Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54621.1

JCVISYN3A_0115

UTP--glucose-1-phosphate uridylyltransferase.
M. mycoides homolog: Q6MUC2.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 106
Unique PROST Go: 13
Unique BLAST Go: 24
Unique Foldseek Go: 19

Total Homologs: 1645
Unique PROST Homologs: 621
Unique BLAST Homologs: 37
Unique Foldseek Homologs: 588

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: galU; UTP glucose 1 phosphate uridylyltransferase
Zhang et al. [4]: GO:0003983|UTP:glucose-1-phosphate uridylyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P27897 (UTP--glucose-1-phosphate uridylyltransferase) with a FATCAT P-Value: 0 and RMSD of 1.65 angstrom. The sequence alignment identity is 33.9%.
Structural alignment shown in left. Query protein AVX54621.1 colored as red in alignment, homolog P27897 colored as blue. Query protein AVX54621.1 is also shown in right top, homolog P27897 showed in right bottom. They are colored based on secondary structures.

  AVX54621.1 M--TIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAIDSGIKEILIVLNDKKSEIMNYFSRNIELERFLYNKDKINELEQIK-TKYDADI 97
      P27897 MIKPLKKAVLPVAGLGTRFLPATKCVPKEMLTVVDRPLIQYAIDEAREAGIEEFCLVSSRGKDSLIDYFDISYELEDTLKARKKTSALKALEATRV---I 97

  AVX54621.1 HYIMQD-EPLG-LG--HAISLC-KGFINNESFAVLLGDDLFKCQTPAIKQLMDLYEEKHSTILGTIL----IDKKDCKKYGICKTESSND-NVYKVCSVV 187
      P27897 PGTMLSVPPAGTAGPWHAI-WCAREFIGNDPFAILLPDDVVQSKKSCIGQLVEVY---NKT-GGNVLAVTEVPREQTGSYGILDV-GKDDGKTVEVKGLV 191

  AVX54621.1 EKPDEQNAPSNVAIAGRYILTPEIFNYLDLQL-KGETGEIELTDSILRTIKDVDCYAKVIDGKRYDIGNKLGYLEAFVDFASNRDDTKNEFIKIVKKLNE 286
      P27897 EKPDPKDAPSTLSVIGRYVLTADVLKHL-AKLEKGAGGEVQLTDAMAKTIGHVPFHGYRYEGKRFDCGSK---IASWKPRSPLRWSVRN-WLPAC--VNS 284

  AVX54621.1 EETL 290
      P27897 ---- 284

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0016779	nucleotidyltransferase activity
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0045226	extracellular polysaccharide biosynthetic process
1. PBF	GO:0006011	UDP-glucose metabolic process
1. PBF	GO:0005978	glycogen biosynthetic process
1. PBF	GO:0009243	O antigen biosynthetic process
1. PBF	GO:0008879	glucose-1-phosphate thymidylyltransferase activity
1. PBF	GO:0009103	lipopolysaccharide biosynthetic process
1. PBF	GO:0019305	dTDP-rhamnose biosynthetic process
1. PBF	GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity
1. PBF	GO:0047343	glucose-1-phosphate cytidylyltransferase activity
1. PBF	GO:0030234	enzyme regulator activity
1. PBF	GO:0009058	biosynthetic process
1. PBF	GO:0045232	S-layer organization
1. PBF	GO:0071555	cell wall organization
1. PBF	GO:0002134	UTP binding
1. PBF	GO:0097172	N-acetylmuramic acid metabolic process
1. PBF	GO:0008878	glucose-1-phosphate adenylyltransferase activity
1. PBF	GO:0009246	enterobacterial common antigen biosynthetic process
1. PBF	GO:0045227	capsule polysaccharide biosynthetic process
1. PBF	GO:0019300	rhamnose biosynthetic process
2. PF	GO:0050518	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity
2. PF	GO:0033468	CMP-keto-3-deoxy-D-manno-octulosonic acid biosynthetic process
2. PF	GO:0019252	starch biosynthetic process
2. PF	GO:0030931	heterotetrameric ADPG pyrophosphorylase complex
2. PF	GO:0005737	cytoplasm
2. PF	GO:0008690	3-deoxy-manno-octulosonate cytidylyltransferase activity
2. PF	GO:0019288	isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
2. PF	GO:0005524	ATP binding
2. PF	GO:0046872	metal ion binding
2. PF	GO:0009501	amyloplast
3. BF	GO:0014003	oligodendrocyte development
3. BF	GO:0006486	protein glycosylation
3. BF	GO:0006048	UDP-N-acetylglucosamine biosynthetic process
3. BF	GO:0070590	spore wall biogenesis
3. BF	GO:0009298	GDP-mannose biosynthetic process
3. BF	GO:0005851	eukaryotic translation initiation factor 2B complex
3. BF	GO:0000032	cell wall mannoprotein biosynthetic process
3. BF	GO:0000902	cell morphogenesis
3. BF	GO:0003977	UDP-N-acetylglucosamine diphosphorylase activity
3. BF	GO:0009252	peptidoglycan biosynthetic process
3. BF	GO:0004475	mannose-1-phosphate guanylyltransferase activity
3. BF	GO:0052630	UDP-N-acetylgalactosamine diphosphorylase activity
3. BF	GO:0000287	magnesium ion binding
3. BF	GO:0019134	glucosamine-1-phosphate N-acetyltransferase activity
3. BF	GO:0009245	lipid A biosynthetic process
3. BF	GO:0008360	regulation of cell shape
4. PB	GO:0009244	lipopolysaccharide core region biosynthetic process
4. PB	GO:0046075	dTTP metabolic process
4. PB	GO:1900727	osmoregulated periplasmic glucan biosynthetic process
5. P	GO:0016114	terpenoid biosynthetic process
5. P	GO:0043814	phospholactate guanylyltransferase activity
5. P	GO:0047349	D-ribitol-5-phosphate cytidylyltransferase activity
5. P	GO:0008270	zinc ion binding
5. P	GO:0061603	molybdenum cofactor guanylyltransferase activity
5. P	GO:0002135	CTP binding
5. P	GO:0052645	F420-0 metabolic process
5. P	GO:0070567	cytidylyltransferase activity
5. P	GO:0010170	glucose-1-phosphate adenylyltransferase complex
5. P	GO:0008781	N-acylneuraminate cytidylyltransferase activity
5. P	GO:0009254	peptidoglycan turnover
5. P	GO:0008299	isoprenoid biosynthetic process
5. P	GO:1902012	poly(ribitol phosphate) teichoic acid biosynthetic process
6. F	GO:0004476	mannose-6-phosphate isomerase activity
6. F	GO:0005829	cytosol
6. F	GO:0090609	single-species submerged biofilm formation
6. F	GO:0008375	acetylglucosaminyltransferase activity
6. F	GO:0000271	polysaccharide biosynthetic process
6. F	GO:0004653	polypeptide N-acetylgalactosaminyltransferase activity
6. F	GO:0016757	glycosyltransferase activity
6. F	GO:0050501	hyaluronan synthase activity
6. F	GO:0048573	photoperiodism, flowering
6. F	GO:0005634	nucleus
6. F	GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity
6. F	GO:0016021	integral component of membrane
6. F	GO:0043708	cell adhesion involved in biofilm formation
6. F	GO:0005576	extracellular region
6. F	GO:0008685	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
6. F	GO:0030213	hyaluronan biosynthetic process
6. F	GO:0035268	protein mannosylation
6. F	GO:0004169	dolichyl-phosphate-mannose-protein mannosyltransferase activity
6. F	GO:0018243	protein O-linked glycosylation via threonine
7. B	GO:0031369	translation initiation factor binding
7. B	GO:0001541	ovarian follicle development
7. B	GO:0014002	astrocyte development
7. B	GO:0019872	streptomycin biosynthetic process
7. B	GO:0010226	response to lithium ion
7. B	GO:0010193	response to ozone
7. B	GO:0043434	response to peptide hormone
7. B	GO:0070569	uridylyltransferase activity
7. B	GO:0006413	translational initiation
7. B	GO:0035167	larval lymph gland hemopoiesis
7. B	GO:0042552	myelination
7. B	GO:0034976	response to endoplasmic reticulum stress
7. B	GO:0005085	guanyl-nucleotide exchange factor activity
7. B	GO:0033499	galactose catabolic process via UDP-galactose
7. B	GO:0009242	colanic acid biosynthetic process
7. B	GO:0060359	response to ammonium ion
7. B	GO:0030445	yeast-form cell wall
7. B	GO:0050852	T cell receptor signaling pathway
7. B	GO:0032045	guanyl-nucleotide exchange factor complex
7. B	GO:0005525	GTP binding
7. B	GO:0009749	response to glucose
7. B	GO:0048708	astrocyte differentiation
7. B	GO:0007049	cell cycle
7. B	GO:0045948	positive regulation of translational initiation

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0016779	nucleotidyltransferase activity
GO:0009058	biosynthetic process
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity
GO:0006011	UDP-glucose metabolic process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P95778	Glucose-1-phosphate thymidylyltransferase	6.22e-15	4.74e-27	1.48e-16	0.7481
1. PBF	P26393	Glucose-1-phosphate thymidylyltransferase	9.55e-15	1.89e-29	2.10e-14	0.743
1. PBF	Q9ZAE7	Glucose-1-phosphate thymidylyltransferase	1.14e-14	7.80e-19	3.91e-11	0.7682
1. PBF	P55257	Glucose-1-phosphate thymidylyltransferase	1.39e-14	3.87e-27	1.06e-13	0.7392
1. PBF	A0QPF9	Glucose-1-phosphate thymidylyltransferase	1.94e-14	3.43e-28	8.91e-12	0.7618
1. PBF	P0DG73	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	2.03e-71	5.62e-79	0.9607
1. PBF	P55255	Glucose-1-phosphate thymidylyltransferase	1.55e-14	2.86e-28	7.95e-15	0.7483
1. PBF	P0C7J4	Glucose-1-phosphate thymidylyltransferase	1.62e-14	3.57e-27	3.61e-18	0.7395
1. PBF	Q6G6H5	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.22e-83	1.99e-87	0.9714
1. PBF	Q5HLD1	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.18e-83	2.10e-87	0.968
1. PBF	P61888	Glucose-1-phosphate thymidylyltransferase 2	1.24e-14	2.54e-24	1.95e-17	0.7524
1. PBF	B0RVK9	Glucose-1-phosphate thymidylyltransferase	1.49e-14	3.57e-27	3.61e-18	0.7401
1. PBF	P37762	Glucose-1-phosphate thymidylyltransferase	5.55e-15	6.28e-27	4.39e-14	0.7591
1. PBF	P47691	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	7.93e-82	1.73e-66	0.9535
1. PBF	Q9AGY6	D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase	7.55e-15	4.84e-10	2.08e-04	0.7877
1. PBF	Q8NUU9	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.22e-83	1.99e-87	0.9704
1. PBF	Q8CR67	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.18e-83	2.10e-87	0.9664
1. PBF	Q99RD4	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	3.23e-81	2.79e-87	0.9704
1. PBF	P0AEP4	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	6.36e-67	2.13e-49	0.9273
1. PBF	P0DG70	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	1.21e-69	1.53e-76	0.9615
1. PBF	Q2FE05	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	3.23e-81	2.79e-87	0.9704
1. PBF	Q8NKW9	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	2.24e-69	3.38e-76	0.9617
1. PBF	D4GYH1	UTP--glucose-1-phosphate uridylyltransferase AglF	0.00e+00	4.63e-26	1.67e-20	0.859
1. PBF	Q9L9E6	Glucose-1-phosphate thymidylyltransferase	5.22e-15	3.19e-25	2.45e-13	0.7354
1. PBF	P58313	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.60e-77	2.28e-80	0.969
1. PBF	P0AEP6	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	6.36e-67	2.13e-49	0.9285
1. PBF	O31822	Probable UTP--glucose-1-phosphate uridylyltransferase YngB	0.00e+00	1.90e-83	3.17e-84	0.9696
1. PBF	Q59633	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.58e-63	4.98e-57	0.9385
1. PBF	P42407	Putative UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	2.51e-59	4.92e-65	0.9645
1. PBF	P55464	Probable glucose-1-phosphate thymidylyltransferase	3.79e-14	1.06e-26	3.25e-09	0.746
1. PBF	P33696	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	9.25e-72	1.99e-58	0.9549
1. PBF	Q5XE04	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	2.03e-71	5.62e-79	0.9611
1. PBF	P0DG71	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	1.21e-69	1.53e-76	0.9604
1. PBF	P0AEP5	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	6.36e-67	2.13e-49	0.9276
1. PBF	P39629	Glucose-1-phosphate thymidylyltransferase	0.00e+00	2.09e-35	8.54e-21	0.8151
1. PBF	P0C0I9	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	9.58e-69	3.76e-76	0.9613
1. PBF	P67068	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	2.03e-71	5.62e-79	0.9607
