Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54617.1
JCVISYN3A_0108
Uncharacterized lipoprotein.
M. mycoides homolog: Q6MUC9.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 15
Unique PROST Go: 15
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 54
Unique PROST Homologs: 54
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
Q45212
(Variable small protein 2) with a FATCAT P-Value: 0.0342 and RMSD of 2.50 angstrom. The sequence alignment identity is 16.3%.
Structural alignment shown in left. Query protein AVX54617.1 colored as red in alignment, homolog Q45212 colored as blue.
Query protein AVX54617.1 is also shown in right top, homolog Q45212 showed in right bottom. They are colored based on secondary structures.
AVX54617.1 MKKLLSIITGFSLLITPSLFAI--SCSS-----KVQVISKFD----DITSI-KNTGAFKNNQAFISRNELKEIVNSNNTTNSST--ASSTAVMTSTSTTS 86 Q45212 MRKRIS-----AIIMT--LFMVFMSCNNGGPELKSDEVAKSDGTVLDLAKISKK---IKDAVEFAAS--VKEI----ETLVKSIDELAKT--IGQKLTKD 82 AVX54617.1 TG---TQPNNND-----AKY--ASE---RLKA-LAANNFTKN-KKQAWDSLQNTSMTFYKKVEPTAVNVLGYEQI-TKDNVEKLEKNLKTVFLVFK-DNT 169 Q45212 TGVLAADANNNNGGLIAGVYGIVTDVGTKLDGLLKVNGISEDIKTKINDS-KSKGTAFLSKVK-------GDDDLCKKDATDAHAKN-----AIDKNDNT 169 AVX54617.1 --K-ETEKLEVELLPEINNGNKVIDNGSLYLDLLEKPENLKLANQKSIIEVLRPEIT-KIKVVLQNTKNNNSTNKEDIKNTEVFNLLIKQLSIYLANTVK 265 Q45212 GGKGKTE-L-IAL-------NTAID------EL------LKAANE--AVEAAIKELTAPVKA--EKPSQNN----------------------------- 215 AVX54617.1 YFNSESGIITTNPTFSYKTRSNQIYDYIVKNKKDELYKKLETAFTSEFNKINFIDIFKDFQFDENNSNDNKKITTKIIKSSTNSSTSSSNSSTTTTTEPS 365 Q45212 ---------------------------------------------------------------------------------------------------- 215 AVX54617.1 STTTR 370 Q45212 ----- 215
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0003755 | peptidyl-prolyl cis-trans isomerase activity |
| 5. P | GO:0005618 | cell wall |
| 5. P | GO:0060279 | positive regulation of ovulation |
| 5. P | GO:0009279 | cell outer membrane |
| 5. P | GO:0019828 | aspartic-type endopeptidase inhibitor activity |
| 5. P | GO:0007610 | behavior |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0051715 | cytolysis in another organism |
| 5. P | GO:0046692 | sperm competition |
| 5. P | GO:0015232 | heme transmembrane transporter activity |
| 5. P | GO:0032504 | multicellular organism reproduction |
| 5. P | GO:0006457 | protein folding |
| 5. P | GO:2000130 | positive regulation of octopamine signaling pathway |
| 5. P | GO:0005576 | extracellular region |
| 5. P | GO:0046872 | metal ion binding |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | P75505 | Uncharacterized lipoprotein MPN_271 | 3.48e-01 | 1.75e-06 | NA | NA |
| 5. P | Q8NX66 | Iron-regulated surface determinant protein B | 4.40e-01 | 3.53e-02 | NA | NA |
| 5. P | P47678 | Uncharacterized protein MG440 | 5.89e-01 | 1.46e-02 | NA | NA |
| 5. P | P75155 | Uncharacterized lipoprotein MG439 homolog 4 | 7.07e-01 | 1.39e-04 | NA | NA |
| 5. P | P0DG08 | Exotoxin type G | 5.33e-01 | 2.11e-02 | NA | NA |
| 5. P | Q40237 | Major pollen allergen Lol p 5b | 2.40e-01 | 2.62e-05 | NA | NA |
| 5. P | P60811 | Foldase protein PrsA 1 | 3.73e-01 | 3.89e-02 | NA | NA |
| 5. P | Q7A656 | Iron-regulated surface determinant protein B | 4.71e-01 | 4.36e-02 | NA | NA |
| 5. P | Q6GF49 | Uncharacterized leukocidin-like protein 2 | 9.10e-01 | 4.66e-02 | NA | NA |
| 5. P | A7X146 | Iron-regulated surface determinant protein B | 5.32e-01 | 4.36e-02 | NA | NA |
| 5. P | Q8CVC6 | Foldase protein PrsA | 3.49e-01 | 1.27e-02 | NA | NA |
| 5. P | P75075 | Uncharacterized protein MPN_039 | 2.85e-01 | 2.88e-07 | NA | NA |
