Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54619.1

JCVISYN3A_0113

Glycolipid synthase A.
M. mycoides homolog: Q6MRY9.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 163
Unique PROST Go: 60
Unique BLAST Go: 1
Unique Foldseek Go: 53

Total Homologs: 408
Unique PROST Homologs: 195
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 118

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: Glycosyltransferase
Zhang et al. [4]: GO:0033692|cellular polysaccharide biosynthetic process
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q6G608 (Poly-beta-1,6-N-acetyl-D-glucosamine synthase) with a FATCAT P-Value: 1.11e-16 and RMSD of 3.02 angstrom. The sequence alignment identity is 25.0%.
Structural alignment shown in left. Query protein AVX54619.1 colored as red in alignment, homolog Q6G608 colored as blue. Query protein AVX54619.1 is also shown in right top, homolog Q6G608 showed in right bottom. They are colored based on secondary structures.

  AVX54619.1 MLNSQLNTTTTVFF-YLTLVIGIIFMLLLSSDW----LFFMFA----YTKNKKKLAKHKPKKN----RSFAIVIPAHNESMVVGKLIDSIKAQKYDGVID 87
      Q6G608 ----------MQFFNFL-LFYP-VFM---SIYWIVGSIYFYFTREIRYSLNK------KPDINVDELEGITFLLACYNESDTIEDTLSNVLALKYEKK-E 78

  AVX54619.1 IYLVADNCTDNRKT----YNVGIEKG--ITV-L-ERFHSTLKG-GNFAIRHGWRYIRDNNLLDKYD-CFCSFDADNLLDEN--WVYEV-NKTFDFYND-- 172
      Q6G608 IIIINDGSSDN--TAELIYKIK-ENNDFIFVDLQEN-----RGKAN-ALNQG---IKQAS----YDYVMC-LDADTIVDQDAPY-YMIEN----FKHDPK 156

  AVX54619.1 IEVVT---TYRNSKNYADNWISSAC-SIQFLKESDIINKG---RA-TLNHSSYVNGT--G-FCITRK--IFEQTNWWDFNSLSHDIEFTQW-LMLN--KI 256
      Q6G608 LGAVTGNPRIRN-K-------SSILGKIQTIEYASLI--GCIKRSQTL--AGAVN-TISGVFTLFKKSAVVD-VGYWDTDMITEDIAVS-WKLHLRGYRI 241

  AVX54619.1 KTGYAPNA-CFYDEQPIDFKNSWKQRMRWCVGFKQVWKIYRSEMIKNMF-TFKINKIKLWVNFTMIFPAVITLLINLLFWLITFGLIISNYIV-NYLNSS 353
      Q6G608 K--YEPLAMCWM-LVPETLGGLWKQRVRWAQGGHEV-------LLRDFFSTMKTKRFPLYI---LMFEQIISIL-----WV---------YIVLLYL-GY 313

  AVX54619.1 LVIIEQANNYLRDLIIYCT-TTPIVI---FGIIFINYLLW--GFIIVAR-NKKSIQA---TSWQKFKSIFTYP--FFML--TYIPISF---LALFKSTYS 436
      Q6G608 LFITA---NFL-D-YTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAGLIFVSW--------YPTVYWIINAAVVLVAFPKALKRKKGGYA 400

  AVX54619.1 T--TP----VARKAQLVQN 449
      Q6G608 TWSSPDRGNTQR------- 412

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0046467	membrane lipid biosynthetic process
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0043708	cell adhesion involved in biofilm formation
1. PBF	GO:0016758	hexosyltransferase activity
1. PBF	GO:0008375	acetylglucosaminyltransferase activity
1. PBF	GO:0016757	glycosyltransferase activity
2. PF	GO:0019350	teichoic acid biosynthetic process
2. PF	GO:0016117	carotenoid biosynthetic process
2. PF	GO:0045226	extracellular polysaccharide biosynthetic process
2. PF	GO:0035810	positive regulation of urine volume
2. PF	GO:0090609	single-species submerged biofilm formation
2. PF	GO:0000271	polysaccharide biosynthetic process
2. PF	GO:0050501	hyaluronan synthase activity
2. PF	GO:0047643	alginate synthase activity
2. PF	GO:0009103	lipopolysaccharide biosynthetic process
2. PF	GO:0008120	ceramide glucosyltransferase activity
2. PF	GO:0042121	alginic acid biosynthetic process
2. PF	GO:0006679	glucosylceramide biosynthetic process
2. PF	GO:1900625	positive regulation of monocyte aggregation
2. PF	GO:0071498	cellular response to fluid shear stress
2. PF	GO:0009312	oligosaccharide biosynthetic process
2. PF	GO:0016760	cellulose synthase (UDP-forming) activity
2. PF	GO:0000139	Golgi membrane
2. PF	GO:0090500	endocardial cushion to mesenchymal transition
2. PF	GO:0070295	renal water absorption
2. PF	GO:0045232	S-layer organization
2. PF	GO:0071555	cell wall organization
2. PF	GO:0102769	dihydroceramide glucosyltransferase activity
2. PF	GO:0005737	cytoplasm
2. PF	GO:0030244	cellulose biosynthetic process
2. PF	GO:0046479	glycosphingolipid catabolic process
2. PF	GO:0004100	chitin synthase activity
2. PF	GO:0085029	extracellular matrix assembly
2. PF	GO:0030213	hyaluronan biosynthetic process
2. PF	GO:0045227	capsule polysaccharide biosynthetic process
2. PF	GO:0036302	atrioventricular canal development
2. PF	GO:0006665	sphingolipid metabolic process
2. PF	GO:0044038	cell wall macromolecule biosynthetic process
2. PF	GO:0006031	chitin biosynthetic process
2. PF	GO:0047259	glucomannan 4-beta-mannosyltransferase activity
2. PF	GO:0009250	glucan biosynthetic process
2. PF	GO:0030448	hyphal growth
2. PF	GO:0006486	protein glycosylation
2. PF	GO:0001570	vasculogenesis
4. PB	GO:0005802	trans-Golgi network
4. PB	GO:0048868	pollen tube development
4. PB	GO:0000138	Golgi trans cisterna
4. PB	GO:0099402	plant organ development
5. P	GO:0016759	cellulose synthase activity
5. P	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
5. P	GO:1903575	cornified envelope assembly
5. P	GO:1900127	positive regulation of hyaluronan biosynthetic process
5. P	GO:0005829	cytosol
5. P	GO:0010192	mucilage biosynthetic process
5. P	GO:0010838	positive regulation of keratinocyte proliferation
5. P	GO:0016051	carbohydrate biosynthetic process
5. P	GO:0051753	mannan synthase activity
5. P	GO:0046677	response to antibiotic
5. P	GO:0061436	establishment of skin barrier
5. P	GO:0030720	oocyte localization involved in germarium-derived egg chamber formation
5. P	GO:0036117	hyaluranon cable