1. PBF	Q2YW63	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	5.67e-82	1.25e-86	0.9704
1. PBF	P55253	Glucose-1-phosphate thymidylyltransferase	1.28e-14	4.64e-27	1.13e-15	0.7251
1. PBF	Q6GDU6	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.14e-83	3.25e-87	0.971
1. PBF	P67070	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	2.03e-71	5.62e-79	0.9608
1. PBF	Q5HD54	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	3.23e-81	2.79e-87	0.9702
1. PBF	Q88QT2	N-acetylmuramate alpha-1-phosphate uridylyltransferase	2.22e-16	4.35e-13	1.48e-04	0.7773
1. PBF	Q4L8Y7	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	5.58e-83	1.11e-87	0.9643
1. PBF	Q4A122	UTP--glucose-1-phosphate uridylyltransferase 1	0.00e+00	5.77e-83	1.34e-83	0.9659
1. PBF	P9WH12	Glucose-1-phosphate thymidylyltransferase	1.71e-14	3.97e-28	2.83e-09	0.7244
1. PBF	P0A2K7	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.15e-68	1.88e-46	0.9473
1. PBF	Q54800	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.81e-69	2.46e-73	0.9622
1. PBF	Q05852	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.65e-88	1.41e-88	0.9746
1. PBF	P0DG72	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	2.03e-71	5.62e-79	0.9628
1. PBF	Q0P8J8	CTP:phosphoglutamine cytidylyltransferase	5.28e-13	2.87e-17	2.76e-04	0.6913
1. PBF	Q5X9A7	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	1.21e-69	1.53e-76	0.9614
1. PBF	P0AAB7	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	4.86e-66	3.29e-47	0.9303
1. PBF	P75124	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	7.93e-82	1.48e-63	0.9537
1. PBF	Q9I291	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	2.94e-63	3.75e-59	0.9321
1. PBF	O06486	Probable glucose-1-phosphate cytidylyltransferase	1.01e-07	4.46e-15	6.87e-05	0.6908
1. PBF	P44878	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	5.56e-70	1.94e-52	0.9392
1. PBF	P27897	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	4.44e-62	1.14e-50	0.9431
1. PBF	P0C0I8	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	2.24e-69	3.38e-76	0.9609
1. PBF	P37776	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	4.05e-66	6.96e-47	0.9267
1. PBF	P55254	Glucose-1-phosphate thymidylyltransferase	9.10e-15	2.29e-27	8.96e-16	0.7429
1. PBF	Q9F664	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	6.10e-70	2.19e-54	0.9419
1. PBF	P0A2K8	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	1.15e-68	1.88e-46	0.9474
1. PBF	Q49VP4	UTP--glucose-1-phosphate uridylyltransferase 2	0.00e+00	6.50e-81	4.20e-83	0.9715
1. PBF	Q48447	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	2.28e-66	1.29e-46	0.9365
1. PBF	Q7A3J9	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	3.23e-81	2.79e-87	0.9704
1. PBF	P37779	Glucose-1-phosphate thymidylyltransferase 1	1.15e-14	2.48e-27	3.15e-16	0.7427
1. PBF	P57040	Glucose-1-phosphate thymidylyltransferase	9.21e-15	7.79e-28	1.90e-14	0.7469
2. PF	Q62HI2	3-deoxy-manno-octulosonate cytidylyltransferase	2.41e-10	2.44e-04	NA	0.5894
2. PF	A7MGF4	Glucose-1-phosphate adenylyltransferase	2.68e-11	3.19e-02	NA	0.6991
2. PF	Q2LY80	3-deoxy-manno-octulosonate cytidylyltransferase	3.04e-10	9.81e-06	NA	0.6643
2. PF	A8EZ55	3-deoxy-manno-octulosonate cytidylyltransferase	3.97e-11	8.70e-07	NA	0.6623
2. PF	Q11AX2	3-deoxy-manno-octulosonate cytidylyltransferase	6.82e-11	7.57e-08	NA	0.6095
2. PF	B1YVD9	3-deoxy-manno-octulosonate cytidylyltransferase 1	5.36e-10	2.22e-04	NA	0.6166
2. PF	Q5F9Y9	3-deoxy-manno-octulosonate cytidylyltransferase	4.45e-10	4.79e-04	NA	0.6224
2. PF	Q1MN23	3-deoxy-manno-octulosonate cytidylyltransferase	7.81e-11	5.12e-08	NA	0.6454
2. PF	P44490	3-deoxy-manno-octulosonate cytidylyltransferase	1.77e-10	2.45e-05	NA	0.6743
2. PF	P30522	Glucose-1-phosphate adenylyltransferase (Fragment)	5.00e-15	3.52e-15	NA	0.7632
2. PF	B0SA58	3-deoxy-manno-octulosonate cytidylyltransferase	2.34e-10	4.18e-06	NA	0.6797
2. PF	Q9ZDF0	3-deoxy-manno-octulosonate cytidylyltransferase	5.52e-11	3.12e-08	NA	0.646
2. PF	A6WUU4	3-deoxy-manno-octulosonate cytidylyltransferase	7.78e-11	4.36e-09	NA	0.6719
2. PF	Q1IU72	3-deoxy-manno-octulosonate cytidylyltransferase	7.22e-11	1.57e-02	NA	0.6466
2. PF	A9M6P3	3-deoxy-manno-octulosonate cytidylyltransferase	6.17e-11	2.05e-09	NA	0.65
2. PF	B5YUI6	Glucose-1-phosphate adenylyltransferase	2.86e-11	4.96e-02	NA	0.7034
2. PF	Q74BY2	3-deoxy-manno-octulosonate cytidylyltransferase	6.17e-10	2.17e-04	NA	0.6859
2. PF	Q11R71	3-deoxy-manno-octulosonate cytidylyltransferase	1.30e-09	5.85e-07	NA	0.6429
2. PF	Q083F6	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.68e-10	2.15e-06	NA	0.6876
2. PF	C6E0M8	3-deoxy-manno-octulosonate cytidylyltransferase	5.32e-10	2.90e-05	NA	0.6666
2. PF	B1IP34	Glucose-1-phosphate adenylyltransferase	2.58e-11	4.96e-02	NA	0.694
2. PF	Q1QR80	3-deoxy-manno-octulosonate cytidylyltransferase	1.89e-10	6.76e-07	NA	0.6687
2. PF	A9AGK2	3-deoxy-manno-octulosonate cytidylyltransferase	6.15e-10	1.54e-03	NA	0.5896
2. PF	B5E8N2	3-deoxy-manno-octulosonate cytidylyltransferase	4.86e-10	3.17e-05	NA	0.6662
2. PF	Q7UI86	3-deoxy-manno-octulosonate cytidylyltransferase	3.39e-10	8.53e-05	NA	0.6466
2. PF	Q2VZK3	3-deoxy-manno-octulosonate cytidylyltransferase	4.65e-10	5.52e-09	NA	0.6522
2. PF	Q7W7F9	3-deoxy-manno-octulosonate cytidylyltransferase	4.49e-10	3.77e-06	NA	0.6314
2. PF	A1RJ74	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.26e-10	9.35e-07	NA	0.684
2. PF	Q3SH75	Glucose-1-phosphate adenylyltransferase	1.50e-11	3.91e-03	NA	0.7203
2. PF	Q8KBF7	3-deoxy-manno-octulosonate cytidylyltransferase	1.10e-10	7.25e-04	NA	0.6454
2. PF	A4Y7B5	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.93e-10	1.40e-06	NA	0.6856
2. PF	Q1RHU5	3-deoxy-manno-octulosonate cytidylyltransferase	6.91e-11	1.90e-07	NA	0.6591
2. PF	Q632H2	Glucose-1-phosphate adenylyltransferase	1.44e-13	1.00e-02	NA	0.7147
2. PF	Q97GX8	Glucose-1-phosphate adenylyltransferase	8.76e-14	3.98e-02	NA	0.7155
2. PF	Q6MD00	3-deoxy-manno-octulosonate cytidylyltransferase	3.55e-10	3.43e-06	NA	0.6245
2. PF	Q92SX6	3-deoxy-manno-octulosonate cytidylyltransferase	8.41e-11	2.32e-07	NA	0.669
2. PF	A7GUA0	Glucose-1-phosphate adenylyltransferase	1.83e-13	5.14e-03	NA	0.7124
2. PF	B6I2Z6	Glucose-1-phosphate adenylyltransferase	2.59e-11	4.96e-02	NA	0.7143
2. PF	B3QXK8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.78e-10	1.58e-04	NA	0.6063
2. PF	Q0TC29	Glucose-1-phosphate adenylyltransferase	2.86e-11	4.96e-02	NA	0.6834
2. PF	A6VQ31	3-deoxy-manno-octulosonate cytidylyltransferase	1.77e-10	1.58e-04	NA	0.6596
2. PF	O66914	3-deoxy-manno-octulosonate cytidylyltransferase	5.36e-11	9.81e-06	NA	0.6986
2. PF	Q8YEH4	3-deoxy-manno-octulosonate cytidylyltransferase	7.45e-11	6.81e-09	NA	0.6548
2. PF	Q9Z8U9	3-deoxy-manno-octulosonate cytidylyltransferase	1.26e-10	2.96e-05	NA	0.6597
2. PF	Q14GD1	3-deoxy-manno-octulosonate cytidylyltransferase	5.57e-10	7.65e-05	NA	0.668
2. PF	Q04XW6	3-deoxy-manno-octulosonate cytidylyltransferase	2.05e-10	3.93e-04	NA	0.638
2. PF	Q6AAV8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.94e-07	5.21e-05	NA	0.5439
2. PF	Q72YJ4	Glucose-1-phosphate adenylyltransferase	2.13e-13	1.06e-02	NA	0.7134
2. PF	Q8F0C3	3-deoxy-manno-octulosonate cytidylyltransferase	2.13e-10	1.44e-05	NA	0.6467
2. PF	Q6G4U6	3-deoxy-manno-octulosonate cytidylyltransferase	1.37e-10	1.78e-06	NA	0.6717
2. PF	B9J2G7	Glucose-1-phosphate adenylyltransferase	1.85e-13	1.20e-02	NA	0.6992
2. PF	Q12MB0	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.83e-10	9.81e-07	NA	0.6556
2. PF	A0RK86	Glucose-1-phosphate adenylyltransferase	3.31e-13	6.95e-03	NA	0.7155
2. PF	A8IGU8	3-deoxy-manno-octulosonate cytidylyltransferase	6.66e-11	1.25e-08	NA	0.6651
2. PF	P0A6V3	Glucose-1-phosphate adenylyltransferase	3.08e-11	4.96e-02	NA	0.7047
2. PF	B4UIT7	3-deoxy-manno-octulosonate cytidylyltransferase	7.23e-11	7.09e-05	NA	0.7062
2. PF	B7M2J3	Glucose-1-phosphate adenylyltransferase	2.60e-11	4.96e-02	NA	0.7046
2. PF	B3R0X8	3-deoxy-manno-octulosonate cytidylyltransferase	3.59e-10	5.50e-03	NA	0.5917
2. PF	Q816G7	Glucose-1-phosphate adenylyltransferase	2.95e-13	6.25e-03	NA	0.7125
2. PF	A8GW69	3-deoxy-manno-octulosonate cytidylyltransferase	7.23e-11	1.90e-07	NA	0.6629
2. PF	A4WFL3	Glucose-1-phosphate adenylyltransferase	5.39e-11	4.36e-02	NA	0.7038
2. PF	A8FW10	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.79e-10	2.20e-06	NA	0.6808
2. PF	B3QP85	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.05e-09	2.24e-04	NA	0.6524
2. PF	B1JXF7	3-deoxy-manno-octulosonate cytidylyltransferase	6.78e-10	9.72e-05	NA	0.6107
2. PF	B3EMY6	3-deoxy-manno-octulosonate cytidylyltransferase	5.39e-11	9.59e-06	NA	0.6618
2. PF	Q5X3Y7	3-deoxy-manno-octulosonate cytidylyltransferase	1.13e-10	2.10e-06	NA	0.6754
2. PF	C0RGA2	3-deoxy-manno-octulosonate cytidylyltransferase	6.44e-11	6.81e-09	NA	0.6557
2. PF	O25016	3-deoxy-manno-octulosonate cytidylyltransferase	1.65e-09	1.87e-05	NA	0.6655
2. PF	B0SK97	3-deoxy-manno-octulosonate cytidylyltransferase	2.26e-10	4.18e-06	NA	0.689
2. PF	Q9I5U0	N-acetylmuramate alpha-1-phosphate uridylyltransferase	2.22e-16	6.55e-09	NA	0.7846
2. PF	B8ICG5	3-deoxy-manno-octulosonate cytidylyltransferase	4.65e-11	1.05e-07	NA	0.6777
2. PF	B3QGN5	3-deoxy-manno-octulosonate cytidylyltransferase	2.13e-10	1.90e-08	NA	0.6911
2. PF	Q1GZI3	3-deoxy-manno-octulosonate cytidylyltransferase	2.18e-10	1.37e-02	NA	0.6358
2. PF	Q1BU67	3-deoxy-manno-octulosonate cytidylyltransferase	6.16e-10	9.30e-05	NA	0.6004
2. PF	Q32AV5	Glucose-1-phosphate adenylyltransferase	3.30e-11	4.96e-02	NA	0.704
2. PF	P0A6V2	Glucose-1-phosphate adenylyltransferase	2.88e-11	4.96e-02	NA	0.7015
2. PF	A6WNW2	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.44e-10	1.34e-06	NA	0.6714
2. PF	Q3JVB0	3-deoxy-manno-octulosonate cytidylyltransferase	3.71e-10	2.44e-04	NA	0.5933
2. PF	Q0HUU0	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	6.92e-10	7.35e-07	NA	0.6847
2. PF	Q81K83	Glucose-1-phosphate adenylyltransferase	2.71e-13	1.00e-02	NA	0.7157
2. PF	P55625	Uncharacterized protein y4qD	3.35e-10	4.67e-05	NA	0.7139
2. PF	Q822T3	3-deoxy-manno-octulosonate cytidylyltransferase	2.00e-10	4.45e-04	NA	0.6406
2. PF	Q63WL5	3-deoxy-manno-octulosonate cytidylyltransferase	2.63e-10	2.44e-04	NA	0.5881
2. PF	A1UU32	3-deoxy-manno-octulosonate cytidylyltransferase	8.22e-11	7.86e-08	NA	0.6971
2. PF	Q5N120	3-deoxy-manno-octulosonate cytidylyltransferase	2.39e-10	6.14e-07	NA	0.6792
2. PF	A4SF04	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.17e-10	6.01e-05	NA	0.6774
2. PF	A8GRV7	3-deoxy-manno-octulosonate cytidylyltransferase	8.74e-11	3.31e-06	NA	0.6618
2. PF	A4QD83	Glucose-1-phosphate adenylyltransferase	1.17e-11	2.75e-02	NA	0.6866
2. PF	A3MN47	3-deoxy-manno-octulosonate cytidylyltransferase	3.40e-10	2.44e-04	NA	0.582
2. PF	A5FBA3	3-deoxy-manno-octulosonate cytidylyltransferase	5.24e-10	8.39e-07	NA	0.6722
2. PF	Q15JG4	Valienol-1-phosphate guanylyltransferase	3.68e-07	1.72e-04	NA	0.6726
2. PF	Q8EEA9	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	7.17e-10	7.63e-07	NA	0.6854