| 5. P | P75157 | Uncharacterized lipoprotein MG439 homolog 5 | 5.81e-01 | 3.60e-02 | NA | NA |
| 5. P | P0CV54 | Secreted RxLR effector protein 128 | 3.91e-01 | 3.27e-02 | NA | NA |
| 5. P | Q9RZZ0 | Lipoprotein MlpJ | 2.27e-01 | 2.97e-03 | NA | NA |
| 5. P | P32778 | Variable small protein 24 | 9.16e-02 | 2.15e-02 | NA | NA |
| 5. P | P0DD42 | Foldase protein PrsA 1 | 3.66e-01 | 3.89e-02 | NA | NA |
| 5. P | P0DJ00 | Lipoprotein p35 | 6.56e-01 | 1.88e-04 | NA | NA |
| 5. P | Q8P0E5 | Foldase protein PrsA 1 | 3.86e-01 | 3.05e-02 | NA | NA |
| 5. P | P10333 | Accessory gland-specific peptide 26Aa | 2.36e-01 | 2.19e-02 | NA | NA |
| 5. P | P0DD43 | Foldase protein PrsA 1 | 3.17e-01 | 3.89e-02 | NA | NA |
| 5. P | Q837Y9 | Foldase protein PrsA | 4.36e-01 | 2.19e-03 | NA | NA |
| 5. P | P0DG09 | Exotoxin type G | 5.37e-01 | 2.11e-02 | NA | NA |
| 5. P | Q6GA86 | Iron-regulated surface determinant protein B | 4.18e-01 | 3.08e-02 | NA | NA |
| 5. P | P75102 | Uncharacterized lipoprotein MPN_011 | 2.70e-01 | 3.70e-02 | NA | NA |
| 5. P | P55802 | Uncharacterized lipoprotein lpp | 6.06e-01 | 1.06e-05 | NA | NA |
| 5. P | P75373 | Uncharacterized lipoprotein MPN_411 | 4.38e-01 | 6.94e-05 | NA | NA |
| 5. P | P75153 | Uncharacterized lipoprotein MG439 homolog 3 | 6.10e-01 | 1.06e-03 | NA | NA |
| 5. P | P0DI98 | Lipoprotein p33 | 8.78e-01 | 3.03e-03 | NA | NA |
| 5. P | P75152 | Uncharacterized lipoprotein MG439 homolog 2 | 5.42e-01 | 1.36e-05 | NA | NA |
| 5. P | P75156 | Uncharacterized lipoprotein MG440 homolog 3 | 8.29e-01 | 7.47e-03 | NA | NA |
| 5. P | P0C7J5 | Iron-regulated surface determinant protein B | 4.42e-01 | 3.53e-02 | NA | NA |
| 5. P | P0DJ01 | Lipoprotein p35 | 6.01e-01 | 8.42e-05 | NA | NA |
| 5. P | Q2FZF0 | Iron-regulated surface determinant protein B | 4.21e-01 | 3.53e-02 | NA | NA |
| 5. P | A6U0U6 | Iron-regulated surface determinant protein B | 6.16e-01 | 4.36e-02 | NA | NA |
| 5. P | P55801 | Immunodominant protein p72 | 3.84e-01 | 1.10e-06 | NA | NA |
| 5. P | Q45209 | Variable small protein 22 | 1.08e-01 | 1.14e-03 | NA | NA |
| 5. P | P75255 | Uncharacterized lipoprotein MG348 homolog | 3.68e-01 | 1.98e-04 | NA | NA |
| 5. P | P0DI99 | Lipoprotein p33 | 7.31e-01 | 1.54e-02 | NA | NA |
| 5. P | Q2G1F3 | Uncharacterized protein SAOUHSC_00172 | 3.78e-01 | 3.08e-02 | NA | NA |
| 5. P | Q5XBH0 | Foldase protein PrsA 1 | 2.82e-01 | 3.08e-02 | NA | NA |
| 5. P | P22286 | Pollen allergen KBG 60 | 3.54e-02 | 1.84e-02 | NA | NA |
| 5. P | P21250 | Immunodominant antigen Ov33-3 | 1.89e-01 | 4.24e-02 | NA | NA |
| 5. P | P75538 | Uncharacterized lipoprotein MG095 homolog | 6.36e-01 | 1.60e-03 | NA | NA |
| 5. P | Q99UX5 | Iron-regulated surface determinant protein B | 4.70e-01 | 4.36e-02 | NA | NA |
| 5. P | A3CLY1 | Foldase protein PrsA | 3.32e-01 | 6.37e-04 | NA | NA |
| 5. P | Q5HGV5 | Iron-regulated surface determinant protein B | 6.70e-01 | 3.53e-02 | NA | NA |
| 5. P | P75151 | Uncharacterized lipoprotein MG440 homolog 1 | 4.57e-01 | 4.28e-05 | NA | NA |
| 5. P | Q95WA3 | Spore wall protein 1 | 1.15e-01 | 4.16e-02 | NA | NA |
| 5. P | A5IS15 | Iron-regulated surface determinant protein B | 5.31e-01 | 4.36e-02 | NA | NA |
| 5. P | Q45212 | Variable small protein 2 | 3.42e-02 | 9.43e-03 | NA | NA |
| 5. P | Q2FHV2 | Iron-regulated surface determinant protein B | 4.58e-01 | 3.53e-02 | NA | NA |
| 5. P | A6QG30 | Iron-regulated surface determinant protein B | 4.29e-01 | 3.53e-02 | NA | NA |
| 5. P | P47341 | Uncharacterized lipoprotein MG095 | 5.24e-01 | 1.52e-03 | NA | NA |