11 | 1.00e-10 | NA |
| 4. PB | A5ILJ7 | Transcription antitermination protein NusB | 4.98e-12 | 9.33e-31 | 1.11e-05 | NA |
| 4. PB | Q5GW16 | Transcription antitermination protein NusB | 5.39e-11 | 3.78e-21 | 0.001 | NA |
| 4. PB | Q03RR0 | Transcription antitermination protein NusB | 2.51e-12 | 4.26e-27 | 0.004 | NA |
| 4. PB | B8JEW3 | Transcription antitermination protein NusB | 1.25e-11 | 1.01e-26 | 2.92e-07 | NA |
| 4. PB | Q9K965 | Transcription antitermination protein NusB | 2.56e-11 | 2.26e-28 | 5.88e-06 | NA |
| 4. PB | Q5N1J7 | Transcription antitermination protein NusB | 2.50e-07 | 5.60e-03 | 4.31e-05 | NA |
| 4. PB | C1L2R5 | Transcription antitermination protein NusB | 9.85e-13 | 1.13e-25 | 6.18e-05 | NA |
| 4. PB | C4L3F7 | Transcription antitermination protein NusB | 5.99e-12 | 2.98e-37 | 1.42e-07 | NA |
| 4. PB | A6X1Y4 | Transcription antitermination protein NusB | 5.91e-11 | 9.98e-22 | 0.003 | NA |
| 4. PB | Q39V65 | Transcription antitermination protein NusB | 2.66e-09 | 3.24e-34 | 0.002 | NA |
| 4. PB | Q118A6 | Transcription antitermination protein NusB | 6.93e-08 | 1.64e-03 | 0.001 | NA |
| 4. PB | Q2YD50 | Transcription antitermination protein NusB | 1.39e-12 | 1.39e-23 | 0.004 | NA |
| 4. PB | P0A780 | Transcription antitermination protein NusB | 5.48e-12 | 4.99e-26 | 0.003 | NA |
| 4. PB | Q2IWR9 | Transcription antitermination protein NusB | 1.09e-10 | 9.70e-16 | 0.001 | NA |
| 4. PB | C5CPZ2 | Transcription antitermination protein NusB | 1.04e-11 | 2.44e-06 | 0.005 | NA |
| 4. PB | Q5F9Y0 | Transcription antitermination protein NusB | 4.16e-12 | 3.26e-23 | 0.001 | NA |
| 4. PB | B3QJK9 | Transcription antitermination protein NusB | 4.57e-11 | 2.57e-16 | 0.009 | NA |
| 4. PB | B0SB76 | Transcription antitermination protein NusB | 1.39e-10 | 9.78e-27 | 0.023 | NA |
| 4. PB | Q3II29 | Transcription antitermination protein NusB | 8.76e-12 | 4.61e-38 | 1.02e-06 | NA |
| 4. PB | Q1MS16 | Transcription antitermination protein NusB | 4.38e-11 | 1.34e-25 | 0.003 | NA |
| 4. PB | A3NY89 | Transcription antitermination protein NusB | 2.74e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | B7HB53 | Transcription antitermination protein NusB | 1.80e-11 | 6.95e-34 | 1.17e-04 | NA |
| 4. PB | Q9A8J3 | Transcription antitermination protein NusB | 9.20e-10 | 3.83e-36 | 2.58e-09 | NA |
| 4. PB | Q8FT35 | Transcription antitermination protein NusB | 3.05e-10 | 3.23e-05 | 0.004 | NA |
| 4. PB | A8LY11 | Transcription antitermination protein NusB | 5.26e-14 | 1.33e-35 | 5.95e-05 | NA |
| 4. PB | C5BCH6 | Transcription antitermination protein NusB | 4.78e-12 | 1.01e-27 | 0.005 | NA |
| 4. PB | B8F8R7 | Transcription antitermination protein NusB | 1.31e-11 | 1.66e-34 | 0.038 | NA |
| 4. PB | A3MMR4 | Transcription antitermination protein NusB | 1.04e-09 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | Q74CI1 | Transcription antitermination protein NusB | 1.10e-09 | 6.38e-33 | 2.88e-04 | NA |
| 4. PB | C0RIA7 | Transcription antitermination protein NusB | 2.22e-11 | 1.77e-19 | 0.003 | NA |
| 4. PB | A6LLA7 | Transcription antitermination protein NusB | 4.34e-11 | 8.99e-31 | 3.22e-07 | NA |
| 4. PB | B9IXH5 | Transcription antitermination protein NusB | 1.67e-11 | 3.18e-33 | 1.26e-04 | NA |
| 4. PB | B8HYJ8 | Transcription antitermination protein NusB | 3.91e-07 | 1.75e-04 | 3.99e-08 | NA |