2. PF	Q21TN7	3-deoxy-manno-octulosonate cytidylyltransferase	5.73e-09	1.98e-05	NA	0.5893
2. PF	Q8Z5I4	Glucose-1-phosphate cytidylyltransferase	2.17e-07	3.75e-15	NA	0.6673
2. PF	A9CKP8	3-deoxy-manno-octulosonate cytidylyltransferase	1.29e-11	2.07e-07	NA	0.6631
2. PF	B9M9Q4	3-deoxy-manno-octulosonate cytidylyltransferase	1.23e-10	1.31e-04	NA	0.6991
2. PF	B1X775	Glucose-1-phosphate adenylyltransferase	3.32e-11	4.96e-02	NA	0.6942
2. PF	Q8A9S0	3-deoxy-manno-octulosonate cytidylyltransferase	1.95e-10	2.36e-06	NA	0.6517
2. PF	B1ZJ23	3-deoxy-manno-octulosonate cytidylyltransferase	2.80e-11	2.68e-08	NA	0.6805
2. PF	B1JHX9	Glucose-1-phosphate adenylyltransferase	1.44e-11	2.12e-02	NA	0.6845
2. PF	Q3AS33	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.62e-07	5.88e-05	NA	0.655
2. PF	A4SD67	3-deoxy-manno-octulosonate cytidylyltransferase	5.17e-11	1.54e-06	NA	0.6295
2. PF	A1BI64	3-deoxy-manno-octulosonate cytidylyltransferase	6.28e-11	7.90e-05	NA	0.6632
2. PF	B3EAK6	3-deoxy-manno-octulosonate cytidylyltransferase	4.29e-10	1.05e-04	NA	0.6815
2. PF	Q9JXY0	N-acetylmuramate alpha-1-phosphate uridylyltransferase	1.93e-14	7.75e-15	NA	0.7533
2. PF	Q0KE19	3-deoxy-manno-octulosonate cytidylyltransferase	2.53e-10	1.04e-03	NA	0.5961
2. PF	A1S639	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	6.93e-10	1.19e-06	NA	0.6764
2. PF	A8A5P0	Glucose-1-phosphate adenylyltransferase	2.53e-11	4.96e-02	NA	0.6971
2. PF	Q1DDB3	3-deoxy-manno-octulosonate cytidylyltransferase	9.58e-11	1.54e-06	NA	0.6445
2. PF	A8ZWH0	3-deoxy-manno-octulosonate cytidylyltransferase	2.16e-10	2.89e-04	NA	0.6513
2. PF	Q31DP4	3-deoxy-manno-octulosonate cytidylyltransferase 2	1.93e-10	2.07e-05	NA	0.6748
2. PF	A9L3N6	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.67e-10	8.20e-07	NA	0.6825
2. PF	B9JGV0	3-deoxy-manno-octulosonate cytidylyltransferase	8.79e-11	1.03e-08	NA	0.6788
2. PF	A6L5J0	3-deoxy-manno-octulosonate cytidylyltransferase	6.09e-11	3.05e-06	NA	0.636
2. PF	B4SES6	3-deoxy-manno-octulosonate cytidylyltransferase	4.98e-11	1.10e-05	NA	0.6598
2. PF	C4ZVY0	Glucose-1-phosphate adenylyltransferase	2.81e-11	4.96e-02	NA	0.6957
2. PF	B7L4W0	Glucose-1-phosphate adenylyltransferase	3.19e-11	4.96e-02	NA	0.6979
2. PF	Q254V8	3-deoxy-manno-octulosonate cytidylyltransferase	1.89e-10	1.01e-03	NA	0.6509
2. PF	A9VZK8	3-deoxy-manno-octulosonate cytidylyltransferase	3.30e-11	2.16e-08	NA	0.6713
2. PF	A6L9D4	3-deoxy-manno-octulosonate cytidylyltransferase	2.53e-10	4.33e-06	NA	0.6636
2. PF	P39122	Glucose-1-phosphate adenylyltransferase	4.23e-13	2.96e-02	NA	0.7153
2. PF	A5G5T4	3-deoxy-manno-octulosonate cytidylyltransferase	4.32e-10	3.66e-05	NA	0.6848
2. PF	B1LI91	Glucose-1-phosphate adenylyltransferase	2.87e-11	4.96e-02	NA	0.7033
2. PF	Q68WZ5	3-deoxy-manno-octulosonate cytidylyltransferase	1.79e-10	1.05e-07	NA	0.661
2. PF	A1STD0	3-deoxy-manno-octulosonate cytidylyltransferase	3.21e-10	4.59e-06	NA	0.6597
2. PF	A5UFM6	3-deoxy-manno-octulosonate cytidylyltransferase	1.08e-10	1.35e-05	NA	0.687
2. PF	B2K6F9	Glucose-1-phosphate adenylyltransferase	3.77e-11	2.65e-02	NA	0.7041
2. PF	B7N1M2	Glucose-1-phosphate adenylyltransferase	2.54e-11	4.96e-02	NA	0.6875
2. PF	A1IQS6	3-deoxy-manno-octulosonate cytidylyltransferase	2.67e-10	4.84e-04	NA	0.6506
2. PF	Q210C0	3-deoxy-manno-octulosonate cytidylyltransferase	2.38e-10	5.37e-07	NA	0.6841
2. PF	B3QL08	3-deoxy-manno-octulosonate cytidylyltransferase	1.35e-10	1.30e-03	NA	0.6921
2. PF	A8GN86	3-deoxy-manno-octulosonate cytidylyltransferase	5.88e-11	1.20e-06	NA	0.6485
2. PF	A1VNK3	3-deoxy-manno-octulosonate cytidylyltransferase	4.92e-10	2.04e-04	NA	0.6186
2. PF	A0KWG8	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	7.04e-10	7.35e-07	NA	0.6686
2. PF	Q0SZN4	Glucose-1-phosphate adenylyltransferase	3.21e-11	4.96e-02	NA	0.6927
2. PF	Q6NHY8	Glucose-1-phosphate adenylyltransferase	1.60e-11	5.10e-04	NA	0.6808
2. PF	B3EG58	3-deoxy-manno-octulosonate cytidylyltransferase	1.03e-10	7.65e-05	NA	0.6322
2. PF	O08326	Glucose-1-phosphate adenylyltransferase	1.97e-13	2.55e-02	NA	0.725
2. PF	Q7WKU7	3-deoxy-manno-octulosonate cytidylyltransferase	3.89e-10	3.47e-06	NA	0.6255
2. PF	Q4ULX8	3-deoxy-manno-octulosonate cytidylyltransferase	6.46e-11	7.27e-07	NA	0.6522
2. PF	A3N6K5	3-deoxy-manno-octulosonate cytidylyltransferase	2.85e-10	2.44e-04	NA	0.6093
2. PF	B2RLM4	3-deoxy-manno-octulosonate cytidylyltransferase	6.92e-11	4.27e-05	NA	0.6293
2. PF	A6Q3P4	3-deoxy-manno-octulosonate cytidylyltransferase	1.81e-09	5.37e-04	NA	0.6365
2. PF	A7IIM9	3-deoxy-manno-octulosonate cytidylyltransferase	1.06e-10	2.42e-06	NA	0.6535
2. PF	Q0HJ42	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.57e-10	7.35e-07	NA	0.6708
2. PF	A9M2V7	3-deoxy-manno-octulosonate cytidylyltransferase	3.45e-10	3.97e-04	NA	0.6097
2. PF	A9BWI2	3-deoxy-manno-octulosonate cytidylyltransferase	2.46e-09	3.28e-05	NA	0.6115
2. PF	Q5L5S2	3-deoxy-manno-octulosonate cytidylyltransferase	1.81e-10	4.70e-06	NA	0.6386
2. PF	H2K888	Valienol-1-phosphate guanylyltransferase	4.68e-07	4.54e-04	NA	0.6734
2. PF	B4SAG7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.28e-10	1.38e-05	NA	0.6793
2. PF	A6UF15	3-deoxy-manno-octulosonate cytidylyltransferase	8.11e-11	9.60e-08	NA	0.6731
2. PF	Q3YW95	Glucose-1-phosphate adenylyltransferase	2.65e-11	4.96e-02	NA	0.7008
2. PF	P42216	3-deoxy-manno-octulosonate cytidylyltransferase	7.60e-12	1.04e-05	NA	0.6984
2. PF	B8E9F5	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	5.64e-10	9.24e-07	NA	0.671
2. PF	Q3SVY8	3-deoxy-manno-octulosonate cytidylyltransferase	1.01e-10	6.93e-08	NA	0.6788
2. PF	P0A6V4	Glucose-1-phosphate adenylyltransferase	3.07e-11	4.96e-02	NA	0.696
2. PF	Q31KU9	3-deoxy-manno-octulosonate cytidylyltransferase	2.04e-10	6.14e-07	NA	0.6821
2. PF	A8H420	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.29e-10	3.70e-05	NA	0.6347
2. PF	P39124	Glycogen biosynthesis protein GlgD	6.80e-10	1.01e-02	NA	0.6009
2. PF	B1KDR7	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.66e-10	5.04e-06	NA	0.6519
2. PF	B0BZZ7	3-deoxy-manno-octulosonate cytidylyltransferase	1.37e-10	1.58e-06	NA	0.6856
2. PF	A6VUC8	3-deoxy-manno-octulosonate cytidylyltransferase	2.36e-10	4.31e-03	NA	0.6068
2. PF	A4IS22	Glucose-1-phosphate adenylyltransferase	2.92e-13	3.70e-02	NA	0.723
2. PF	Q133H9	3-deoxy-manno-octulosonate cytidylyltransferase	2.01e-10	4.91e-09	NA	0.6822
2. PF	Q30V56	3-deoxy-manno-octulosonate cytidylyltransferase	9.12e-11	4.22e-04	NA	0.6541
2. PF	B0UNK9	3-deoxy-manno-octulosonate cytidylyltransferase	5.49e-11	1.40e-07	NA	0.6943
2. PF	A5VMY8	3-deoxy-manno-octulosonate cytidylyltransferase	7.15e-11	4.30e-09	NA	0.6514
2. PF	B0BXB4	3-deoxy-manno-octulosonate cytidylyltransferase	5.75e-11	1.26e-06	NA	0.656
2. PF	Q8G3B2	3-deoxy-manno-octulosonate cytidylyltransferase	5.86e-11	2.05e-09	NA	0.6693
2. PF	Q2KDX9	3-deoxy-manno-octulosonate cytidylyltransferase	4.59e-11	1.39e-08	NA	0.6486
2. PF	B4RJR9	3-deoxy-manno-octulosonate cytidylyltransferase	2.89e-10	4.79e-04	NA	0.626
2. PF	Q8RFA8	3-deoxy-manno-octulosonate cytidylyltransferase	6.29e-11	4.49e-06	NA	0.6965
2. PF	B7L043	3-deoxy-manno-octulosonate cytidylyltransferase	2.68e-11	3.01e-08	NA	0.6817
2. PF	Q89UJ4	3-deoxy-manno-octulosonate cytidylyltransferase	2.36e-10	6.46e-09	NA	0.6976
2. PF	A8F1E9	3-deoxy-manno-octulosonate cytidylyltransferase	6.79e-11	1.82e-06	NA	0.6633
2. PF	P57883	3-deoxy-manno-octulosonate cytidylyltransferase	1.40e-10	1.23e-04	NA	0.6425
2. PF	A0LE62	3-deoxy-manno-octulosonate cytidylyltransferase	1.05e-10	5.57e-05	NA	0.6586
2. PF	P14183	Protein LicC	1.74e-14	1.72e-09	NA	0.7399
2. PF	Q65U18	3-deoxy-manno-octulosonate cytidylyltransferase	1.83e-10	2.07e-05	NA	0.6524
2. PF	Q2IH80	3-deoxy-manno-octulosonate cytidylyltransferase	6.71e-11	7.16e-05	NA	0.7102
2. PF	Q98BN3	3-deoxy-manno-octulosonate cytidylyltransferase	1.19e-10	3.87e-09	NA	0.6667
2. PF	A1V116	3-deoxy-manno-octulosonate cytidylyltransferase	2.59e-10	2.44e-04	NA	0.588
2. PF	Q7M829	3-deoxy-manno-octulosonate cytidylyltransferase	1.65e-09	2.56e-05	NA	0.644
2. PF	B6JJE4	3-deoxy-manno-octulosonate cytidylyltransferase	1.14e-10	9.97e-08	NA	0.6838
2. PF	B5YGT5	3-deoxy-manno-octulosonate cytidylyltransferase	5.11e-10	5.66e-06	NA	0.6599
2. PF	Q2IZ84	3-deoxy-manno-octulosonate cytidylyltransferase	1.76e-10	1.19e-08	NA	0.7003
2. PF	C1A8V7	3-deoxy-manno-octulosonate cytidylyltransferase	3.39e-10	7.90e-06	NA	0.6118
2. PF	B8DIL4	3-deoxy-manno-octulosonate cytidylyltransferase	3.69e-10	3.69e-04	NA	0.5871
2. PF	A7ZSW3	Glucose-1-phosphate adenylyltransferase	2.61e-11	4.96e-02	NA	0.6948
2. PF	A7HPP1	3-deoxy-manno-octulosonate cytidylyltransferase	1.94e-10	7.11e-08	NA	0.6208
2. PF	Q92I96	3-deoxy-manno-octulosonate cytidylyltransferase	5.34e-11	1.00e-06	NA	0.6506
2. PF	A6GYA2	3-deoxy-manno-octulosonate cytidylyltransferase	5.09e-10	1.05e-06	NA	0.6526
2. PF	Q39W63	3-deoxy-manno-octulosonate cytidylyltransferase	1.16e-10	3.62e-05	NA	0.6781
2. PF	Q5NEX8	3-deoxy-manno-octulosonate cytidylyltransferase	6.61e-10	7.65e-05	NA	0.6695
2. PF	A0KLX9	3-deoxy-manno-octulosonate cytidylyltransferase	1.53e-10	5.99e-06	NA	0.6725
2. PF	B3QTV9	3-deoxy-manno-octulosonate cytidylyltransferase	1.22e-10	2.80e-05	NA	0.684
2. PF	Q6MPP1	3-deoxy-manno-octulosonate cytidylyltransferase	5.25e-11	1.19e-04	NA	0.6822
2. PF	A5ERZ6	3-deoxy-manno-octulosonate cytidylyltransferase	2.28e-10	4.11e-07	NA	0.677
2. PF	Q726J3	3-deoxy-manno-octulosonate cytidylyltransferase	9.28e-11	2.37e-05	NA	0.6149
2. PF	A0M2E8	3-deoxy-manno-octulosonate cytidylyltransferase	1.07e-09	8.06e-08	NA	0.6394
2. PF	Q0BL48	3-deoxy-manno-octulosonate cytidylyltransferase	3.92e-10	6.71e-05	NA	0.6739
2. PF	Q2KZE5	3-deoxy-manno-octulosonate cytidylyltransferase	6.88e-10	4.79e-04	NA	0.5996
2. PF	Q2RPI7	3-deoxy-manno-octulosonate cytidylyltransferase	4.45e-10	2.32e-07	NA	0.6478
2. PF	P23509	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic	1.94e-10	1.69e-02	NA	0.6897
2. PF	Q47B45	3-deoxy-manno-octulosonate cytidylyltransferase	9.27e-11	1.32e-05	NA	0.6458
2. PF	C4K2D9	3-deoxy-manno-octulosonate cytidylyltransferase	6.91e-11	9.24e-07	NA	0.6422
2. PF	A4W8T7	3-deoxy-manno-octulosonate cytidylyltransferase	1.89e-10	9.93e-05	NA	0.6926
2. PF	B2KD62	3-deoxy-manno-octulosonate cytidylyltransferase	2.78e-10	2.10e-05	NA	0.6852
2. PF	Q6HC16	Glucose-1-phosphate adenylyltransferase	3.05e-13	1.00e-02	NA	0.7131
2. PF	Q3IGX8	3-deoxy-manno-octulosonate cytidylyltransferase	1.16e-10	4.00e-05	NA	0.656
2. PF	B3PXG0	3-deoxy-manno-octulosonate cytidylyltransferase	1.13e-10	3.83e-08	NA	0.6331
2. PF	Q7MTW6	3-deoxy-manno-octulosonate cytidylyltransferase	7.68e-11	4.00e-05	NA	0.6249
2. PF	P26396	Glucose-1-phosphate cytidylyltransferase	2.28e-07	1.29e-15	NA	0.6671
2. PF	P55233	Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic	2.83e-10	1.85e-03	NA	0.6923
2. PF	B5Z9Z7	3-deoxy-manno-octulosonate cytidylyltransferase	1.49e-09	1.02e-05	NA	0.6616
2. PF	Q01T78	3-deoxy-manno-octulosonate cytidylyltransferase	3.17e-10	8.20e-04	NA	0.6255