5. P	GO:0048359	mucilage metabolic process involved in seed coat development
5. P	GO:0016325	oocyte microtubule cytoskeleton organization
5. P	GO:0033210	leptin-mediated signaling pathway
5. P	GO:0009245	lipid A biosynthetic process
5. P	GO:0014911	positive regulation of smooth muscle cell migration
5. P	GO:0044853	plasma membrane raft
5. P	GO:0050504	mannosyl-3-phosphoglycerate synthase activity
5. P	GO:0005634	nucleus
5. P	GO:0007293	germarium-derived egg chamber formation
5. P	GO:0006688	glycosphingolipid biosynthetic process
5. P	GO:0099621	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase activity
5. P	GO:0044010	single-species biofilm formation
5. P	GO:0046872	metal ion binding
5. P	GO:0051479	mannosylglycerate biosynthetic process
5. P	GO:1900106	positive regulation of hyaluranon cable assembly
5. P	GO:0071347	cellular response to interleukin-1
5. P	GO:0030212	hyaluronan metabolic process
5. P	GO:0033227	dsRNA transport
5. P	GO:0071356	cellular response to tumor necrosis factor
5. P	GO:0042661	regulation of mesodermal cell fate specification
5. P	GO:0016333	morphogenesis of follicular epithelium
5. P	GO:0036120	cellular response to platelet-derived growth factor stimulus
5. P	GO:1901048	transforming growth factor beta receptor signaling pathway involved in regulation of multicellular organism growth
5. P	GO:0016780	phosphotransferase activity, for other substituted phosphate groups
5. P	GO:0007299	ovarian follicle cell-cell adhesion
5. P	GO:0010764	negative regulation of fibroblast migration
5. P	GO:0051549	positive regulation of keratinocyte migration
5. P	GO:0005794	Golgi apparatus
5. P	GO:0102921	mannosylglycerate synthase activity
5. P	GO:0045434	negative regulation of female receptivity, post-mating
5. P	GO:0009966	regulation of signal transduction
5. P	GO:0019187	beta-1,4-mannosyltransferase activity
5. P	GO:0098856	intestinal lipid absorption
5. P	GO:0044849	estrous cycle
5. P	GO:0030216	keratinocyte differentiation
5. P	GO:0060349	bone morphogenesis
5. P	GO:0001822	kidney development
5. P	GO:0006497	protein lipidation
5. P	GO:0042248	maintenance of polarity of follicular epithelium
5. P	GO:1904508	regulation of protein localization to basolateral plasma membrane
5. P	GO:0036108	4-amino-4-deoxy-alpha-L-arabinopyranosyl undecaprenyl phosphate biosynthetic process
5. P	GO:0002119	nematode larval development
5. P	GO:0001744	insect visual primordium formation
5. P	GO:0030335	positive regulation of cell migration
5. P	GO:1901201	regulation of extracellular matrix assembly
5. P	GO:0009833	plant-type primary cell wall biogenesis
5. P	GO:0048666	neuron development
6. F	GO:0001575	globoside metabolic process
6. F	GO:0050211	procollagen galactosyltransferase activity
6. F	GO:0036427	all-trans-undecaprenyl-phosphate mannosyltransferase activity
6. F	GO:0047276	N-acetyllactosaminide 3-alpha-galactosyltransferase activity
6. F	GO:0018279	protein N-linked glycosylation via asparagine
6. F	GO:0048315	conidium formation
6. F	GO:0035252	UDP-xylosyltransferase activity
6. F	GO:0006011	UDP-glucose metabolic process
6. F	GO:0032580	Golgi cisterna membrane
6. F	GO:0000918	division septum site selection
6. F	GO:0047277	globoside alpha-N-acetylgalactosaminyltransferase activity
6. F	GO:0008152	metabolic process
6. F	GO:0050845	teichuronic acid biosynthetic process
6. F	GO:0050650	chondroitin sulfate proteoglycan biosynthetic process
6. F	GO:0008919	lipopolysaccharide glucosyltransferase I activity
6. F	GO:0009243	O antigen biosynthetic process
6. F	GO:0035438	cyclic-di-GMP binding
6. F	GO:0047238	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity
6. F	GO:0005975	carbohydrate metabolic process
6. F	GO:0015020	glucuronosyltransferase activity
6. F	GO:0001411	hyphal tip
6. F	GO:0030428	cell septum
6. F	GO:0035269	protein O-linked mannosylation
6. F	GO:0031985	Golgi cisterna
6. F	GO:0031505	fungal-type cell wall organization
6. F	GO:0000934	porous cell septum
6. F	GO:0050510	N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity
6. F	GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity
6. F	GO:0006487	protein N-linked glycosylation
6. F	GO:0042285	xylosyltransferase activity
6. F	GO:0016266	O-glycan processing
6. F	GO:0003827	alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
6. F	GO:0030659	cytoplasmic vesicle membrane
6. F	GO:0034221	fungal-type cell wall chitin biosynthetic process
6. F	GO:0009298	GDP-mannose biosynthetic process
6. F	GO:0008475	procollagen-lysine 5-dioxygenase activity
6. F	GO:0033580	protein galactosylation at cell surface
6. F	GO:0030446	hyphal cell wall
6. F	GO:0043936	asexual sporulation resulting in formation of a cellular spore
6. F	GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
6. F	GO:0016262	protein N-acetylglucosaminyltransferase activity
6. F	GO:0004475	mannose-1-phosphate guanylyltransferase activity
6. F	GO:0047600	abequosyltransferase activity
6. F	GO:0006049	UDP-N-acetylglucosamine catabolic process
6. F	GO:0102096	decaprenyl-N-acetyl-alpha-D-glucosaminyl-pyrophosphate:dTDP-alpha-L-rhamnose rhamnosyltransferase activity
6. F	GO:0071944	cell periphery
6. F	GO:0140563	UDP-D-xylose:beta-D-glucoside alpha-1,3-D-xylosyltransferase activity
6. F	GO:0006493	protein O-linked glycosylation
6. F	GO:0017185	peptidyl-lysine hydroxylation
6. F	GO:0030173	integral component of Golgi membrane