| 4. PB | B2G851 | Transcription antitermination protein NusB | 1.48e-12 | 4.25e-33 | 3.16e-04 | NA |
| 4. PB | B7K4P4 | Transcription antitermination protein NusB | 1.18e-07 | 3.14e-03 | 8.47e-07 | NA |
| 4. PB | Q4UKG1 | Transcription antitermination protein NusB | 2.24e-11 | 7.15e-32 | 0.004 | NA |
| 4. PB | Q68XK6 | Transcription antitermination protein NusB | 1.13e-07 | 2.19e-29 | 0.002 | NA |
| 4. PB | A5UF14 | Transcription antitermination protein NusB | 1.19e-09 | 2.93e-27 | 0.018 | NA |
| 4. PB | B0K9D9 | Transcription antitermination protein NusB | 6.50e-13 | 2.93e-21 | 2.12e-05 | NA |
| 4. PB | Q3Z709 | Transcription antitermination protein NusB | 5.90e-11 | 4.50e-26 | 2.87e-07 | NA |
| 4. PB | Q8DKS0 | Transcription antitermination protein NusB | 3.17e-08 | 1.07e-02 | 3.33e-04 | NA |
| 4. PB | A0LUG6 | Transcription antitermination protein NusB | 1.05e-13 | 7.12e-13 | 0.004 | NA |
| 4. PB | Q5M2R7 | Transcription antitermination protein NusB | 1.58e-08 | 1.56e-39 | 5.99e-05 | NA |
| 4. PB | Q82S07 | Transcription antitermination protein NusB | 2.10e-11 | 1.49e-16 | 4.21e-05 | NA |
| 4. PB | Q7NVF2 | Transcription antitermination protein NusB | 5.26e-11 | 1.25e-16 | 1.42e-04 | NA |
| 4. PB | A5I310 | Transcription antitermination protein NusB | 6.33e-13 | 3.27e-29 | 0.002 | NA |
| 4. PB | B6HZL7 | Transcription antitermination protein NusB | 5.90e-12 | 4.99e-26 | 0.003 | NA |
| 4. PB | Q4QKN1 | Transcription antitermination protein NusB | 1.12e-09 | 3.52e-29 | 0.006 | NA |
| 4. PB | Q97HC8 | Transcription antitermination protein NusB | 2.39e-13 | 6.25e-32 | 0.003 | NA |
| 4. PB | B4EU20 | Transcription antitermination protein NusB | 5.26e-12 | 2.64e-31 | 0.004 | NA |
| 4. PB | Q2SYC5 | Transcription antitermination protein NusB | 2.70e-10 | 2.42e-21 | 2.13e-07 | NA |
| 4. PB | C1CPU1 | Transcription antitermination protein NusB | 8.26e-12 | 5.39e-41 | 2.02e-06 | NA |
| 4. PB | C1DB31 | Transcription antitermination protein NusB | 1.70e-11 | 3.25e-03 | 3.26e-05 | NA |
| 4. PB | C3PMK2 | Transcription antitermination protein NusB | 1.96e-11 | 4.24e-31 | 7.96e-04 | NA |
| 4. PB | P0DC77 | Transcription antitermination protein NusB | 6.80e-09 | 7.44e-36 | 2.95e-04 | NA |
| 4. PB | Q7VTN3 | Transcription antitermination protein NusB | 5.06e-12 | 3.57e-20 | 2.39e-04 | NA |
| 4. PB | A1S4C1 | Transcription antitermination protein NusB | 2.34e-12 | 1.23e-35 | 1.15e-06 | NA |
| 4. PB | A5URZ1 | Transcription antitermination protein NusB | 2.29e-11 | 7.50e-24 | 0.008 | NA |
| 4. PB | A5VPV2 | Transcription antitermination protein NusB | 5.00e-11 | 4.80e-19 | 0.003 | NA |
| 4. PB | B0ST01 | Transcription antitermination protein NusB | 1.51e-10 | 9.78e-27 | 0.023 | NA |
| 5. P | Q8G9G3 | Transcription antitermination protein NusB | 4.83e-12 | 1.13e-28 | NA | NA |
| 5. P | Q3ATI5 | Transcription antitermination protein NusB | 2.23e-10 | 7.42e-06 | NA | NA |
| 5. P | Q1H424 | Transcription antitermination protein NusB | 1.17e-11 | 2.23e-19 | NA | NA |
| 5. P | B0UU23 | Transcription antitermination protein NusB | 2.37e-09 | 1.11e-33 | NA | NA |
| 5. P | B3EM81 | Transcription antitermination protein NusB | 9.66e-11 | 3.08e-04 | NA | NA |
| 5. P | B0B961 | Transcription antitermination protein NusB | 5.80e-10 | 6.58e-12 | NA | NA |