2. PF	A1APF8	3-deoxy-manno-octulosonate cytidylyltransferase	1.54e-10	4.09e-05	NA	0.6615
2. PF	C3PN96	3-deoxy-manno-octulosonate cytidylyltransferase	6.87e-11	1.15e-06	NA	0.65
2. PF	A1VA25	3-deoxy-manno-octulosonate cytidylyltransferase	9.52e-11	1.87e-05	NA	0.6226
2. PF	A2S515	3-deoxy-manno-octulosonate cytidylyltransferase	3.92e-10	2.44e-04	NA	0.5809
2. PF	Q04VK9	3-deoxy-manno-octulosonate cytidylyltransferase	1.69e-10	3.93e-04	NA	0.6357
2. PF	A5EW69	3-deoxy-manno-octulosonate cytidylyltransferase	9.40e-10	9.46e-07	NA	0.6627
2. PF	Q3ATT2	3-deoxy-manno-octulosonate cytidylyltransferase	8.24e-11	1.83e-05	NA	0.6416
2. PF	Q9A2M1	N-acetylmuramate alpha-1-phosphate uridylyltransferase	1.57e-13	6.82e-17	NA	0.7583
2. PF	B8JBN7	3-deoxy-manno-octulosonate cytidylyltransferase	5.45e-11	9.93e-05	NA	0.699
2. PF	B8CMP6	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.86e-10	4.92e-06	NA	0.6825
2. PF	Q5WVD2	3-deoxy-manno-octulosonate cytidylyltransferase	8.55e-11	2.00e-06	NA	0.6805
2. PF	Q0BCH2	3-deoxy-manno-octulosonate cytidylyltransferase 1	5.41e-10	3.35e-04	NA	0.6129
2. PF	Q1MPN4	3-deoxy-manno-octulosonate cytidylyltransferase	3.00e-11	3.50e-05	NA	0.6531
2. PF	A7FNX3	Glucose-1-phosphate adenylyltransferase	3.73e-11	2.12e-02	NA	0.7017
2. PF	B5ZWP0	3-deoxy-manno-octulosonate cytidylyltransferase	8.80e-11	5.67e-08	NA	0.6366
2. PF	Q6N3J9	3-deoxy-manno-octulosonate cytidylyltransferase	2.04e-10	1.71e-08	NA	0.677
2. PF	Q72UN2	3-deoxy-manno-octulosonate cytidylyltransferase	2.60e-10	1.20e-05	NA	0.6574
2. PF	C1F3B8	3-deoxy-manno-octulosonate cytidylyltransferase	2.07e-11	1.47e-07	NA	0.6707
2. PF	Q57FX6	3-deoxy-manno-octulosonate cytidylyltransferase	7.62e-11	6.81e-09	NA	0.6216
2. PF	A4YLY9	3-deoxy-manno-octulosonate cytidylyltransferase	2.07e-10	4.18e-08	NA	0.6632
2. PF	B0CI58	3-deoxy-manno-octulosonate cytidylyltransferase	6.17e-11	6.81e-09	NA	0.627
2. PF	C3PFJ1	Glucose-1-phosphate adenylyltransferase	1.04e-11	2.41e-02	NA	0.6794
2. PF	B7NE40	Glucose-1-phosphate adenylyltransferase	2.45e-11	4.96e-02	NA	0.6836
2. PF	Q7VVB0	3-deoxy-manno-octulosonate cytidylyltransferase	4.57e-10	4.23e-06	NA	0.6231
2. PF	A9VM89	Glucose-1-phosphate adenylyltransferase	2.58e-13	1.04e-02	NA	0.7195
2. PF	B6JKG1	3-deoxy-manno-octulosonate cytidylyltransferase	1.50e-09	2.51e-05	NA	0.6475
2. PF	Q07K36	3-deoxy-manno-octulosonate cytidylyltransferase	8.29e-11	6.93e-08	NA	0.6946
2. PF	A7HIF1	3-deoxy-manno-octulosonate cytidylyltransferase	5.78e-11	1.37e-04	NA	0.6917
2. PF	Q6G0M4	3-deoxy-manno-octulosonate cytidylyltransferase	1.52e-10	4.59e-07	NA	0.6375
2. PF	Q3A370	3-deoxy-manno-octulosonate cytidylyltransferase	3.96e-10	2.51e-05	NA	0.6688
2. PF	B6IWU1	3-deoxy-manno-octulosonate cytidylyltransferase	3.47e-10	1.93e-07	NA	0.6453
2. PF	A3D555	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	4.42e-10	9.24e-07	NA	0.6603
2. PF	B4S4I2	3-deoxy-manno-octulosonate cytidylyltransferase	3.88e-11	3.07e-07	NA	0.6494
2. PF	B4E9G0	3-deoxy-manno-octulosonate cytidylyltransferase	5.71e-10	6.28e-05	NA	0.6041
2. PF	B2S7U2	3-deoxy-manno-octulosonate cytidylyltransferase	7.37e-11	6.81e-09	NA	0.6254
2. PF	B1LVX5	3-deoxy-manno-octulosonate cytidylyltransferase	4.06e-11	4.57e-08	NA	0.6941
2. PF	Q3B604	3-deoxy-manno-octulosonate cytidylyltransferase	1.26e-10	2.04e-04	NA	0.6478
2. PF	A9IMZ3	3-deoxy-manno-octulosonate cytidylyltransferase	1.77e-10	3.86e-06	NA	0.6376
2. PF	Q2YPQ5	3-deoxy-manno-octulosonate cytidylyltransferase	6.73e-11	6.81e-09	NA	0.6292
3. BF	A1TRG1	Glucose-1-phosphate adenylyltransferase	1.45e-11	NA	1.78e-05	0.6816
3. BF	D4GU70	Low-salt glycan biosynthesis nucleotidyltransferase Agl11	0.00e+00	NA	6.92e-29	0.7924
3. BF	Q5B1J4	Mannose-1-phosphate guanyltransferase	2.35e-13	NA	7.12e-10	0.7209
3. BF	Q68EY9	Mannose-1-phosphate guanyltransferase beta-A	1.93e-14	NA	1.31e-09	0.6891
3. BF	Q0VFM6	Mannose-1-phosphate guanyltransferase alpha	1.71e-12	NA	0.001	0.6703
3. BF	Q181B4	Bifunctional protein GlmU	2.30e-12	NA	3.65e-05	0.654
3. BF	Q74GH5	Bifunctional protein GlmU	7.21e-12	NA	4.45e-05	0.687
3. BF	Q31QN4	Glucose-1-phosphate adenylyltransferase	1.69e-11	NA	0.047	0.6954
3. BF	A6UUQ4	Bifunctional protein GlmU	4.13e-13	NA	4.03e-18	0.7593
3. BF	B6J2E2	Bifunctional protein GlmU	3.94e-11	NA	0.005	0.6433
3. BF	Q752H4	Mannose-1-phosphate guanyltransferase	2.16e-13	NA	7.21e-09	0.6783
3. BF	Q975F9	Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase	6.61e-14	NA	2.89e-16	0.7046
3. BF	Q6CCU3	Mannose-1-phosphate guanyltransferase	5.36e-14	NA	7.38e-08	0.7102
3. BF	A0KQX6	Bifunctional protein GlmU	6.46e-11	NA	0.014	0.6616
3. BF	Q8R752	Bifunctional protein GlmU	1.05e-12	NA	0.003	0.6499
3. BF	A5WBA1	Bifunctional protein GlmU	8.11e-11	NA	0.044	0.6519
3. BF	Q68EQ1	Mannose-1-phosphate guanyltransferase beta	4.22e-15	NA	2.13e-09	0.7076
3. BF	Q1WSM9	Glucose-1-phosphate adenylyltransferase	4.62e-13	NA	0.002	0.7037
3. BF	B0KRA6	Bifunctional protein GlmU	6.51e-11	NA	0.016	0.672
3. BF	Q6LYB5	Bifunctional protein GlmU	5.88e-15	NA	1.02e-19	0.7871
3. BF	Q83AF3	Bifunctional protein GlmU	3.07e-11	NA	0.004	0.6471
3. BF	B7KDB8	Glucose-1-phosphate adenylyltransferase	8.21e-12	NA	0.006	0.7036
3. BF	Q70SJ2	Mannose-1-phosphate guanyltransferase	1.25e-14	NA	2.90e-10	0.673
3. BF	B9M701	Bifunctional protein GlmU	6.45e-12	NA	0.015	0.6695
3. BF	Q9P8N0	Mannose-1-phosphate guanyltransferase	1.13e-13	NA	1.43e-07	0.7122
3. BF	Q7RVR8	Mannose-1-phosphate guanyltransferase	2.08e-14	NA	6.52e-06	0.7228
3. BF	Q88BX6	Bifunctional protein GlmU	5.74e-11	NA	0.007	0.666
3. BF	P47823	Translation initiation factor eIF-2B subunit epsilon	2.95e-07	NA	0.048	0.6283
3. BF	B8D8J0	Bifunctional protein GlmU	2.02e-10	NA	0.014	0.6698
3. BF	A3DIP9	Bifunctional protein GlmU	1.43e-12	NA	0.012	0.6646
3. BF	Q4U3E8	Mannose-1-phosphate guanyltransferase	2.10e-13	NA	2.59e-09	0.7184
3. BF	Q2YDJ9	Mannose-1-phosphate guanyltransferase beta	6.03e-14	NA	2.21e-09	0.7018
3. BF	P0CO21	Mannose-1-phosphate guanyltransferase	1.95e-13	NA	6.16e-08	0.6957
3. BF	Q295Y7	Mannose-1-phosphate guanyltransferase beta	1.23e-13	NA	4.38e-07	0.6983
3. BF	O74624	Mannose-1-phosphate guanyltransferase	6.87e-14	NA	7.07e-09	0.7283
3. BF	Q61S97	Mannose-1-phosphate guanyltransferase beta	1.34e-14	NA	6.86e-07	0.6816
3. BF	Q5SMC1	Glucose-1-phosphate adenylyltransferase	6.42e-12	NA	1.58e-04	0.7095
3. BF	Q6BN12	Mannose-1-phosphate guanyltransferase	2.25e-13	NA	6.97e-08	0.6856
3. BF	Q66KG5	Mannose-1-phosphate guanyltransferase alpha-B	2.50e-12	NA	8.87e-04	0.6798
3. BF	B0CM52	Mannose-1-phosphate guanyltransferase alpha	6.06e-12	NA	1.09e-05	0.6944
3. BF	O52049	Glucose-1-phosphate adenylyltransferase	1.03e-11	NA	4.43e-04	0.6873
3. BF	Q4ZL26	Bifunctional protein GlmU	7.92e-11	NA	4.72e-04	0.6492
3. BF	Q87TT6	Bifunctional protein GlmU	8.70e-11	NA	3.05e-04	0.6485
3. BF	Q6DKE9	Mannose-1-phosphate guanyltransferase alpha-A	2.40e-12	NA	0.002	0.6686
3. BF	A2VD83	Mannose-1-phosphate guanyltransferase beta-B	6.88e-15	NA	3.10e-08	0.6873
3. BF	Q4K3B1	Bifunctional protein GlmU	7.42e-11	NA	0.002	0.6487
3. BF	A8G7N0	Bifunctional protein GlmU	2.32e-11	NA	0.019	0.6658
3. BF	Q4I1Y5	Mannose-1-phosphate guanyltransferase	5.61e-14	NA	4.22e-06	0.7012
3. BF	P08075	Glucose-1-phosphate thymidylyltransferase	0.00e+00	NA	4.63e-18	0.7962
3. BF	Q2UJU5	Mannose-1-phosphate guanyltransferase	5.80e-14	NA	9.84e-10	0.7166
3. BF	Q72G72	Glucose-1-phosphate adenylyltransferase	6.49e-12	NA	1.64e-04	0.6944
3. BF	A5GDL4	Bifunctional protein GlmU	2.18e-12	NA	1.38e-04	0.698
3. BF	A6VG23	Bifunctional protein GlmU	7.55e-15	NA	4.52e-25	0.7856
3. BF	Q3K443	Bifunctional protein GlmU	7.01e-11	NA	0.041	0.6494
3. BF	Q5WAD9	Bifunctional protein GlmU	1.48e-12	NA	0.001	0.6675
3. BF	A9NBD3	Bifunctional protein GlmU	3.00e-11	NA	0.004	0.6476
3. BF	P74285	UTP--glucose-1-phosphate uridylyltransferase	7.42e-14	NA	9.61e-10	0.7343
3. BF	P0C5I2	Mannose-1-phosphate guanyltransferase beta	3.55e-14	NA	1.21e-10	0.7047
3. BF	Q6FRY2	Mannose-1-phosphate guanyltransferase 2	1.31e-13	NA	1.11e-10	0.744
3. BF	Q12HQ5	Bifunctional protein GlmU	4.79e-11	NA	0.011	0.6424
3. BF	Q7UXF5	Glucose-1-phosphate adenylyltransferase	3.13e-11	NA	0.003	0.7048
3. BF	A4Y185	Bifunctional protein GlmU	9.09e-11	NA	0.006	0.6655
3. BF	A6UP85	Bifunctional protein GlmU	7.18e-14	NA	5.07e-22	0.7833
3. BF	Q9Y725	Mannose-1-phosphate guanyltransferase 1	1.60e-13	NA	4.52e-10	0.6747
3. BF	Q1I2I9	Bifunctional protein GlmU	9.27e-11	NA	3.64e-04	0.6495
3. BF	Q48BG7	Bifunctional protein GlmU	8.26e-11	NA	6.51e-04	0.6647
3. BF	Q9RR29	Glucose-1-phosphate thymidylyltransferase	0.00e+00	NA	3.05e-19	0.7702
3. BF	P0CO20	Mannose-1-phosphate guanyltransferase	2.59e-13	NA	6.16e-08	0.6999
3. BF	A4FX98	Bifunctional protein GlmU	6.99e-15	NA	1.50e-24	0.7853
4. PB	P37744	Glucose-1-phosphate thymidylyltransferase 1	7.66e-15	5.76e-26	4.20e-15	NA
4. PB	P61887	Glucose-1-phosphate thymidylyltransferase 2	1.14e-14	2.54e-24	1.95e-17	NA
4. PB	P9WH13	Glucose-1-phosphate thymidylyltransferase	1.81e-14	3.97e-28	2.83e-09	NA
4. PB	Q58730	Putative UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	2.44e-73	9.38e-60	NA
4. PB	P0AAB6	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	4.86e-66	3.29e-47	NA
4. PB	P0AEP3	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	6.36e-67	2.13e-49	NA
4. PB	Q2G1T6	UTP--glucose-1-phosphate uridylyltransferase	0.00e+00	3.23e-81	2.79e-87	NA
5. P	Q7MJ10	3-deoxy-manno-octulosonate cytidylyltransferase	2.15e-10	1.95e-06	NA	NA
5. P	Q12PZ2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.95e-10	1.51e-03	NA	NA
5. P	P55229	Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic	9.46e-10	1.50e-02	NA	NA
5. P	Q72GN3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.29e-08	1.66e-03	NA	NA
5. P	Q3SK38	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.23e-05	2.69e-04	NA	NA
5. P	B0JUF7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.22e-06	2.93e-03	NA	NA
5. P	B2TIF4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.07e-10	2.00e-06	NA	NA
5. P	Q2YV73	Ribitol-5-phosphate cytidylyltransferase 1	4.52e-11	3.35e-04	NA	NA
5. P	Q57R10	3-deoxy-manno-octulosonate cytidylyltransferase	3.86e-10	3.54e-05	NA	NA
5. P	Q4KHF4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.17e-05	2.01e-03	NA	NA
5. P	Q87R14	3-deoxy-manno-octulosonate cytidylyltransferase	1.50e-10	2.12e-05	NA	NA
5. P	A8AIG3	3-deoxy-manno-octulosonate cytidylyltransferase	1.47e-10	7.09e-05	NA	NA
5. P	B5FTS5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.53e-10	4.62e-05	NA	NA
5. P	A9KSU6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.23e-10	4.59e-06	NA	NA
5. P	Q02PE2	3-deoxy-manno-octulosonate cytidylyltransferase	5.08e-10	9.51e-05	NA	NA
5. P	Q7V647	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.56e-11	5.10e-04	NA	NA
5. P	A8ANW1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.65e-10	6.01e-03	NA	NA
5. P	A7GJZ7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.38e-11	1.50e-04	NA	NA
5. P	Q83E52	3-deoxy-manno-octulosonate cytidylyltransferase	5.10e-10	6.65e-06	NA	NA
5. P	Q8XYW3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.43e-09	1.45e-04	NA	NA