6. F	GO:0015018	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
6. F	GO:0008918	lipopolysaccharide 3-alpha-galactosyltransferase activity
6. F	GO:0033823	procollagen glucosyltransferase activity
7. B	GO:0006071	glycerol metabolic process

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0016020	membrane
GO:0016021	integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q6GDD8	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	2.52e-11	3.27e-44	8.02e-07	0.7582
1. PBF	Q8YMK0	Beta-monoglucosyldiacylglycerol synthase	3.41e-10	1.54e-24	3.18e-04	0.6576
1. PBF	Q99QX3	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	3.26e-11	3.27e-44	8.02e-07	0.7165
1. PBF	Q8GLC5	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	3.46e-10	4.21e-45	3.48e-05	0.7061
1. PBF	Q8XAR5	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	5.56e-11	1.28e-32	9.13e-11	0.6385
1. PBF	Q6G608	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.11e-16	2.58e-44	1.13e-06	0.6672
1. PBF	Q5HCN1	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	4.94e-11	3.27e-44	8.02e-07	0.6971
1. PBF	Q7A351	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	5.11e-11	3.27e-44	8.02e-07	0.6734
1. PBF	Q5HKQ0	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	3.23e-10	6.10e-45	1.74e-05	0.7114
1. PBF	P96587	Uncharacterized glycosyltransferase YdaM	3.16e-11	4.80e-39	1.75e-10	0.7318
1. PBF	Q3MB01	Beta-monoglucosyldiacylglycerol synthase	2.71e-10	3.97e-24	0.001	0.6254
1. PBF	Q8NUI7	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.77e-11	2.58e-44	1.13e-06	0.682
2. PF	Q52463	Mannuronan synthase	7.25e-09	1.02e-21	NA	0.4948
2. PF	Q15JF5	Validoxylamine A glucosyltransferase	2.60e-04	8.78e-05	NA	0.6229
2. PF	B3Q6L4	Glucans biosynthesis glucosyltransferase H	5.15e-08	3.95e-05	NA	0.54
2. PF	P0C0H0	Hyaluronan synthase	1.71e-09	1.91e-30	NA	0.6832
2. PF	D4GYH3	Glucosyl-dolichyl phosphate glucuronosyltransferase	3.12e-09	3.10e-05	NA	0.5547
2. PF	B8GX72	Glucans biosynthesis glucosyltransferase H	3.75e-09	3.21e-05	NA	0.5818
2. PF	D4GYH2	Glycosyltransferase AglI	2.37e-09	9.79e-06	NA	0.6795
2. PF	Q5HI28	Putative glycosyltransferase TagX	3.52e-06	2.46e-02	NA	0.4892
2. PF	B8E7D2	Glucans biosynthesis glucosyltransferase H	5.68e-09	8.11e-05	NA	0.6297
2. PF	Q5U4S8	Ceramide glucosyltransferase-B	7.25e-09	2.46e-21	NA	0.599
2. PF	Q9A6R5	Glucans biosynthesis glucosyltransferase H	4.25e-08	3.21e-05	NA	0.5794
2. PF	Q4L977	4,4'-diaponeurosporenoate glycosyltransferase	5.01e-07	1.58e-24	NA	0.5135
2. PF	Q6UDF0	Glucomannan 4-beta-mannosyltransferase 1	3.28e-09	3.56e-17	NA	0.6131
2. PF	P04340	N-acetylglucosaminyltransferase	5.90e-10	2.00e-36	NA	0.6694
2. PF	P13563	Hyaluronan synthase 1	1.19e-08	9.81e-14	NA	0.5783
2. PF	P04341	N-acetylglucosaminyltransferase	8.46e-10	6.59e-40	NA	0.6844
2. PF	O57424	Hyaluronan synthase 2	2.89e-09	2.70e-15	NA	0.5457
2. PF	Q53590	4,4'-diaponeurosporenoate glycosyltransferase	3.99e-08	7.68e-20	NA	0.6039
2. PF	Q2FDU4	4,4'-diaponeurosporenoate glycosyltransferase	5.03e-08	7.68e-20	NA	0.6135
2. PF	P26024	N-acetylglucosaminyltransferase	7.13e-10	4.00e-14	NA	0.6381
2. PF	A9BEU2	Glucosylglycerate synthase	1.37e-05	1.27e-05	NA	0.3465
2. PF	Q88NC5	Glycosyltransferase alg8	6.23e-09	6.22e-22	NA	0.4718
2. PF	Q5X9A9	Hyaluronan synthase	6.35e-10	3.38e-31	NA	0.6736
2. PF	F9WWD1	Type 2 glycosyltransferase	1.93e-10	3.87e-13	NA	0.579
2. PF	Q8P532	Glucans biosynthesis glucosyltransferase H	5.04e-08	4.98e-09	NA	0.487
2. PF	A6WMM7	Glucans biosynthesis glucosyltransferase H	5.69e-09	5.14e-05	NA	0.619
2. PF	C4R4B3	Ceramide glucosyltransferase	8.98e-08	4.09e-17	NA	0.5101
2. PF	P17862	N-acetylglucosaminyltransferase	1.62e-10	3.85e-39	NA	0.6954
2. PF	Q9PCY1	Glucans biosynthesis glucosyltransferase H	5.26e-08	5.11e-07	NA	0.6325
2. PF	Q0HUS0	Glucans biosynthesis glucosyltransferase H	7.94e-09	1.56e-04	NA	0.6522
2. PF	Q7A3E0	4,4'-diaponeurosporenoate glycosyltransferase	1.42e-07	1.49e-19	NA	0.6134
2. PF	P72334	N-acetylglucosaminyltransferase	4.50e-09	8.03e-32	NA	0.6561
2. PF	Q02EU0	Glucans biosynthesis glucosyltransferase H	6.05e-07	1.26e-02	NA	0.6691
2. PF	B1WB39	Hyaluronan synthase 1	1.22e-08	3.86e-16	NA	0.5632
2. PF	Q7PC70	Probable xyloglucan glycosyltransferase 2	9.92e-08	3.05e-02	NA	0.6538
2. PF	G5AY81	Hyaluronan synthase 2	4.40e-09	2.40e-15	NA	0.5626
2. PF	Q2YWE6	4,4'-diaponeurosporenoate glycosyltransferase	3.92e-07	7.94e-21	NA	0.59
2. PF	Q5HCY7	4,4'-diaponeurosporenoate glycosyltransferase	1.60e-07	7.68e-20	NA	0.6138
2. PF	P33695	Succinoglycan biosynthesis protein ExoM	8.09e-09	4.03e-04	NA	0.5207
2. PF	O06483	Uncharacterized glycosyltransferase YfnE	2.85e-06	1.03e-03	NA	0.4602
2. PF	B1J2R4	Glucans biosynthesis glucosyltransferase H	6.43e-07	4.26e-02	NA	0.6299
2. PF	P9WMX2	Galactofuranosyltransferase GlfT1	6.18e-06	4.83e-06	NA	0.5644
2. PF	Q8NUQ4	4,4'-diaponeurosporenoate glycosyltransferase	4.48e-08	7.68e-20	NA	0.6081
2. PF	P30595	Chitin synthase 2	5.05e-05	3.07e-02	NA	0.4751
2. PF	P20401	Glucans biosynthesis glucosyltransferase H	2.18e-08	7.36e-03	NA	0.6604
2. PF	P33691	Succinoglycan biosynthesis protein ExoA	2.14e-07	2.21e-07	NA	0.6668
2. PF	J9W453	Ceramide glucosyltransferase	9.73e-08	3.11e-13	NA	0.5272
2. PF	Q9FA52	Glucans biosynthesis glucosyltransferase H	2.41e-07	8.71e-09	NA	0.6056
2. PF	P0DB61	Hyaluronan synthase	1.62e-09	1.95e-30	NA	0.6726
2. PF	Q87CC5	Glucans biosynthesis glucosyltransferase H	2.58e-09	1.15e-06	NA	0.628