| 5. P | A4XLC1 | Transcription antitermination protein NusB | 2.41e-09 | 8.30e-16 | NA | NA |
| 5. P | B6J8Q7 | Transcription antitermination protein NusB | 3.07e-13 | 4.79e-32 | NA | NA |
| 5. P | Q7MN52 | Transcription antitermination protein NusB | 1.07e-11 | 3.36e-28 | NA | NA |
| 5. P | C0Q7U3 | Transcription antitermination protein NusB | 5.19e-12 | 5.54e-26 | NA | NA |
| 5. P | Q9Z6S0 | Transcription antitermination protein NusB | 2.42e-12 | 3.08e-19 | NA | NA |
| 5. P | C3K2R8 | Transcription antitermination protein NusB | 1.17e-10 | 1.82e-13 | NA | NA |
| 5. P | P47273 | Uncharacterized protein MG027 | 3.56e-11 | 2.21e-11 | NA | NA |
| 5. P | B7VJA4 | Transcription antitermination protein NusB | 4.97e-12 | 4.39e-30 | NA | NA |
| 5. P | Q9KPU5 | Transcription antitermination protein NusB | 8.97e-12 | 2.34e-28 | NA | NA |
| 5. P | Q21V17 | Transcription antitermination protein NusB | 4.03e-09 | 6.85e-11 | NA | NA |
| 5. P | Q5WYH2 | Transcription antitermination protein NusB | 8.74e-12 | 9.65e-24 | NA | NA |
| 5. P | Q7NKZ0 | Transcription antitermination protein NusB | 3.37e-07 | 1.16e-06 | NA | NA |
| 5. P | A4SG66 | Transcription antitermination protein NusB | 3.63e-10 | 1.77e-08 | NA | NA |
| 5. P | B0VPT9 | Transcription antitermination protein NusB | 9.76e-12 | 2.05e-26 | NA | NA |
| 5. P | B0BAU0 | Transcription antitermination protein NusB | 6.17e-10 | 6.58e-12 | NA | NA |
| 5. P | C3LQ39 | Transcription antitermination protein NusB | 6.94e-12 | 2.34e-28 | NA | NA |
| 5. P | Q8DFA0 | Transcription antitermination protein NusB | 4.72e-12 | 3.36e-28 | NA | NA |
| 5. P | B4SCZ7 | Transcription antitermination protein NusB | 1.91e-10 | 1.37e-04 | NA | NA |
| 5. P | A7MWU1 | Transcription antitermination protein NusB | 5.54e-12 | 3.42e-28 | NA | NA |
| 5. P | B6EIA0 | Transcription antitermination protein NusB | 4.90e-12 | 5.67e-29 | NA | NA |
| 5. P | Q3KKK7 | Transcription antitermination protein NusB | 3.50e-10 | 6.74e-12 | NA | NA |
| 5. P | B2VHS8 | Transcription antitermination protein NusB | 5.94e-12 | 7.15e-28 | NA | NA |
| 5. P | Q6LU11 | Transcription antitermination protein NusB | 1.11e-11 | 3.27e-29 | NA | NA |
| 5. P | Q129J0 | Transcription antitermination protein NusB | 1.15e-08 | 7.40e-07 | NA | NA |
| 5. P | A5F5Z6 | Transcription antitermination protein NusB | 6.76e-12 | 2.34e-28 | NA | NA |
| 5. P | Q6F6V2 | Transcription antitermination protein NusB | 1.05e-11 | 1.81e-27 | NA | NA |
| 5. P | B9MBL7 | Transcription antitermination protein NusB | 2.21e-11 | 1.21e-08 | NA | NA |
| 5. P | Q5SJ93 | Transcription antitermination protein NusB | 8.29e-11 | 2.91e-22 | NA | NA |
| 5. P | Q2G467 | Transcription antitermination protein NusB | 4.48e-13 | 1.58e-32 | NA | NA |
| 5. P | B4S517 | Transcription antitermination protein NusB | 4.89e-11 | 1.62e-04 | NA | NA |
| 5. P | Q72JL6 | Transcription antitermination protein NusB | 8.40e-11 | 2.91e-22 | NA | NA |
| 5. P | Q7VRI1 | Transcription antitermination protein NusB | 2.86e-12 | 1.53e-31 | NA | NA |
| 5. P | A1W9I4 | Transcription antitermination protein NusB | 7.37e-09 | 1.36e-09 | NA | NA |
| 5. P | B7I252 | Transcription antitermination protein NusB | 8.75e-12 | 1.25e-26 | NA | NA |
| 5. P | Q21F20 | Transcription antitermination protein NusB | 3.65e-13 | 2.57e-20 | NA | NA |
| 5. P | A1BDT2 | Transcription antitermination protein NusB | 2.99e-10 | 3.95e-10 | NA | NA |