5. P	A3MYF7	3-deoxy-manno-octulosonate cytidylyltransferase 1	1.84e-10	2.44e-06	NA	NA
5. P	Q21J11	3-deoxy-manno-octulosonate cytidylyltransferase	3.08e-10	2.34e-05	NA	NA
5. P	Q129C7	3-deoxy-manno-octulosonate cytidylyltransferase	1.99e-09	5.04e-06	NA	NA
5. P	Q5NYJ9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.38e-05	4.69e-04	NA	NA
5. P	Q5L433	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.73e-10	1.36e-05	NA	NA
5. P	B4TDQ5	3-deoxy-manno-octulosonate cytidylyltransferase	1.65e-10	3.54e-05	NA	NA
5. P	A5UE59	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.72e-10	4.09e-05	NA	NA
5. P	Q3J2K9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.55e-10	4.54e-04	NA	NA
5. P	A5N4M5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.84e-10	1.34e-04	NA	NA
5. P	Q2A2J8	3-deoxy-manno-octulosonate cytidylyltransferase	3.76e-10	7.90e-05	NA	NA
5. P	B2I939	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.57e-10	2.29e-05	NA	NA
5. P	C3JY27	3-deoxy-manno-octulosonate cytidylyltransferase	6.58e-10	9.16e-06	NA	NA
5. P	Q4ZWQ6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.18e-05	1.21e-03	NA	NA
5. P	D4GVD5	2-phospho-L-lactate guanylyltransferase	7.27e-04	5.14e-03	NA	NA
5. P	B2KA34	3-deoxy-manno-octulosonate cytidylyltransferase	3.15e-10	1.00e-06	NA	NA
5. P	P65176	Ribitol-5-phosphate cytidylyltransferase 2	7.57e-11	2.79e-03	NA	NA
5. P	B6ES02	3-deoxy-manno-octulosonate cytidylyltransferase	4.17e-10	2.42e-05	NA	NA
5. P	Q82GC8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.90e-06	1.25e-02	NA	NA
5. P	B0V5E6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.32e-06	9.28e-04	NA	NA
5. P	B0VQH8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.34e-06	1.37e-03	NA	NA
5. P	Q92CV0	Ribitol-5-phosphate cytidylyltransferase	3.73e-11	2.87e-05	NA	NA
5. P	Q5SLX2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.08e-08	1.66e-03	NA	NA
5. P	Q6GCM3	Ribitol-5-phosphate cytidylyltransferase 2	6.11e-11	3.64e-03	NA	NA
5. P	B1KTA8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.16e-06	9.40e-05	NA	NA
5. P	Q39DJ4	3-deoxy-manno-octulosonate cytidylyltransferase 1	5.83e-10	3.84e-04	NA	NA
5. P	B6JBS5	3-phospho-D-glycerate guanylyltransferase	1.46e-04	3.13e-02	NA	NA
5. P	A9NBW9	3-deoxy-manno-octulosonate cytidylyltransferase	4.46e-10	3.72e-06	NA	NA
5. P	C5BAD7	3-deoxy-manno-octulosonate cytidylyltransferase	7.84e-11	5.57e-05	NA	NA
5. P	Q0T1H8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.13e-10	3.13e-05	NA	NA
5. P	A3N0G2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.92e-10	1.99e-03	NA	NA
5. P	Q9PDT6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.01e-10	5.21e-05	NA	NA
5. P	Q32E38	3-deoxy-manno-octulosonate cytidylyltransferase	2.58e-10	3.70e-05	NA	NA
5. P	A8GCI3	3-deoxy-manno-octulosonate cytidylyltransferase	3.24e-10	4.65e-06	NA	NA
5. P	Q2Y751	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.16e-05	4.79e-04	NA	NA
5. P	B0KF43	3-deoxy-manno-octulosonate cytidylyltransferase	3.36e-10	4.67e-05	NA	NA
5. P	A3CWL3	2-phospho-L-lactate guanylyltransferase	5.65e-04	3.14e-03	NA	NA
5. P	Q8ZBP6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.28e-10	4.99e-05	NA	NA
5. P	B1IUT2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.77e-10	1.07e-04	NA	NA
5. P	Q6D1B3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.98e-10	9.65e-03	NA	NA
5. P	A6T710	3-deoxy-manno-octulosonate cytidylyltransferase	3.40e-10	4.04e-05	NA	NA
5. P	B4SQQ0	3-deoxy-manno-octulosonate cytidylyltransferase	7.75e-11	2.92e-04	NA	NA
5. P	Q39M82	3-deoxy-manno-octulosonate cytidylyltransferase 2	4.41e-10	4.74e-04	NA	NA
5. P	Q2S210	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.54e-09	1.02e-05	NA	NA
5. P	Q7NSS6	3-deoxy-manno-octulosonate cytidylyltransferase	8.59e-10	5.82e-05	NA	NA
5. P	A5UJW5	2-phospho-L-lactate guanylyltransferase	4.86e-04	3.98e-02	NA	NA
5. P	A5IMI1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.37e-10	2.35e-03	NA	NA
5. P	C1BAC2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.28e-06	8.82e-04	NA	NA
5. P	C0ZPR7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.01e-06	3.08e-04	NA	NA
5. P	Q6FAU1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.91e-11	2.50e-03	NA	NA
5. P	A4XLJ3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.72e-10	5.04e-06	NA	NA
5. P	B2FK90	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.00e-09	1.02e-05	NA	NA
5. P	Q8P9Z1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.65e-07	6.61e-04	NA	NA
5. P	A4QH60	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.56e-11	5.00e-07	NA	NA
5. P	Q6GK57	Ribitol-5-phosphate cytidylyltransferase 1	4.51e-11	3.76e-04	NA	NA
5. P	Q7VNY6	3-deoxy-manno-octulosonate cytidylyltransferase	6.33e-11	2.69e-06	NA	NA
5. P	A4IX75	3-deoxy-manno-octulosonate cytidylyltransferase	3.84e-10	6.71e-05	NA	NA
5. P	Q2FK15	Ribitol-5-phosphate cytidylyltransferase 1	5.43e-11	3.76e-04	NA	NA
5. P	A9BHR2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.51e-06	4.88e-05	NA	NA
5. P	B0C9F6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.08e-06	9.87e-04	NA	NA
5. P	P47362	Uncharacterized protein MG116	7.43e-08	2.96e-03	NA	NA
5. P	Q7UM15	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.80e-10	2.03e-03	NA	NA
5. P	Q5F829	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.95e-09	9.51e-05	NA	NA
5. P	B2I2A2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.34e-06	9.47e-04	NA	NA
5. P	P04951	3-deoxy-manno-octulosonate cytidylyltransferase	1.88e-10	3.70e-05	NA	NA
5. P	B1JB36	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.69e-05	1.24e-02	NA	NA
5. P	Q5L6V2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.27e-09	4.74e-02	NA	NA
5. P	A9M0U7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.29e-09	7.16e-05	NA	NA
5. P	B0UT79	3-deoxy-manno-octulosonate cytidylyltransferase	1.17e-10	1.18e-05	NA	NA
5. P	Q1R5J6	Glucose-1-phosphate adenylyltransferase	7.87e-11	4.13e-02	NA	NA
5. P	A1WWF7	3-deoxy-manno-octulosonate cytidylyltransferase	2.71e-10	8.29e-07	NA	NA
5. P	B7LWK8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.55e-10	7.65e-05	NA	NA
5. P	B0KSC1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.42e-09	1.22e-02	NA	NA
5. P	Q8FJA9	3-deoxy-manno-octulosonate cytidylyltransferase	1.48e-10	1.51e-05	NA	NA
5. P	Q0VQP3	3-deoxy-manno-octulosonate cytidylyltransferase	5.68e-10	1.85e-05	NA	NA
5. P	C6DDG2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.24e-10	2.80e-02	NA	NA
5. P	A3NAL9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.67e-10	1.42e-04	NA	NA
5. P	B7NT91	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.07e-10	5.45e-05	NA	NA
5. P	Q2JUE5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.40e-06	9.69e-07	NA	NA
5. P	P74323	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.32e-11	1.98e-04	NA	NA
5. P	A9R7J3	3-deoxy-manno-octulosonate cytidylyltransferase	3.80e-10	1.00e-06	NA	NA
5. P	Q0AFW3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.12e-09	3.22e-04	NA	NA
5. P	B4EC23	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.24e-10	5.77e-04	NA	NA
5. P	A4TPZ7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.35e-10	4.99e-05	NA	NA
5. P	Q8D223	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.54e-10	3.39e-04	NA	NA
5. P	Q9K0D6	3-deoxy-manno-octulosonate cytidylyltransferase	3.52e-10	2.42e-04	NA	NA
5. P	A6LPN9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.02e-10	6.56e-05	NA	NA
5. P	Q8Y832	Ribitol-5-phosphate cytidylyltransferase	4.77e-11	4.27e-05	NA	NA
5. P	Q2SKW7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.56e-10	5.04e-03	NA	NA
5. P	B7LSE1	Glucose-1-phosphate adenylyltransferase	4.83e-11	2.24e-02	NA	NA
5. P	Q3MAF5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.52e-11	5.56e-03	NA	NA
5. P	Q4QPI6	3-deoxy-manno-octulosonate cytidylyltransferase	1.11e-10	1.89e-05	NA	NA
5. P	Q46893	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.55e-10	1.07e-04	NA	NA
5. P	B5YF77	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.05e-06	8.91e-05	NA	NA
5. P	P0A0Z7	N-acylneuraminate cytidylyltransferase	9.92e-05	6.81e-04	NA	NA
5. P	B8FKL0	3-deoxy-manno-octulosonate cytidylyltransferase	6.22e-10	1.06e-04	NA	NA
5. P	B7MYQ2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.37e-10	1.58e-04	NA	NA
5. P	Q1QU73	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.10e-05	7.12e-06	NA	NA
5. P	Q0AST1	3-deoxy-manno-octulosonate cytidylyltransferase	7.17e-10	1.01e-04	NA	NA
5. P	A4JF20	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.03e-10	6.02e-04	NA	NA
5. P	A0Q5R0	3-deoxy-manno-octulosonate cytidylyltransferase	4.09e-10	1.09e-04	NA	NA
5. P	Q9X1B3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.48e-10	9.97e-04	NA	NA
5. P	Q824I4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.16e-10	3.30e-03	NA	NA
5. P	Q48L52	3-deoxy-manno-octulosonate cytidylyltransferase	6.26e-10	2.65e-05	NA	NA
5. P	B7VK66	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.96e-09	1.35e-02	NA	NA
5. P	A6TWL0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-05	9.24e-07	NA	NA
5. P	C0PXV5	3-deoxy-manno-octulosonate cytidylyltransferase	1.73e-10	3.54e-05	NA	NA
5. P	B2K577	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-10	7.90e-05	NA	NA
5. P	Q688T8	Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic/amyloplastic	4.86e-10	3.56e-02	NA	NA
5. P	Q118M1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.89e-11	2.10e-05	NA	NA
5. P	B7UN04	3-deoxy-manno-octulosonate cytidylyltransferase	1.41e-10	2.45e-05	NA	NA
5. P	Q48F81	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.25e-05	5.48e-04	NA	NA
5. P	A4TN08	3-deoxy-manno-octulosonate cytidylyltransferase	3.68e-10	1.00e-06	NA	NA
5. P	C5CKW0	3-deoxy-manno-octulosonate cytidylyltransferase	7.29e-10	1.22e-05	NA	NA
5. P	B1JQT6	3-deoxy-manno-octulosonate cytidylyltransferase	3.73e-10	1.00e-06	NA	NA
5. P	B9DY87	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.34e-10	1.34e-04	NA	NA
5. P	Q9PB46	3-deoxy-manno-octulosonate cytidylyltransferase	2.74e-10	1.82e-06	NA	NA
5. P	A3M4Z0	3-deoxy-manno-octulosonate cytidylyltransferase	2.00e-09	8.75e-06	NA	NA
5. P	B1Z3N9	3-deoxy-manno-octulosonate cytidylyltransferase 2	2.78e-10	7.01e-05	NA	NA
5. P	Q6HPT2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.74e-11	2.65e-05	NA	NA
5. P	B2JGK2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.83e-10	6.08e-05	NA	NA
5. P	P55230	Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic	6.25e-10	1.62e-03	NA	NA
5. P	O67343	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.63e-05	2.47e-03	NA	NA
5. P	B1GYT4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.48e-06	6.54e-04	NA	NA
5. P	Q31C80	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.64e-10	3.69e-07	NA	NA
5. P	Q3KMI0	3-deoxy-manno-octulosonate cytidylyltransferase	2.82e-10	2.78e-06	NA	NA
5. P	B5ETK7	3-deoxy-manno-octulosonate cytidylyltransferase	4.01e-10	1.29e-05	NA	NA
5. P	Q3ALY8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.33e-11	3.13e-06	NA	NA
5. P	Q8KCU3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.45e-08	6.86e-05	NA	NA