2. PF	Q99R74	4,4'-diaponeurosporenoate glycosyltransferase	7.53e-08	1.49e-19	NA	0.6142
2. PF	Q8XVC2	Glucans biosynthesis glucosyltransferase H	1.37e-06	7.38e-04	NA	0.6172
2. PF	Q5BL38	Ceramide glucosyltransferase	4.38e-09	1.59e-21	NA	0.6046
2. PF	C0QRQ2	Glucosyl-3-phosphoglycerate synthase	2.44e-04	1.93e-04	NA	0.3581
2. PF	D4GU74	Low-salt glycan biosynthesis hexosyltransferase Agl6	3.13e-06	1.08e-06	NA	0.3713
2. PF	Q8NXS4	Putative glycosyltransferase TagX	1.31e-05	2.61e-02	NA	0.4838
2. PF	A0R5Z2	Galactofuranosyltransferase GlfT1	5.12e-06	3.90e-04	NA	0.5374
2. PF	P0DB60	Hyaluronan synthase	9.73e-10	1.95e-30	NA	0.6833
2. PF	Q6G6B1	4,4'-diaponeurosporenoate glycosyltransferase	1.71e-07	7.68e-20	NA	0.6304
2. PF	Q6GBJ0	Putative glycosyltransferase TagX	2.62e-06	2.61e-02	NA	0.4791
2. PF	Q83Z42	Glucans biosynthesis glucosyltransferase H	3.20e-11	1.49e-08	NA	0.6426
2. PF	A5F1Q0	Glucans biosynthesis glucosyltransferase H	7.82e-09	3.76e-03	NA	0.6236
2. PF	Q0HJ63	Glucans biosynthesis glucosyltransferase H	4.29e-09	1.54e-04	NA	0.6205
2. PF	P0C0H1	Hyaluronan synthase	5.66e-09	3.30e-31	NA	0.6912
2. PF	P50357	N-acetylglucosaminyltransferase	2.23e-10	1.39e-39	NA	0.7263
2. PF	Q07755	N-acetylglucosaminyltransferase	1.53e-12	2.87e-36	NA	0.7282
2. PF	P94199	Glycosyltransferase alg8	1.11e-07	1.85e-19	NA	0.4425
2. PF	P50356	N-acetylglucosaminyltransferase	4.75e-10	2.42e-36	NA	0.6445
2. PF	A4Y768	Glucans biosynthesis glucosyltransferase H	4.66e-09	4.84e-04	NA	0.6628
2. PF	O57428	Hyaluronan synthase-related protein	2.38e-08	4.97e-13	NA	0.6086
2. PF	I1RPI4	Ceramide glucosyltransferase	4.40e-06	5.74e-11	NA	0.4414
2. PF	Q9KSG9	Glucans biosynthesis glucosyltransferase H	7.32e-09	3.76e-03	NA	0.6134
2. PF	Q4UYZ8	Glucans biosynthesis glucosyltransferase H	4.56e-08	4.98e-09	NA	0.6334
2. PF	Q1MJ95	Dodecaprenyl-phosphate galacturonate synthase	6.57e-06	6.28e-04	NA	0.435
2. PF	P24151	N-acetylglucosaminyltransferase	1.24e-08	3.04e-38	NA	0.6169
2. PF	Q8NKX1	Hyaluronan synthase	9.16e-10	1.91e-30	NA	0.6733
2. PF	Q6GDN6	4,4'-diaponeurosporenoate glycosyltransferase	4.34e-07	1.33e-19	NA	0.6156
2. PF	Q3BXV7	Glucans biosynthesis glucosyltransferase H	3.26e-09	8.78e-10	NA	0.5061
2. PF	Q8AY29	Ceramide glucosyltransferase-A	4.01e-09	8.96e-22	NA	0.6059
3. BF	Q4UM29	Uncharacterized glycosyltransferase RF_0543	3.69e-04	NA	0.049	0.4848
4. PB	Q9RQP9	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	3.03e-11	3.27e-44	8.02e-07	NA
4. PB	Q9LJP4	Xyloglucan glycosyltransferase 4	9.97e-09	4.12e-04	0.028	NA
4. PB	P75905	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	4.75e-11	4.57e-33	1.98e-10	NA
5. P	O57427	Hyaluronan synthase 2	4.32e-09	8.99e-15	NA	NA
5. P	Q7UC63	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.03e-05	5.89e-04	NA	NA
5. P	Q6L538	Probable xyloglucan glycosyltransferase 7	9.61e-08	2.51e-03	NA	NA
5. P	P26403	O antigen biosynthesis rhamnosyltransferase RfbN	4.58e-07	5.01e-04	NA	NA
5. P	Q3U129	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1	2.00e-05	7.96e-04	NA	NA
5. P	P57022	Bactoprenol glucosyl transferase	NA	1.23e-05	NA	NA
5. P	O80898	Cellulose synthase-like protein B1	8.64e-06	2.61e-07	NA	NA
5. P	B7NNT3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.40e-05	3.03e-04	NA	NA
5. P	F4JMI5	Putative glucuronosyltransferase PGSIP7	4.41e-04	4.06e-02	NA	NA
5. P	Q61647	Hyaluronan synthase 1	4.07e-09	2.59e-14	NA	NA
5. P	B6I7J7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.92e-05	4.30e-04	NA	NA
5. P	A8XAC4	Beta-1,4-mannosyltransferase bre-3	4.56e-09	6.97e-19	NA	NA
5. P	Q7XIF5	Probable glucomannan 4-beta-mannosyltransferase 7	2.43e-09	3.69e-04	NA	NA
5. P	Q9LQC9	Probable glucomannan 4-beta-mannosyltransferase 3	5.94e-09	2.18e-15	NA	NA
5. P	P9WMX0	Pre-mycofactocin glycosyltransferase	1.08e-06	2.28e-16	NA	NA
5. P	B5XTK8	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	8.20e-06	2.79e-03	NA	NA
5. P	Q94GM9	Probable mixed-linked glucan synthase 7	6.74e-05	2.58e-02	NA	NA
5. P	A0QSC1	Pre-mycofactocin glycosyltransferase	8.22e-07	3.09e-14	NA	NA
5. P	B4TPI1	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.79e-04	5.90e-05	NA	NA
5. P	P9WMX1	Pre-mycofactocin glycosyltransferase	1.17e-06	2.28e-16	NA	NA
5. P	Q8PPR7	Glucans biosynthesis glucosyltransferase H	2.62e-08	1.84e-09	NA	NA
5. P	Q8Z541	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.68e-05	5.44e-05	NA	NA
5. P	A9N5B3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.80e-04	5.44e-05	NA	NA
5. P	Q8XDZ5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.35e-05	6.08e-04	NA	NA
5. P	Q7PC71	Cellulose synthase-like protein H2	8.15e-05	9.85e-03	NA	NA
5. P	Q9R0E0	Ceramide glucosyltransferase	4.87e-09	1.26e-23	NA	NA
5. P	O88693	Ceramide glucosyltransferase	4.71e-09	1.98e-23	NA	NA
5. P	Q651X7	Cellulose synthase-like protein E1	9.56e-09	2.59e-03	NA	NA
5. P	B7MXT5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.17e-05	3.94e-04	NA	NA
5. P	A1RJC2	Glucans biosynthesis glucosyltransferase H	5.31e-09	4.84e-04	NA	NA
5. P	P71057	Putative glycosyltransferase EpsH	3.44e-06	7.59e-03	NA	NA
5. P	Q84W06	Probable glucomannan 4-beta-mannosyltransferase 14	5.41e-11	5.76e-22	NA	NA
5. P	Q3YZV2	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.19e-05	4.30e-04	NA	NA
5. P	Q9RFR0	Mannosylglycerate synthase	8.52e-05	4.78e-02	NA	NA
5. P	A6VDK0	Glucans biosynthesis glucosyltransferase H	8.61e-08	9.09e-03	NA	NA