| 5. P | Q87RU3 | Transcription antitermination protein NusB | 5.92e-12 | 5.27e-29 | NA | NA |
| 5. P | B4SWR0 | Transcription antitermination protein NusB | 5.36e-12 | 5.54e-26 | NA | NA |
| 5. P | O84839 | Transcription antitermination protein NusB | 4.08e-10 | 4.90e-12 | NA | NA |
| 5. P | Q3B298 | Transcription antitermination protein NusB | 1.83e-10 | 2.69e-10 | NA | NA |
| 5. P | Q9PL88 | Transcription antitermination protein NusB | 1.20e-07 | 2.09e-07 | NA | NA |
| 5. P | B5FBF9 | Transcription antitermination protein NusB | 5.18e-12 | 1.13e-28 | NA | NA |
| 5. P | Q31FT2 | Transcription antitermination protein NusB | 1.59e-11 | 1.05e-21 | NA | NA |
| 5. P | O66530 | Transcription antitermination protein NusB | 5.69e-11 | 2.78e-18 | NA | NA |
| 5. P | Q5E6Z7 | Transcription antitermination protein NusB | 1.33e-11 | 1.13e-28 | NA | NA |
| 5. P | Q1IFL9 | Transcription antitermination protein NusB | 3.03e-09 | 5.93e-13 | NA | NA |
| 5. P | Q8KBS4 | Transcription antitermination protein NusB | 2.85e-10 | 2.20e-08 | NA | NA |
| 5. P | P57868 | Transcription antitermination protein NusB | 7.58e-10 | 1.69e-29 | NA | NA |
| 5. P | Q889Q5 | Transcription antitermination protein NusB | 3.59e-11 | 1.49e-14 | NA | NA |
| 5. P | Q0I3N5 | Transcription antitermination protein NusB | 6.72e-10 | 7.86e-32 | NA | NA |
| 5. P | Q5X720 | Transcription antitermination protein NusB | 7.61e-12 | 9.65e-24 | NA | NA |
| 5. P | B8D2G0 | Transcription antitermination protein NusB | 1.04e-13 | 2.46e-36 | NA | NA |
| 5. P | Q0ABQ3 | Transcription antitermination protein NusB | 1.38e-10 | 1.15e-14 | NA | NA |
| 5. P | B3QLL5 | Transcription antitermination protein NusB | 2.27e-10 | 4.12e-08 | NA | NA |
| 5. P | A3MA35 | Transcription antitermination protein NusB | 1.06e-11 | 1.25e-26 | NA | NA |
| 5. P | Q48DC2 | Transcription antitermination protein NusB | 3.39e-11 | 3.34e-14 | NA | NA |
| 5. P | Q3AAM1 | Transcription antitermination protein NusB | 2.26e-13 | 1.19e-30 | NA | NA |
| 5. P | P59452 | Transcription antitermination protein NusB | 4.90e-12 | 7.02e-28 | NA | NA |
| 5. P | Q4ZMY4 | Transcription antitermination protein NusB | 2.78e-11 | 4.10e-14 | NA | NA |
| 5. P | Q8K9A2 | Transcription antitermination protein NusB | 2.04e-11 | 3.17e-39 | NA | NA |
| 5. P | B2GD68 | Transcription antitermination protein NusB | 8.84e-13 | 1.64e-30 | NA | NA |
| 5. P | A5IGI0 | Transcription antitermination protein NusB | 7.88e-12 | 9.65e-24 | NA | NA |
| 5. P | B0V9X4 | Transcription antitermination protein NusB | 1.09e-11 | 1.25e-26 | NA | NA |
| 5. P | B7GUW2 | Transcription antitermination protein NusB | 9.00e-12 | 1.25e-26 | NA | NA |
| 5. P | B2I2B2 | Transcription antitermination protein NusB | 1.07e-11 | 1.25e-26 | NA | NA |
| 7. B | B0TEI6 | Transcription antitermination protein NusB | 1.30e-09 | NA | 0.024 | NA |
| 7. B | B1WXY6 | Transcription antitermination protein NusB | 4.79e-08 | NA | 3.07e-05 | NA |
| 7. B | Q9CCR9 | Transcription antitermination protein NusB | 6.20e-12 | NA | 1.84e-11 | NA |
| 7. B | B2J3F1 | Transcription antitermination protein NusB | 1.45e-07 | NA | 0.001 | NA |
| 7. B | B8ZUK7 | Transcription antitermination protein NusB | 3.67e-13 | NA | 1.84e-11 | NA |
| 7. B | Q2J830 | Transcription antitermination protein NusB | 4.30e-10 | NA | 0.012 | NA |