5. P	A4SVI9	3-deoxy-manno-octulosonate cytidylyltransferase	1.06e-09	7.24e-05	NA	NA
5. P	Q8E4B4	Ribitol-5-phosphate cytidylyltransferase	4.95e-06	1.11e-05	NA	NA
5. P	Q724H7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.68e-11	9.77e-04	NA	NA
5. P	B5YT52	3-deoxy-manno-octulosonate cytidylyltransferase	2.62e-10	4.42e-05	NA	NA
5. P	Q5E328	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.00e-05	7.40e-05	NA	NA
5. P	Q8NYI0	Ribitol-5-phosphate cytidylyltransferase 2	3.80e-11	3.64e-03	NA	NA
5. P	Q6NFC1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.32e-11	4.81e-06	NA	NA
5. P	B1IW13	3-deoxy-manno-octulosonate cytidylyltransferase	2.00e-10	3.70e-05	NA	NA
5. P	Q2FQJ1	2-phospho-L-lactate guanylyltransferase	1.19e-03	5.34e-03	NA	NA
5. P	A0PV29	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.27e-10	5.45e-03	NA	NA
5. P	Q46GW4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.82e-11	3.25e-04	NA	NA
5. P	Q2NVM4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.79e-10	2.55e-04	NA	NA
5. P	Q6F9X2	3-deoxy-manno-octulosonate cytidylyltransferase	3.22e-09	6.35e-05	NA	NA
5. P	B0U660	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.49e-10	3.31e-05	NA	NA
5. P	Q04XR1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.44e-10	4.22e-03	NA	NA
5. P	B2RJ15	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.72e-10	3.02e-03	NA	NA
5. P	B2FK23	3-deoxy-manno-octulosonate cytidylyltransferase	1.21e-10	7.57e-05	NA	NA
5. P	A9N7U4	3-deoxy-manno-octulosonate cytidylyltransferase	2.60e-10	3.54e-05	NA	NA
5. P	B0TK06	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.51e-10	8.04e-04	NA	NA
5. P	A1U1F3	3-deoxy-manno-octulosonate cytidylyltransferase	1.32e-10	1.17e-06	NA	NA
5. P	B0BP82	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.79e-10	3.14e-03	NA	NA
5. P	A8F958	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.90e-11	1.20e-05	NA	NA
5. P	Q8ZMF6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.40e-10	5.16e-05	NA	NA
5. P	B7MDR5	Glucose-1-phosphate adenylyltransferase	8.05e-11	4.13e-02	NA	NA
5. P	A1AX25	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.39e-05	2.59e-05	NA	NA
5. P	B2HJ23	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.65e-10	5.24e-03	NA	NA
5. P	Q5Z2R3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.24e-06	4.31e-03	NA	NA
5. P	P0A6V1	Glucose-1-phosphate adenylyltransferase	2.43e-11	4.96e-02	NA	NA
5. P	Q67JP5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.06e-06	3.91e-02	NA	NA
5. P	A0K9X0	3-deoxy-manno-octulosonate cytidylyltransferase	6.03e-10	9.30e-05	NA	NA
5. P	Q6GCL7	Ribitol-5-phosphate cytidylyltransferase 1	5.17e-11	3.76e-04	NA	NA
5. P	B4RZG5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.52e-05	1.44e-03	NA	NA
5. P	Q8PLR8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.10e-09	1.61e-03	NA	NA
5. P	A4J0Y3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.92e-06	5.21e-05	NA	NA
5. P	B2VC71	3-deoxy-manno-octulosonate cytidylyltransferase	5.85e-10	4.92e-06	NA	NA
5. P	Q7N6C2	3-deoxy-manno-octulosonate cytidylyltransferase	4.68e-10	1.16e-04	NA	NA
5. P	Q87LQ2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.78e-10	4.99e-05	NA	NA
5. P	B2US61	3-deoxy-manno-octulosonate cytidylyltransferase	1.78e-09	6.42e-06	NA	NA
5. P	Q03A83	Ribitol-5-phosphate cytidylyltransferase	5.04e-10	5.04e-06	NA	NA
5. P	A5GMW9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.59e-11	4.37e-05	NA	NA
5. P	A9AIT5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.11e-10	1.10e-03	NA	NA
5. P	Q3SIR7	3-deoxy-manno-octulosonate cytidylyltransferase	6.59e-10	2.12e-06	NA	NA
5. P	A0K867	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.40e-10	8.29e-04	NA	NA
5. P	A1WSH5	3-deoxy-manno-octulosonate cytidylyltransferase	3.34e-09	4.89e-04	NA	NA
5. P	Q3BTC6	3-deoxy-manno-octulosonate cytidylyltransferase	1.54e-10	1.21e-04	NA	NA
5. P	Q4KFT3	3-deoxy-manno-octulosonate cytidylyltransferase	5.87e-10	2.42e-05	NA	NA
5. P	B5F411	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.20e-10	8.72e-05	NA	NA
5. P	O31701	Probable molybdenum cofactor guanylyltransferase	3.61e-08	3.77e-02	NA	NA
5. P	Q9HZM5	3-deoxy-manno-octulosonate cytidylyltransferase	5.33e-10	1.07e-04	NA	NA
5. P	Q9PJT1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.92e-10	2.13e-03	NA	NA
5. P	Q9JTM3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.89e-09	2.93e-05	NA	NA
5. P	Q15P31	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.67e-10	1.64e-05	NA	NA
5. P	B0B9T2	3-deoxy-manno-octulosonate cytidylyltransferase	2.27e-10	2.00e-06	NA	NA
5. P	Q8XHQ3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.11e-09	2.55e-03	NA	NA
5. P	Q8NMB8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.32e-07	8.70e-07	NA	NA
5. P	A7Z0L2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-10	1.66e-04	NA	NA
5. P	Q664I4	Glucose-1-phosphate adenylyltransferase	1.91e-11	2.65e-02	NA	NA
5. P	B0U168	3-deoxy-manno-octulosonate cytidylyltransferase	3.73e-10	8.62e-05	NA	NA
5. P	Q3JR99	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.77e-10	1.42e-04	NA	NA
5. P	Q7NYL6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.10e-09	1.51e-05	NA	NA
5. P	Q5PEG1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.82e-10	4.04e-05	NA	NA
5. P	Q746Z9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.71e-10	2.28e-03	NA	NA
5. P	Q5H0H2	3-deoxy-manno-octulosonate cytidylyltransferase	1.11e-10	1.51e-05	NA	NA
5. P	Q12WF3	2-phospho-L-lactate guanylyltransferase	7.89e-05	1.86e-02	NA	NA
5. P	Q0P8U6	Pseudaminic acid cytidylyltransferase	7.22e-05	7.03e-04	NA	NA
5. P	Q0I2X5	3-deoxy-manno-octulosonate cytidylyltransferase	1.07e-10	1.10e-05	NA	NA
5. P	A4WDV2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.38e-10	7.40e-05	NA	NA
5. P	Q475G0	3-deoxy-manno-octulosonate cytidylyltransferase	4.12e-10	1.71e-03	NA	NA
5. P	B8ZUA7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.24e-06	5.48e-04	NA	NA
5. P	B3DTQ9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.89e-08	1.04e-02	NA	NA
5. P	C4ZZQ1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.70e-10	1.07e-04	NA	NA
5. P	Q492T2	3-deoxy-manno-octulosonate cytidylyltransferase	7.49e-11	7.24e-05	NA	NA
5. P	Q47EL2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.58e-09	1.61e-04	NA	NA
5. P	D3SYZ8	2-phospho-L-lactate guanylyltransferase	5.82e-03	4.64e-04	NA	NA
5. P	A1KUV0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.99e-09	4.04e-05	NA	NA
5. P	Q4L8D3	Probable molybdenum cofactor guanylyltransferase	3.21e-09	4.17e-02	NA	NA
5. P	Q8F7A0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.22e-10	7.51e-03	NA	NA
5. P	B1XCS3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.23e-10	1.07e-04	NA	NA
5. P	B0VMY7	3-deoxy-manno-octulosonate cytidylyltransferase	2.87e-09	1.16e-05	NA	NA
5. P	B6I8Z0	3-deoxy-manno-octulosonate cytidylyltransferase	1.33e-10	5.04e-05	NA	NA
5. P	B2J1D2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.41e-11	5.77e-04	NA	NA
5. P	B7IF61	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.02e-09	3.47e-03	NA	NA
5. P	B1HNM7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.84e-11	8.62e-05	NA	NA
5. P	Q9CCW6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.17e-06	5.48e-04	NA	NA
5. P	Q472F2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.72e-09	2.65e-06	NA	NA
5. P	Q3IDQ6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.26e-10	2.69e-04	NA	NA
5. P	Q604M2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.05e-10	1.31e-03	NA	NA
5. P	Q7VZN2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.92e-10	8.68e-03	NA	NA
5. P	Q0I880	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.71e-07	1.16e-05	NA	NA
5. P	Q5E0E9	3-deoxy-manno-octulosonate cytidylyltransferase	4.07e-10	1.29e-05	NA	NA
5. P	P0A0Z8	N-acylneuraminate cytidylyltransferase	1.01e-04	6.81e-04	NA	NA
5. P	B9MI81	3-deoxy-manno-octulosonate cytidylyltransferase	2.01e-09	5.43e-04	NA	NA
5. P	Q4QMP4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.10e-10	9.93e-05	NA	NA
5. P	A8H1S7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.39e-10	3.75e-03	NA	NA
5. P	B7LEG5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.09e-10	1.07e-04	NA	NA
5. P	Q2G2C4	Ribitol-5-phosphate cytidylyltransferase 2	4.59e-11	2.79e-03	NA	NA
5. P	B0U330	3-deoxy-manno-octulosonate cytidylyltransferase	2.84e-10	8.70e-07	NA	NA
5. P	B0R6P7	2-phospho-L-lactate guanylyltransferase	6.07e-04	7.96e-03	NA	NA
5. P	Q5ZU88	3-deoxy-manno-octulosonate cytidylyltransferase	1.00e-10	2.62e-06	NA	NA
5. P	Q5QUC3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.79e-06	8.85e-06	NA	NA
5. P	B0RSI0	3-deoxy-manno-octulosonate cytidylyltransferase	3.53e-10	1.48e-02	NA	NA
5. P	Q3K093	Ribitol-5-phosphate cytidylyltransferase	4.69e-06	1.69e-05	NA	NA
5. P	P39626	Spore coat polysaccharide biosynthesis protein SpsF	5.00e-06	7.37e-03	NA	NA
5. P	A8A3M6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.70e-10	1.07e-04	NA	NA
5. P	Q88W46	Ribitol-5-phosphate cytidylyltransferase	6.99e-11	1.99e-03	NA	NA
5. P	Q8ZGA4	3-deoxy-manno-octulosonate cytidylyltransferase	3.77e-10	1.00e-06	NA	NA
5. P	B5EMX4	3-deoxy-manno-octulosonate cytidylyltransferase	1.26e-09	9.51e-05	NA	NA
5. P	Q7MUQ9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.98e-10	4.10e-03	NA	NA
5. P	B6J1K0	3-deoxy-manno-octulosonate cytidylyltransferase	5.01e-10	6.65e-06	NA	NA
5. P	A4IJG4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.13e-10	1.08e-05	NA	NA
5. P	Q7W5C9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.72e-10	3.98e-03	NA	NA
5. P	Q3ZWE1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.18e-06	3.63e-02	NA	NA
5. P	Q483B3	3-deoxy-manno-octulosonate cytidylyltransferase	6.47e-10	2.55e-04	NA	NA
5. P	Q1AU08	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.61e-10	2.00e-04	NA	NA
5. P	Q65Q78	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.93e-09	7.25e-04	NA	NA
5. P	Q2NUA2	3-deoxy-manno-octulosonate cytidylyltransferase	1.47e-10	9.00e-05	NA	NA
5. P	B5BEY4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.47e-10	4.04e-05	NA	NA
5. P	Q0A8Q5	3-deoxy-manno-octulosonate cytidylyltransferase	2.13e-10	9.06e-06	NA	NA
5. P	Q8DYQ7	Ribitol-5-phosphate cytidylyltransferase	4.80e-06	1.83e-05	NA	NA
5. P	A9II44	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.63e-10	1.56e-03	NA	NA
5. P	B6J8F8	3-deoxy-manno-octulosonate cytidylyltransferase	6.40e-10	7.99e-06	NA	NA
5. P	Q253C1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.71e-10	1.91e-03	NA	NA
5. P	Q1I648	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.18e-09	7.29e-03	NA	NA
5. P	Q6D440	3-deoxy-manno-octulosonate cytidylyltransferase	3.62e-10	4.47e-05	NA	NA
5. P	B2UB84	3-deoxy-manno-octulosonate cytidylyltransferase	4.23e-10	5.39e-05	NA	NA
5. P	A3N2M5	3-deoxy-manno-octulosonate cytidylyltransferase 2	3.78e-10	2.88e-06	NA	NA
5. P	Q0B295	3-deoxy-manno-octulosonate cytidylyltransferase 2	4.37e-10	4.57e-05	NA	NA
5. P	B1J508	3-deoxy-manno-octulosonate cytidylyltransferase	4.07e-10	6.93e-05	NA	NA
5. P	B4S8U7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.61e-08	1.71e-05	NA	NA