5. P	B5RCC3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.95e-04	5.57e-05	NA	NA
5. P	B7N5L9	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.08e-05	5.17e-04	NA	NA
5. P	Q6GV29	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1	2.00e-05	1.23e-04	NA	NA
5. P	P37782	dTDP-rhamnosyl transferase RfbF	2.17e-07	5.52e-06	NA	NA
5. P	Q9YDM5	Mannosyl-3-phosphoglycerate synthase	7.44e-03	1.86e-04	NA	NA
5. P	Q8D342	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	3.37e-05	3.57e-06	NA	NA
5. P	I1RB03	Type 2 glycosyltransferase	1.56e-09	1.34e-10	NA	NA
5. P	B2K5L4	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.83e-05	1.37e-02	NA	NA
5. P	Q5PNA5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	7.79e-06	4.97e-05	NA	NA
5. P	Q9LR87	Probable glucomannan 4-beta-mannosyltransferase 10	5.83e-10	5.22e-12	NA	NA
5. P	Q6AU53	Probable xyloglucan glycosyltransferase 9	6.81e-10	7.15e-11	NA	NA
5. P	C0Q070	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.85e-04	5.32e-05	NA	NA
5. P	B5EZH7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.37e-04	5.90e-05	NA	NA
5. P	B7LM77	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	3.61e-05	4.35e-04	NA	NA
5. P	B5FNT8	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.88e-04	5.57e-05	NA	NA
5. P	Q47536	Uncharacterized glycosyltransferase YaiP	3.01e-08	1.37e-32	NA	NA
5. P	Q6D2F0	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	7.05e-06	1.21e-02	NA	NA
5. P	Q2NRV6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	9.38e-06	9.44e-04	NA	NA
5. P	Q1CIH6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	6.29e-04	1.82e-02	NA	NA
5. P	A9BHI9	Glucosyl-3-phosphoglycerate synthase	1.25e-03	1.33e-02	NA	NA
5. P	Q57M56	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.02e-04	2.82e-05	NA	NA
5. P	Q6N5U3	Glucans biosynthesis glucosyltransferase H	1.05e-07	5.20e-05	NA	NA
5. P	Q8D3D5	Glucans biosynthesis glucosyltransferase H	1.34e-10	2.57e-04	NA	NA
5. P	Q1R9G1	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.17e-05	3.94e-04	NA	NA
5. P	A4TIM3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.93e-05	1.37e-02	NA	NA
5. P	Q9FNI7	Glucomannan 4-beta-mannosyltransferase 2	3.56e-10	1.25e-14	NA	NA
5. P	P70312	Hyaluronan synthase 2	3.35e-09	4.82e-15	NA	NA
5. P	Q16739	Ceramide glucosyltransferase	4.75e-09	3.44e-23	NA	NA
5. P	Q21054	Ceramide glucosyltransferase 3	2.66e-07	3.61e-06	NA	NA
5. P	Q45539	Putative glycosyltransferase CsbB	3.28e-05	1.27e-03	NA	NA
5. P	Q8ZDX7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.01e-05	1.82e-02	NA	NA
5. P	Q7PC73	Probable glucomannan 4-beta-mannosyltransferase 5	1.09e-08	2.17e-08	NA	NA
5. P	B1X8W7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.34e-05	4.30e-04	NA	NA
5. P	A7ZP72	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.29e-05	3.81e-04	NA	NA
5. P	A9KZ13	Glucans biosynthesis glucosyltransferase H	5.53e-09	5.14e-05	NA	NA
5. P	B5BCP7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	6.82e-06	4.97e-05	NA	NA
5. P	Q31YK3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.00e-05	4.30e-04	NA	NA
5. P	Q03562	Beta-1,4-mannosyltransferase bre-3	4.55e-09	1.03e-19	NA	NA
5. P	B0KM50	Glucans biosynthesis glucosyltransferase H	6.05e-07	2.49e-02	NA	NA
5. P	G4MS28	Ceramide glucosyltransferase	1.21e-06	5.72e-13	NA	NA
5. P	A6TF99	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	9.68e-06	3.16e-03	NA	NA
5. P	Q92197	Chitin synthase C	7.28e-05	6.26e-03	NA	NA
5. P	Q4KC83	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	4.81e-06	1.51e-02	NA	NA
5. P	Q9T0L2	Probable glucomannan 4-beta-mannosyltransferase 15	6.13e-09	1.41e-13	NA	NA
5. P	Q2FV58	4,4'-diaponeurosporenoate glycosyltransferase	3.43e-08	7.68e-20	NA	NA
5. P	P46370	Uncharacterized 55.3 kDa protein in thcA 5'region	3.70e-06	1.10e-07	NA	NA
5. P	C4ZU96	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.31e-05	4.30e-04	NA	NA
5. P	P68667	SfII prophage-derived bactoprenol glucosyl transferase	1.06e-05	4.86e-05	NA	NA
5. P	Q1C741	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.74e-05	1.82e-02	NA	NA
5. P	O22007	Bactoprenol glucosyl transferase	NA	1.88e-05	NA	NA
5. P	O05154	Putative glycosyltransferase TagX	1.48e-06	2.46e-02	NA	NA
5. P	D4GYG7	Glycosyltransferase AglE	8.71e-11	2.42e-06	NA	NA
5. P	Q92819	Hyaluronan synthase 2	6.28e-09	1.09e-14	NA	NA
5. P	P11290	Uncharacterized glycosyltransferase YibD	9.02e-05	8.58e-04	NA	NA
5. P	Q89BU5	Glucans biosynthesis glucosyltransferase H	1.06e-07	9.01e-06	NA	NA
5. P	Q339N5	Cellulose synthase-like protein H1	4.65e-06	2.57e-05	NA	NA
5. P	A0KWF0	Glucans biosynthesis glucosyltransferase H	7.38e-09	1.88e-04	NA	NA
5. P	Q9LZR3	Glucomannan 4-beta-mannosyltransferase 9	4.98e-10	1.13e-16	NA	NA
5. P	Q0TFI8	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.49e-05	3.94e-04	NA	NA
5. P	Q9UZC1	Mannosyl-3-phosphoglycerate synthase	7.47e-03	1.51e-02	NA	NA
5. P	O80899	Cellulose synthase-like protein B2	1.59e-05	7.64e-07	NA	NA
5. P	Q8EF78	Glucans biosynthesis glucosyltransferase H	6.13e-09	4.75e-05	NA	NA
5. P	P04679	N-acetylglucosaminyltransferase (Fragments)	1.15e-07	1.13e-03	NA	NA
5. P	P77757	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.42e-05	4.30e-04	NA	NA
5. P	Q8VZK9	Cellulose synthase-like protein E1	1.70e-05	1.05e-04	NA	NA
5. P	A8A2C1	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.67e-05	4.30e-04	NA	NA
5. P	Q7N3Q6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.20e-05	1.23e-02	NA	NA