5. P	A7MV12	3-deoxy-manno-octulosonate cytidylyltransferase	7.19e-11	2.80e-05	NA	NA
5. P	A3PBH7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.52e-10	8.91e-07	NA	NA
5. P	B5F1S0	3-deoxy-manno-octulosonate cytidylyltransferase	1.71e-10	3.54e-05	NA	NA
5. P	Q4ZVY8	3-deoxy-manno-octulosonate cytidylyltransferase	6.06e-10	1.55e-05	NA	NA
5. P	Q2GEM3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.79e-10	4.72e-05	NA	NA
5. P	B7UHG6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.12e-10	2.24e-04	NA	NA
5. P	Q87YF7	3-deoxy-manno-octulosonate cytidylyltransferase	4.26e-10	8.96e-06	NA	NA
5. P	A9VN98	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.20e-11	2.71e-05	NA	NA
5. P	B4ET34	3-deoxy-manno-octulosonate cytidylyltransferase	1.74e-10	2.87e-05	NA	NA
5. P	B0B835	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.61e-10	4.27e-03	NA	NA
5. P	B5BBP0	3-deoxy-manno-octulosonate cytidylyltransferase	1.80e-10	3.62e-05	NA	NA
5. P	Q7U559	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.61e-11	5.26e-04	NA	NA
5. P	A8GKU8	Glucose-1-phosphate adenylyltransferase	4.53e-11	1.14e-02	NA	NA
5. P	A1AXA1	3-deoxy-manno-octulosonate cytidylyltransferase	3.63e-10	3.87e-05	NA	NA
5. P	C6DH77	Glucose-1-phosphate adenylyltransferase	1.89e-11	9.28e-03	NA	NA
5. P	Q3KLN6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.78e-10	5.56e-03	NA	NA
5. P	Q57KJ4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.80e-10	7.99e-05	NA	NA
5. P	P9WKG9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.70e-06	3.54e-05	NA	NA
5. P	A0LIS2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.05e-10	3.35e-06	NA	NA
5. P	Q8DAU9	3-deoxy-manno-octulosonate cytidylyltransferase	2.15e-10	1.23e-06	NA	NA
5. P	Q8P8W6	3-deoxy-manno-octulosonate cytidylyltransferase	3.41e-10	1.19e-05	NA	NA
5. P	B5FQ61	3-deoxy-manno-octulosonate cytidylyltransferase	1.64e-10	6.56e-05	NA	NA
5. P	Q8CQ77	Ribitol-5-phosphate cytidylyltransferase	5.16e-11	2.13e-03	NA	NA
5. P	B7J514	3-deoxy-manno-octulosonate cytidylyltransferase	1.27e-09	9.51e-05	NA	NA
5. P	Q086A8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.97e-10	1.06e-03	NA	NA
5. P	O84468	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.67e-10	5.56e-03	NA	NA
5. P	P65177	Ribitol-5-phosphate cytidylyltransferase 2	5.74e-11	2.79e-03	NA	NA
5. P	Q7VR47	3-deoxy-manno-octulosonate cytidylyltransferase	3.82e-11	1.03e-06	NA	NA
5. P	Q9KGF8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.96e-10	2.58e-04	NA	NA
5. P	Q1CUS2	3-deoxy-manno-octulosonate cytidylyltransferase	1.65e-09	1.35e-05	NA	NA
5. P	B5XV34	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.62e-10	3.73e-04	NA	NA
5. P	A4SL70	3-deoxy-manno-octulosonate cytidylyltransferase	2.76e-10	1.72e-06	NA	NA
5. P	Q81VV5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.60e-11	2.65e-05	NA	NA
5. P	B7H3M4	3-deoxy-manno-octulosonate cytidylyltransferase	2.16e-09	1.04e-05	NA	NA
5. P	B0TVJ0	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	6.18e-10	5.40e-06	NA	NA
5. P	Q5WLT7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.67e-10	4.89e-04	NA	NA
5. P	B8GR40	3-deoxy-manno-octulosonate cytidylyltransferase	8.19e-10	5.92e-06	NA	NA
5. P	Q3KH90	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.63e-05	2.31e-03	NA	NA
5. P	P55242	Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic/amyloplastic	3.88e-10	6.62e-03	NA	NA
5. P	Q72P59	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.60e-10	7.51e-03	NA	NA
5. P	B0BCA0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.28e-10	4.27e-03	NA	NA
5. P	A7FJV8	3-deoxy-manno-octulosonate cytidylyltransferase	3.73e-10	1.00e-06	NA	NA
5. P	Q7VDC7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.46e-10	4.88e-05	NA	NA
5. P	A5WF97	3-deoxy-manno-octulosonate cytidylyltransferase	3.26e-09	1.58e-05	NA	NA
5. P	Q8PKS3	3-deoxy-manno-octulosonate cytidylyltransferase	1.01e-10	2.45e-05	NA	NA
5. P	Q8X7Y4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.11e-10	4.77e-05	NA	NA
5. P	B1LQ67	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.01e-10	7.82e-05	NA	NA
5. P	B2TZI4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.71e-10	1.07e-04	NA	NA
5. P	B0RU03	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.98e-07	3.88e-04	NA	NA
5. P	Q8G7E2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.36e-08	1.11e-02	NA	NA
5. P	A4F6W3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.17e-06	3.35e-04	NA	NA
5. P	B9KSH8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.89e-10	5.71e-04	NA	NA
5. P	Q0TMM2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.77e-09	2.55e-03	NA	NA
5. P	Q9KQX2	3-deoxy-manno-octulosonate cytidylyltransferase	8.48e-11	1.56e-05	NA	NA
5. P	Q2M5Q2	Pseudaminic acid cytidylyltransferase	5.16e-05	1.62e-03	NA	NA
5. P	B2SUA8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.91e-09	2.55e-04	NA	NA
5. P	P57953	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.10e-09	2.47e-03	NA	NA
5. P	Q60B47	3-deoxy-manno-octulosonate cytidylyltransferase	3.78e-10	2.46e-07	NA	NA
5. P	A6LPA6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.00e-10	8.29e-04	NA	NA
5. P	A9R119	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.37e-10	4.99e-05	NA	NA
5. P	Q8FMI3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.53e-11	4.32e-05	NA	NA
5. P	B4TRV0	3-deoxy-manno-octulosonate cytidylyltransferase	1.67e-10	3.54e-05	NA	NA
5. P	Q0BED6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.24e-10	8.44e-05	NA	NA
5. P	B0BRZ1	3-deoxy-manno-octulosonate cytidylyltransferase	1.45e-10	3.39e-06	NA	NA
5. P	A5I7N1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.47e-06	7.57e-05	NA	NA
5. P	A7NDA8	3-deoxy-manno-octulosonate cytidylyltransferase	4.04e-10	6.71e-05	NA	NA
5. P	Q3J7B0	3-deoxy-manno-octulosonate cytidylyltransferase	1.63e-10	2.13e-04	NA	NA
5. P	A1K5I4	3-deoxy-manno-octulosonate cytidylyltransferase	3.13e-10	7.56e-04	NA	NA
5. P	Q0SWZ7	3-deoxy-manno-octulosonate cytidylyltransferase	1.44e-10	2.93e-05	NA	NA
5. P	B2SG51	3-deoxy-manno-octulosonate cytidylyltransferase	3.91e-10	2.05e-05	NA	NA
5. P	B9K8U1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.74e-10	7.87e-04	NA	NA
5. P	Q93SF3	Probable molybdenum cofactor guanylyltransferase	4.74e-08	4.24e-02	NA	NA
5. P	B7M847	3-deoxy-manno-octulosonate cytidylyltransferase	1.37e-10	5.04e-05	NA	NA
5. P	A9KEB5	3-deoxy-manno-octulosonate cytidylyltransferase	6.14e-10	6.65e-06	NA	NA
5. P	Q6GK63	Ribitol-5-phosphate cytidylyltransferase 2	4.84e-11	3.61e-03	NA	NA
5. P	Q39FB8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.89e-10	1.91e-04	NA	NA
5. P	A8G9Z2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.14e-10	1.61e-02	NA	NA
5. P	Q5L917	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.95e-10	3.02e-04	NA	NA
5. P	A5F726	3-deoxy-manno-octulosonate cytidylyltransferase	1.05e-10	1.56e-05	NA	NA
5. P	Q1CLR6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.16e-10	4.99e-05	NA	NA
5. P	D1C883	Phosphoenolpyruvate guanylyltransferase	2.94e-06	3.70e-02	NA	NA
5. P	B0BBG2	3-deoxy-manno-octulosonate cytidylyltransferase	1.77e-10	2.00e-06	NA	NA
5. P	A5ID77	3-deoxy-manno-octulosonate cytidylyltransferase	1.31e-10	1.20e-06	NA	NA
5. P	Q8K9D6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.08e-10	6.54e-04	NA	NA
5. P	B5QZC2	3-deoxy-manno-octulosonate cytidylyltransferase	3.50e-10	2.17e-05	NA	NA
5. P	Q5HRJ7	Ribitol-5-phosphate cytidylyltransferase	5.39e-11	2.99e-03	NA	NA
5. P	B7MKM1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.26e-10	1.58e-04	NA	NA
5. P	Q1QX66	3-deoxy-manno-octulosonate cytidylyltransferase	1.62e-10	3.31e-06	NA	NA
5. P	Q5HJC1	Ribitol-5-phosphate cytidylyltransferase 1	5.24e-11	3.76e-04	NA	NA
5. P	A2SIQ3	3-deoxy-manno-octulosonate cytidylyltransferase	4.88e-10	4.31e-03	NA	NA
5. P	A9MHW5	3-deoxy-manno-octulosonate cytidylyltransferase	1.73e-10	4.27e-05	NA	NA
5. P	Q66EC3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.52e-10	4.47e-05	NA	NA
5. P	A5UB81	3-deoxy-manno-octulosonate cytidylyltransferase	1.21e-10	5.39e-05	NA	NA
5. P	C4LBQ9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.62e-10	4.14e-05	NA	NA
5. P	A9MF28	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.10e-10	3.54e-05	NA	NA
5. P	Q886M1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.06e-05	1.42e-03	NA	NA
5. P	A0R8F7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.35e-11	2.65e-05	NA	NA
5. P	Q7A1W0	Ribitol-5-phosphate cytidylyltransferase 1	5.34e-11	3.76e-04	NA	NA
5. P	A7FZ94	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.62e-06	7.57e-05	NA	NA
5. P	A7FLX8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-10	7.90e-05	NA	NA
5. P	A8FST0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.98e-10	5.89e-03	NA	NA
5. P	A3NWE0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.64e-10	1.42e-04	NA	NA
5. P	A5CVZ7	3-deoxy-manno-octulosonate cytidylyltransferase	2.42e-10	2.48e-05	NA	NA
5. P	Q7TW54	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.28e-10	4.18e-05	NA	NA
5. P	C1AI41	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.96e-06	3.54e-05	NA	NA
5. P	Q31H18	3-deoxy-manno-octulosonate cytidylyltransferase 1	1.53e-10	4.89e-04	NA	NA
5. P	Q9PKL1	3-deoxy-manno-octulosonate cytidylyltransferase	3.96e-10	1.67e-05	NA	NA
5. P	Q2G1C0	Ribitol-5-phosphate cytidylyltransferase 1	5.01e-11	3.76e-04	NA	NA
5. P	Q97EC9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.91e-06	2.10e-05	NA	NA
5. P	A1W894	3-deoxy-manno-octulosonate cytidylyltransferase	1.60e-09	4.31e-04	NA	NA
5. P	P0CD75	3-deoxy-manno-octulosonate cytidylyltransferase	1.89e-10	2.78e-06	NA	NA
5. P	Q87Q30	Ribitol-5-phosphate cytidylyltransferase	3.47e-06	6.29e-07	NA	NA
5. P	Q1LTP8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.94e-10	1.13e-04	NA	NA
5. P	Q32CI3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.49e-10	1.07e-04	NA	NA
5. P	A3QE24	8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase	3.53e-10	7.91e-07	NA	NA
5. P	Q7WCW3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.51e-10	8.68e-03	NA	NA
5. P	A4WSL5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.04e-09	9.97e-04	NA	NA
5. P	A4XSR4	3-deoxy-manno-octulosonate cytidylyltransferase	5.09e-10	2.17e-05	NA	NA
5. P	Q5QU39	3-deoxy-manno-octulosonate cytidylyltransferase	3.93e-10	8.36e-06	NA	NA
5. P	Q487E9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.50e-06	8.69e-08	NA	NA
5. P	B1Y6I6	3-deoxy-manno-octulosonate cytidylyltransferase	2.47e-09	2.18e-02	NA	NA
5. P	Q47LV0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.11e-10	1.50e-03	NA	NA
5. P	Q7A7V0	Ribitol-5-phosphate cytidylyltransferase 1	4.77e-11	3.76e-04	NA	NA
5. P	Q18CD1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.96e-10	1.80e-06	NA	NA
5. P	Q3A8C6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.62e-09	9.06e-06	NA	NA
5. P	Q31VJ3	Glucose-1-phosphate adenylyltransferase	8.23e-11	3.60e-02	NA	NA
5. P	A5UHG1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.75e-10	4.93e-05	NA	NA
5. P	A3QC79	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.56e-10	3.43e-04	NA	NA