5. P	Q3KJD8	Glucans biosynthesis glucosyltransferase H	4.30e-07	4.69e-02	NA	NA
5. P	Q0WT40	Cellulose synthase-like protein B5	1.30e-05	8.09e-06	NA	NA
5. P	B4ETL6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.23e-05	1.06e-03	NA	NA
5. P	A8GDR6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	5.18e-06	1.55e-03	NA	NA
5. P	Q0T2M9	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.50e-05	6.56e-04	NA	NA
5. P	O35776	Hyaluronan synthase 2	7.46e-09	7.27e-15	NA	NA
5. P	B3VA59	Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase	1.38e-08	2.16e-13	NA	NA
5. P	A2YMH5	Probable mixed-linked glucan synthase 3	8.88e-04	7.51e-03	NA	NA
5. P	B1LLK8	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.14e-05	4.39e-04	NA	NA
5. P	Q9ZQN8	Glucomannan 4-beta-mannosyltransferase 7	9.30e-10	6.41e-16	NA	NA
5. P	B1JJ29	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.78e-05	1.37e-02	NA	NA
5. P	B7UFR6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.35e-05	4.12e-04	NA	NA
5. P	P77293	Prophage bactoprenol glucosyl transferase homolog	1.12e-05	2.69e-05	NA	NA
5. P	A0KGY7	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.45e-05	8.49e-04	NA	NA
5. P	Q8RX83	Cellulose synthase-like protein B3	9.68e-06	3.34e-04	NA	NA
5. P	Q0WVN5	Cellulose synthase-like protein G3	9.20e-06	8.55e-07	NA	NA
5. P	Q6ZF89	Putative mixed-linked glucan synthase 1	5.00e-04	4.23e-05	NA	NA
5. P	P74505	Uncharacterized glycosyltransferase slr1943	2.20e-05	9.78e-08	NA	NA
5. P	Q570S7	Cellulose synthase-like protein G1	9.30e-06	2.92e-08	NA	NA
5. P	B7M5T6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.02e-05	3.81e-04	NA	NA
5. P	B7V3H0	Glucans biosynthesis glucosyltransferase H	6.39e-07	1.04e-02	NA	NA
5. P	Q7XUT9	Cellulose synthase-like protein H2	1.30e-04	5.72e-03	NA	NA
5. P	Q67FW5	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1	1.91e-05	5.70e-04	NA	NA
5. P	P74165	Beta-monoglucosyldiacylglycerol synthase	8.88e-16	1.59e-21	NA	NA
5. P	B4SYX0	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.13e-04	5.44e-05	NA	NA
5. P	Q6Z2T9	Probable glucomannan 4-beta-mannosyltransferase 6	1.05e-09	7.36e-06	NA	NA
5. P	B7MG21	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	9.22e-06	3.94e-04	NA	NA
5. P	B1IXT3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.10e-05	4.30e-04	NA	NA
5. P	A3D3U0	Glucans biosynthesis glucosyltransferase H	5.25e-09	8.21e-05	NA	NA
5. P	Q9ZQB9	Probable xyloglucan glycosyltransferase 12	2.62e-08	4.22e-02	NA	NA
5. P	Q55487	Uncharacterized glycosyltransferase sll0501	2.52e-05	3.77e-05	NA	NA
5. P	Q84S11	Mixed-linked glucan synthase 2	5.64e-04	1.78e-03	NA	NA
5. P	A9R094	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.79e-05	1.82e-02	NA	NA
5. P	B5R271	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.36e-04	5.57e-05	NA	NA
5. P	A1JPP5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	5.30e-06	5.78e-03	NA	NA
5. P	Q8FFM2	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	9.41e-06	3.94e-04	NA	NA
5. P	Q48HZ2	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.67e-05	1.30e-02	NA	NA
5. P	C5BDQ5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.91e-05	1.59e-03	NA	NA
5. P	O80891	Cellulose synthase-like protein B4	1.14e-05	1.89e-06	NA	NA
5. P	O01346	Beta-1,4-mannosyltransferase egh	5.95e-10	3.70e-19	NA	NA
5. P	C6DAW6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.70e-05	5.01e-03	NA	NA
5. P	Q887P9	Glycosyltransferase alg8	6.67e-09	4.76e-22	NA	NA
5. P	O34319	Uncharacterized glycosyltransferase YkcC	3.19e-05	8.22e-03	NA	NA
5. P	Q8VYR4	Cellulose synthase-like protein G2	4.39e-06	2.09e-08	NA	NA
5. P	Q84W54	Probable glucomannan 4-beta-mannosyltransferase 1	6.42e-10	2.42e-13	NA	NA
5. P	Q5AMQ4	Ceramide glucosyltransferase	1.02e-05	6.26e-12	NA	NA
5. P	O23386	Cellulose synthase-like protein B6	1.86e-05	4.79e-07	NA	NA
5. P	Q7PC76	Glucomannan 4-beta-mannosyltransferase 1	3.45e-10	2.79e-15	NA	NA
5. P	Q9T1D6	Bactoprenol glucosyl transferase	NA	4.58e-05	NA	NA
5. P	Q6ZF85	Probable mixed-linked glucan synthase 3	1.56e-04	1.54e-02	NA	NA
5. P	Q69L19	Probable xyloglucan glycosyltransferase 2	1.64e-08	3.23e-02	NA	NA
5. P	B7LAR9	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.02e-05	4.30e-04	NA	NA
5. P	Q7PC67	Probable glucomannan 4-beta-mannosyltransferase 2	1.25e-09	4.08e-06	NA	NA
5. P	Q9HUA6	Glucans biosynthesis glucosyltransferase H	6.12e-07	1.04e-02	NA	NA
5. P	Q46TZ4	Glucans biosynthesis glucosyltransferase H	1.58e-07	2.25e-04	NA	NA
5. P	O97711	Hyaluronan synthase 2	5.64e-09	3.46e-15	NA	NA
5. P	Q6YWK8	Probable glucomannan 4-beta-mannosyltransferase 11	2.69e-08	1.04e-08	NA	NA
5. P	Q9LF09	Probable glucomannan 4-beta-mannosyltransferase 11	3.03e-09	1.55e-06	NA	NA
5. P	P9WMX3	Galactofuranosyltransferase GlfT1	6.30e-06	4.83e-06	NA	NA
5. P	B2VBJ0	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.03e-05	1.18e-03	NA	NA
5. P	Q92839	Hyaluronan synthase 1	1.18e-08	2.49e-13	NA	NA
5. P	Q9SRT3	Probable xyloglucan glycosyltransferase 6	2.51e-08	3.57e-03	NA	NA
5. P	O08650	Hyaluronan synthase 3	1.78e-08	5.63e-13	NA	NA
5. P	O34755	Uncharacterized glycosyltransferase YkoT	1.22e-04	3.00e-03	NA	NA
5. P	A4SQW8	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.73e-05	4.08e-03	NA	NA
5. P	Q88D04	Glucans biosynthesis glucosyltransferase H	6.25e-08	2.74e-02	NA	NA
5. P	A1ADA6	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.29e-05	3.94e-04	NA	NA
5. P	G4MWY1	Type 2 glycosyltransferase	6.49e-10	5.23e-15	NA	NA
5. P	Q7XHV0	Probable mixed-linked glucan synthase 9	5.16e-04	5.11e-04	NA	NA
5. P	P68668	Bactoprenol glucosyl transferase	NA	4.86e-05	NA	NA
5. P	A4WAM4	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.15e-05	4.86e-03	NA	NA
5. P	O52324	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.65e-04	5.90e-05	NA	NA
5. P	B0RNI5	Glucans biosynthesis glucosyltransferase H	4.90e-08	4.34e-09	NA	NA
5. P	Q32DT4	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	2.11e-05	4.21e-04	NA	NA
5. P	O18037	Ceramide glucosyltransferase 1	4.76e-07	5.98e-12	NA	NA
5. P	Q69XK5	Putative cellulose synthase A catalytic subunit 11 [UDP-forming]	1.39e-03	8.13e-04	NA	NA
5. P	Q6ZF86	Mixed-linked glucan synthase 4	7.58e-04	3.35e-02	NA	NA
5. P	Q84S18	Probable mixed-linked glucan synthase 8	1.58e-03	4.49e-04	NA	NA
5. P	Q2NYU0	Glucans biosynthesis glucosyltransferase H	5.20e-08	1.44e-10	NA	NA
5. P	Q67VS7	Probable glucomannan 4-beta-mannosyltransferase 9	4.10e-10	3.67e-16	NA	NA
5. P	Q67X45	Probable glucomannan 4-beta-mannosyltransferase 3	6.00e-10	8.87e-07	NA	NA
5. P	Q0DXZ1	Cellulose synthase-like protein E2	3.09e-06	1.55e-03	NA	NA
5. P	Q93PD9	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	5.21e-04	1.37e-02	NA	NA
5. P	A8FRR3	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	7.36e-05	1.10e-02	NA	NA
5. P	P75042	Uncharacterized glycosyltransferase MG060 homolog	6.66e-06	4.87e-02	NA	NA
5. P	G5EC84	Ceramide glucosyltransferase 2	1.73e-07	1.30e-09	NA	NA
5. P	O00219	Hyaluronan synthase 3	4.77e-09	5.52e-14	NA	NA
5. P	Q8S7W0	Probable glucomannan 4-beta-mannosyltransferase 4	1.07e-08	3.48e-11	NA	NA
5. P	Q651X6	Cellulose synthase-like protein E6	1.35e-05	2.43e-05	NA	NA
5. P	O58689	Mannosyl-3-phosphoglycerate synthase	6.81e-03	1.13e-02	NA	NA
5. P	A5WA59	Glucans biosynthesis glucosyltransferase H	6.15e-07	2.82e-02	NA	NA
5. P	B5YX45	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.15e-05	6.08e-04	NA	NA
5. P	B4TBG5	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	1.81e-04	5.90e-05	NA	NA
6. F	Q5CB04	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1	4.46e-04	NA	NA	0.4632
6. F	P55465	Uncharacterized protein y4gI	2.36e-03	NA	NA	0.6351
6. F	Q76KJ8	Cellulose synthase 1	1.43e-04	NA	NA	0.5312
6. F	Q1I3R6	Glucans biosynthesis glucosyltransferase H	4.26e-08	NA	NA	0.6728
6. F	Q8X5L7	Cellulose synthase catalytic subunit [UDP-forming]	5.40e-06	NA	NA	0.5941
6. F	P25148	General stress protein A	4.94e-02	NA	NA	0.4755
6. F	P19449	Cellulose synthase catalytic subunit [UDP-forming]	9.77e-08	NA	NA	0.5489
6. F	A2ZAK8	Cellulose synthase-like protein D1	7.68e-03	NA	NA	0.545
6. F	P54267	Chitin synthase G	5.65e-05	NA	NA	0.4619
6. F	Q57022	Uncharacterized glycosyltransferase HI_0868	2.79e-05	NA	NA	0.6412
6. F	P42092	Protein CgeD	3.49e-06	NA	NA	0.4929
6. F	P19817	Lipopolysaccharide 1,2-glucosyltransferase	5.31e-02	NA	NA	0.3646
6. F	A0A0H3M5A8	Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase	6.22e-03	NA	NA	0.5379
6. F	P27115	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase	8.31e-04	NA	NA	0.4859
6. F	P39621	Spore coat polysaccharide biosynthesis protein SpsA	1.03e-05	NA	NA	0.4952
6. F	Q6PA90	LARGE xylosyl- and glucuronyltransferase 2-A	4.91e-02	NA	NA	0.3567
6. F	Q5ZKI6	Glucoside xylosyltransferase 1	1.55e-02	NA	NA	0.2692
6. F	Q2YDM8	Glycosyltransferase 6 domain-containing protein 1	4.31e-03	NA	NA	0.4153
6. F	P58932	Cellulose synthase catalytic subunit [UDP-forming]	1.33e-07	NA	NA	0.513
6. F	P30583	Chitin synthase C	2.96e-05	NA	NA	0.5532
6. F	P0CW87	Cellulose synthase 1	1.41e-04	NA	NA	0.549
6. F	P30600	Chitin synthase 1	1.02e-05	NA	NA	0.4771
6. F	Q32NJ7	LARGE xylosyl- and glucuronyltransferase 2-B	4.38e-02	NA	NA	0.3485
6. F	P75086	Uncharacterized glycosyltransferase MG025 homolog	5.00e-05	NA	NA	0.5383
6. F	Q6GJ30	Putative glycosyltransferase TagX	3.06e-06	NA	NA	0.4653
6. F	Q9WX75	Putative cellulose synthase 3	7.37e-04	NA	NA	0.5293
6. F	P62518	Glucans biosynthesis glucosyltransferase H	5.02e-08	NA	NA	0.6241
6. F	O19071	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase	7.91e-02	NA	NA	0.392
6. F	P33700	Succinoglycan biosynthesis protein ExoU	1.92e-05	NA	NA	0.5165
6. F	Q5CB03	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1	6.52e-04	NA	NA	0.5095
6. F	Q68X33	Uncharacterized glycosyltransferase RT0329	1.37e-06	NA	NA	0.5409
6. F	Q8SQ20	N-acetyllactosaminide alpha-1,3-galactosyltransferase	1.15e-02	NA	NA	0.4113
6. F	Q9ZDI9	Uncharacterized glycosyltransferase RP339	1.27e-07	NA	NA	0.5427
6. F	Q82SA8	Glucans biosynthesis glucosyltransferase H	5.38e-08	NA	NA	0.6464
6. F	P30598	Chitin synthase 1	8.16e-05	NA	NA	0.4565
6. F	Q1RIM7	Uncharacterized glycosyltransferase RBE_0706	1.68e-04	NA	NA	0.4949
6. F	P26401	Abequosyltransferase RfbV	5.27e-04	NA	NA	0.4757
6. F	A1YGR5	N-acetyllactosaminide alpha-1,3-galactosyltransferase	8.34e-03	NA	NA	0.4241
6. F	Q5CAZ6	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2	2.40e-04	NA	NA	0.5023
6. F	O32268	Putative teichuronic acid biosynthesis glycosyltransferase TuaG	1.60e-06	NA	NA	0.6053
6. F	Q68EQ1	Mannose-1-phosphate guanyltransferase beta	4.72e-03	NA	NA	0.4022
6. F	Q5EAB6	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1	2.32e-02	NA	NA	0.5101
6. F	Q7U0E1	Glucosyl-3-phosphoglycerate synthase	6.42e-05	NA	NA	0.5087
6. F	Q28I33	Glycosyltransferase 8 domain-containing protein 1	8.62e-02	NA	NA	0.3008
6. F	Q8FIS3	Glucans biosynthesis glucosyltransferase H	4.96e-08	NA	NA	0.6333
6. F	Q12632	Chitin synthase 1	5.10e-06	NA	NA	0.4991
6. F	O82859	Cellulose synthase catalytic subunit [UDP-forming]	1.26e-07	NA	NA	0.5335
6. F	C3K816	Glucans biosynthesis glucosyltransferase H	5.85e-07	NA	NA	0.641
6. F	J9VWT0	Chitin synthase 6	2.78e-04	NA	NA	0.4932
6. F	Q6DE37	Glucoside xylosyltransferase 2	2.87e-02	NA	NA	0.3045
6. F	O13356	Chitin synthase 1	6.17e-05	NA	NA	0.5171
6. F	P9WMY2	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase	1.79e-06	NA	NA	0.5491
6. F	A0A0H2UR96	Glycosyltransferase GlyG	3.77e-05	NA	NA	0.5902
6. F	A0A0H3JPC6	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS	2.34e-03	NA	NA	0.4912
6. F	J9VMX7	Chitin synthase 7	4.37e-05	NA	NA	0.4786
6. F	O13394	Chitin synthase 5	9.84e-04	NA	NA	0.5359
6. F	P64864	Uncharacterized protein Mb1547	1.79e-06	NA	NA	0.4284
6. F	A6X546	Bifunctional protein GlmU	1.81e-03	NA	NA	0.4033
6. F	Q8ZQ26	Glucans biosynthesis glucosyltransferase H	5.08e-08	NA	NA	0.6355
6. F	P37820	Putative mannose-1-phosphate guanyltransferase	3.49e-03	NA	NA	0.4428
6. F	A6T7C6	Glucans biosynthesis glucosyltransferase H	3.73e-08	NA	NA	0.6511
6. F	Q8Z7L8	Glucans biosynthesis glucosyltransferase H	5.09e-08	NA	NA	0.632
6. F	Q8HY56	N-acetyllactosaminide alpha-1,3-galactosyltransferase	1.79e-02	NA	NA	0.4197
6. F	P9WLV4	Uncharacterized protein MT1570	1.10e-05	NA	NA	0.4402
6. F	A0R2E6	Glucosyl-3-phosphoglycerate synthase	1.80e-04	NA	NA	0.4988
6. F	Q4R5T7	Glycosyltransferase 6 domain-containing protein 1	3.48e-03	NA	NA	0.4297
6. F	Q68EY9	Mannose-1-phosphate guanyltransferase beta-A	4.35e-03	NA	NA	0.3953
6. F	Q99VX6	Putative glycosyltransferase TagX	1.19e-06	NA	NA	0.4742
6. F	A1KMV1	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978	7.83e-05	NA	NA	0.559
6. F	Q95158	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1	1.86e-02	NA	NA	0.43
6. F	P0AFA6	Bacteriophage N4 adsorption protein B	2.62e-07	NA	NA	0.612
6. F	Q66PG4	LARGE xylosyl- and glucuronyltransferase 2	1.22e-01	NA	NA	0.3809
6. F	Q92444	Chitin synthase 2	5.56e-05	NA	NA	0.5081
6. F	A1YGR6	N-acetyllactosaminide alpha-1,3-galactosyltransferase	1.12e-02	NA	NA	0.4124
6. F	O13353	Chitin synthase 4	2.92e-05	NA	NA	0.5467
6. F	Q07T77	Glucans biosynthesis glucosyltransferase H	7.85e-08	NA	NA	0.57
6. F	Q5R6K5	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3	2.29e-02	NA	NA	0.4788
6. F	Q4P333	Chitin synthase 7	3.99e-05	NA	NA	0.5169
6. F	P9WMX6	PGL/p-HBAD biosynthesis glycosyltransferase MT3031	1.21e-06	NA	NA	0.5871
6. F	P78611	Chitin synthase D	2.49e-05	NA	NA	0.5568
6. F	Q7BLV3	Hyaluronan synthase	5.98e-03	NA	NA	0.5276
6. F	Q12564	Chitin synthase A	3.48e-05	NA	NA	0.5103
6. F	Q46635	Amylovoran biosynthesis glycosyltransferase AmsE	4.77e-05	NA	NA	0.6297
6. F	P9WMW8	Glucosyl-3-phosphoglycerate synthase	1.82e-04	NA	NA	0.5102
6. F	P30572	Chitin synthase 2	9.55e-05	NA	NA	0.5111
6. F	P78746	Chitin synthase D	2.07e-07	NA	NA	0.5891
6. F	Q5RCB9	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1	2.36e-02	NA	NA	0.4957
6. F	Q8L0V4	Chondroitin synthase	3.19e-04	NA	NA	0.6291
6. F	C5CBV8	Undecaprenyl-phosphate mannosyltransferase	5.88e-06	NA	NA	0.5282
6. F	Q03084	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase	5.43e-07	NA	NA	0.6396
6. F	Q93IN2	Cellulose synthase catalytic subunit [UDP-forming]	1.10e-05	NA	NA	0.5813
6. F	Q9CMP0	Chondroitin synthase	4.89e-03	NA	NA	0.5166
6. F	A5U6W5	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2984	1.59e-06	NA	NA	0.5816
6. F	P71054	Putative glycosyltransferase EpsE	1.10e-06	NA	NA	0.6008
6. F	Q57287	Uncharacterized glycosyltransferase HI_1578	1.64e-05	NA	NA	0.5455
6. F	P30602	Chitin synthase 3	7.03e-05	NA	NA	0.5028
6. F	Q00757	Chitin synthase B	9.69e-05	NA	NA	0.452
6. F	Q7RVR8	Mannose-1-phosphate guanyltransferase	1.66e-02	NA	NA	0.4214
6. F	A0QZ12	Polyprenol monophosphomannose synthase	8.66e-05	NA	NA	0.5174
6. F	Q9WX61	Cellulose synthase 1 catalytic subunit [UDP-forming]	1.10e-07	NA	NA	0.5677
6. F	P0A5A0	PGL/p-HBAD biosynthesis glycosyltransferase Mb2981	2.13e-06	NA	NA	0.5804
6. F	Q48PK6	Glucans biosynthesis glucosyltransferase H	5.99e-07	NA	NA	0.6749
6. F	Q8Z291	Cellulose synthase catalytic subunit [UDP-forming]	1.08e-05	NA	NA	0.5537
6. F	Q6D6A7	Glucans biosynthesis glucosyltransferase H	3.84e-08	NA	NA	0.6102
6. F	Q50864	O-antigen biosynthesis protein RfbC	1.31e-02	NA	NA	0.5309
6. F	P9WMX8	Uncharacterized glycosyltransferase MT1564	1.23e-06	NA	NA	0.641
6. F	P37786	Protein RfbJ	4.24e-05	NA	NA	0.7568
6. F	Q99126	Chitin synthase 3	5.63e-05	NA	NA	0.5105
6. F	Q73WU1	Glucosyl-3-phosphoglycerate synthase	3.12e-04	NA	NA	0.4989
6. F	Q48215	Uncharacterized glycosyltransferase HI_1695	5.21e-05	NA	NA	0.6265
6. F	P58931	Cellulose synthase catalytic subunit [UDP-forming]	1.95e-07	NA	NA	0.5296
6. F	P30589	Chitin synthase 2	1.38e-04	NA	NA	0.5058
6. F	Q9WU83	Dolichol-phosphate mannosyltransferase subunit 1	4.69e-06	NA	NA	0.5841
6. F	A0A0H3JNB0	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarP	1.10e-05	NA	NA	0.5178
6. F	Q92IF9	Uncharacterized glycosyltransferase RC0461	1.61e-04	NA	NA	0.472
6. F	Q6DJM3	Glycosyltransferase 8 domain-containing protein 1	6.62e-02	NA	NA	0.397
6. F	Q7A711	Putative glycosyltransferase TagX	1.65e-06	NA	NA	0.4825
6. F	P47271	Uncharacterized glycosyltransferase MG025	6.38e-05	NA	NA	0.4603