5. P	Q9KUJ2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.01e-10	5.51e-05	NA	NA
5. P	Q494E8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.90e-10	1.63e-04	NA	NA
5. P	A9N2D3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.04e-10	4.47e-05	NA	NA
5. P	P57707	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.93e-05	1.06e-03	NA	NA
5. P	B1XTC6	3-deoxy-manno-octulosonate cytidylyltransferase	9.84e-10	1.65e-04	NA	NA
5. P	B5EMB5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.87e-09	1.43e-04	NA	NA
5. P	B5XY79	3-deoxy-manno-octulosonate cytidylyltransferase	3.09e-10	1.89e-05	NA	NA
5. P	Q7V2M1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.53e-10	7.40e-05	NA	NA
5. P	Q3AWK9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.34e-06	1.34e-04	NA	NA
5. P	Q1J200	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.43e-09	4.79e-04	NA	NA
5. P	C6DFA4	3-deoxy-manno-octulosonate cytidylyltransferase	3.16e-10	1.38e-05	NA	NA
5. P	O26710	2-phospho-L-lactate guanylyltransferase	3.27e-04	4.74e-02	NA	NA
5. P	Q5PGF5	3-deoxy-manno-octulosonate cytidylyltransferase	1.78e-10	3.62e-05	NA	NA
5. P	A4G7X9	3-deoxy-manno-octulosonate cytidylyltransferase	1.52e-09	5.10e-06	NA	NA
5. P	Q8XDG6	3-deoxy-manno-octulosonate cytidylyltransferase	1.83e-10	4.42e-05	NA	NA
5. P	B4TTW1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.07e-10	5.95e-05	NA	NA
5. P	Q5UNV4	Probable UDP-N-acetylglucosamine pyrophosphorylase	NA	3.51e-17	NA	NA
5. P	Q8SQS1	Probable UDP-N-acetylglucosamine pyrophosphorylase	1.14e-08	5.25e-08	NA	NA
5. P	A2BPT7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.93e-10	8.70e-07	NA	NA
5. P	Q1Q9K8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.48e-06	2.71e-05	NA	NA
5. P	B5RDQ3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.91e-10	4.62e-05	NA	NA
5. P	A1S4D9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.65e-10	4.67e-05	NA	NA
5. P	Q99WW8	Ribitol-5-phosphate cytidylyltransferase 1	5.19e-11	3.76e-04	NA	NA
5. P	A5U8Q7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.63e-06	3.54e-05	NA	NA
5. P	Q63T70	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.74e-10	1.42e-04	NA	NA
5. P	Q4UTP4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.72e-07	6.61e-04	NA	NA
5. P	Q8Z800	3-deoxy-manno-octulosonate cytidylyltransferase	1.85e-10	3.28e-05	NA	NA
5. P	Q2YV76	Ribitol-5-phosphate cytidylyltransferase 2	4.53e-11	1.91e-03	NA	NA
5. P	C5BL28	3-deoxy-manno-octulosonate cytidylyltransferase	6.13e-10	1.83e-05	NA	NA
5. P	A5CW51	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.96e-05	5.75e-05	NA	NA
5. P	A8MLB1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.19e-10	1.54e-04	NA	NA
5. P	Q62JI5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.96e-10	1.42e-04	NA	NA
5. P	C4L8W0	3-deoxy-manno-octulosonate cytidylyltransferase	5.06e-11	4.45e-04	NA	NA
5. P	Q39ZL5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.14e-10	4.48e-03	NA	NA
5. P	B2TUG1	3-deoxy-manno-octulosonate cytidylyltransferase	3.55e-10	2.83e-05	NA	NA
5. P	B4RL14	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.96e-09	7.48e-05	NA	NA
5. P	A1KPR8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.92e-06	3.54e-05	NA	NA
5. P	B9MJW2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.71e-06	2.00e-05	NA	NA
5. P	C3K6H8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.70e-05	8.82e-04	NA	NA
5. P	A4XWR9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.36e-09	1.95e-04	NA	NA
5. P	Q88LM7	3-deoxy-manno-octulosonate cytidylyltransferase	6.84e-10	5.82e-05	NA	NA
5. P	C7P363	2-phospho-L-lactate guanylyltransferase	6.60e-04	1.06e-02	NA	NA
5. P	B2TAY9	3-deoxy-manno-octulosonate cytidylyltransferase 2	3.18e-10	1.83e-05	NA	NA
5. P	Q87DY4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.64e-10	2.29e-05	NA	NA
5. P	Q8FEJ5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.25e-10	1.58e-04	NA	NA
5. P	Q0SQB9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.32e-05	3.40e-03	NA	NA
5. P	Q1CGH5	3-deoxy-manno-octulosonate cytidylyltransferase	3.77e-10	1.00e-06	NA	NA
5. P	B4T457	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.44e-10	2.93e-05	NA	NA
5. P	Q5P107	3-deoxy-manno-octulosonate cytidylyltransferase	1.14e-10	2.42e-04	NA	NA
5. P	P75519	Uncharacterized protein MG116 homolog	7.96e-08	2.87e-03	NA	NA
5. P	Q87BW1	3-deoxy-manno-octulosonate cytidylyltransferase	5.17e-10	2.75e-06	NA	NA
5. P	B1IGH9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.00e-06	4.32e-05	NA	NA
5. P	B5QW18	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.40e-10	4.62e-05	NA	NA
5. P	B1WSY4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.94e-11	6.78e-05	NA	NA
5. P	A2ST69	2-phospho-L-lactate guanylyltransferase	5.92e-04	6.95e-03	NA	NA
5. P	Q0TEB1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.33e-10	1.58e-04	NA	NA
5. P	Q58463	Uncharacterized protein MJ1063	3.42e-06	6.49e-03	NA	NA
5. P	Q63HB4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.94e-11	2.65e-05	NA	NA
5. P	Q3BUS8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.55e-07	1.76e-04	NA	NA
5. P	B2T3X2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-09	6.49e-05	NA	NA
5. P	Q7C093	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.06e-10	3.13e-05	NA	NA
5. P	B2HZD0	3-deoxy-manno-octulosonate cytidylyltransferase	3.23e-09	1.16e-05	NA	NA
5. P	A1TQ97	3-deoxy-manno-octulosonate cytidylyltransferase	1.49e-09	7.90e-06	NA	NA
5. P	Q4UV63	3-deoxy-manno-octulosonate cytidylyltransferase	3.28e-10	1.19e-05	NA	NA
5. P	A3PJQ3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.01e-09	5.90e-04	NA	NA
5. P	Q31QF6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.01e-07	3.54e-05	NA	NA
5. P	B8F5J5	3-deoxy-manno-octulosonate cytidylyltransferase	5.50e-11	6.78e-05	NA	NA
5. P	B6I6D7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.50e-10	1.07e-04	NA	NA
5. P	Q06755	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.21e-11	8.16e-05	NA	NA
5. P	A2SBD6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.60e-10	1.42e-04	NA	NA
5. P	A1K644	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.74e-09	9.72e-05	NA	NA
5. P	Q13UR9	3-deoxy-manno-octulosonate cytidylyltransferase	1.32e-09	2.29e-04	NA	NA
5. P	A1WWZ0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.40e-10	1.35e-05	NA	NA
5. P	Q0S890	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.16e-06	1.47e-03	NA	NA
5. P	Q4JXJ7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.31e-05	7.90e-06	NA	NA
5. P	A5D5L4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.07e-05	5.39e-05	NA	NA
5. P	B7N6X7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.27e-10	7.99e-05	NA	NA
5. P	A7MJ57	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.48e-10	1.30e-04	NA	NA
5. P	A7MEV1	3-deoxy-manno-octulosonate cytidylyltransferase	1.41e-10	6.20e-06	NA	NA
5. P	B6YQA2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.47e-10	3.12e-04	NA	NA
5. P	Q31YT2	3-deoxy-manno-octulosonate cytidylyltransferase	1.83e-10	2.83e-05	NA	NA
5. P	P55231	Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic	2.37e-10	4.91e-02	NA	NA
5. P	C3KVS6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.79e-06	6.01e-05	NA	NA
5. P	B2U4G2	Glucose-1-phosphate adenylyltransferase	8.03e-11	3.60e-02	NA	NA
5. P	A4JH79	3-deoxy-manno-octulosonate cytidylyltransferase	6.95e-10	6.08e-04	NA	NA
5. P	Q1BHA5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.48e-10	8.29e-04	NA	NA
5. P	Q3JCS9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.58e-10	1.09e-06	NA	NA
5. P	C1D558	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.12e-06	7.63e-06	NA	NA
5. P	Q8A0U8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.48e-10	8.91e-05	NA	NA
5. P	Q64P77	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.52e-10	1.91e-04	NA	NA
5. P	A6VQY1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.76e-09	8.62e-05	NA	NA
5. P	A5W827	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.51e-09	2.68e-02	NA	NA
5. P	C1F763	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.65e-06	6.36e-07	NA	NA
5. P	B7LN80	3-deoxy-manno-octulosonate cytidylyltransferase	2.37e-10	5.51e-05	NA	NA
5. P	Q15UY4	3-deoxy-manno-octulosonate cytidylyltransferase	8.46e-10	1.13e-05	NA	NA
5. P	Q8YLX9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.02e-11	5.40e-03	NA	NA
5. P	B5R8K5	3-deoxy-manno-octulosonate cytidylyltransferase	3.60e-10	3.54e-05	NA	NA
5. P	Q17YX7	3-deoxy-manno-octulosonate cytidylyltransferase	4.79e-10	2.07e-07	NA	NA
5. P	B1X8M2	3-deoxy-manno-octulosonate cytidylyltransferase	1.99e-10	3.70e-05	NA	NA
5. P	A7ZK07	3-deoxy-manno-octulosonate cytidylyltransferase	1.31e-10	5.04e-05	NA	NA
5. P	P9WKG8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.85e-06	3.54e-05	NA	NA
5. P	Q2RFM0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.31e-10	1.95e-04	NA	NA
5. P	Q8ZQC0	3-deoxy-manno-octulosonate cytidylyltransferase	3.25e-10	3.54e-05	NA	NA
5. P	B1JJF8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.59e-10	7.90e-05	NA	NA
5. P	Q2P1L0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.18e-06	9.82e-05	NA	NA
5. P	B2T6M3	3-deoxy-manno-octulosonate cytidylyltransferase 1	9.64e-10	5.10e-05	NA	NA
5. P	Q81J63	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.84e-11	4.32e-05	NA	NA
5. P	Q3YYB5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.33e-10	1.07e-04	NA	NA
5. P	Q8DL91	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.52e-06	2.05e-07	NA	NA
5. P	Q2LUS9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.11e-05	7.16e-05	NA	NA
5. P	Q2T0K3	3-deoxy-manno-octulosonate cytidylyltransferase	2.26e-10	1.48e-03	NA	NA
5. P	A6V1F5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.39e-05	5.37e-04	NA	NA
5. P	Q720Y7	Ribitol-5-phosphate cytidylyltransferase	4.57e-11	3.74e-05	NA	NA
5. P	B4RYE4	3-deoxy-manno-octulosonate cytidylyltransferase	8.46e-10	8.34e-05	NA	NA
5. P	C4Z312	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.60e-06	5.10e-04	NA	NA
5. P	A5FP88	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.97e-06	3.63e-02	NA	NA
5. P	Q8DC60	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.58e-10	2.44e-04	NA	NA
5. P	Q8D2V1	3-deoxy-manno-octulosonate cytidylyltransferase	1.77e-10	5.04e-05	NA	NA
5. P	Q2SIN2	3-deoxy-manno-octulosonate cytidylyltransferase	2.48e-10	2.98e-06	NA	NA
5. P	Q5N3T2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.93e-07	4.99e-05	NA	NA
5. P	Q73FC1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.76e-11	2.87e-05	NA	NA
5. P	B1LBT2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.36e-10	9.77e-04	NA	NA
5. P	Q890M1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.70e-10	7.56e-04	NA	NA
5. P	C3LNH9	3-deoxy-manno-octulosonate cytidylyltransferase	8.95e-11	1.56e-05	NA	NA
5. P	A6T170	3-deoxy-manno-octulosonate cytidylyltransferase	1.53e-09	3.95e-06	NA	NA
5. P	C4ZQ44	3-deoxy-manno-octulosonate cytidylyltransferase	1.81e-10	3.70e-05	NA	NA
5. P	Q92F40	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.35e-10	2.72e-04	NA	NA
5. P	A0KGH5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.19e-10	3.14e-03	NA	NA
5. P	B7V149	3-deoxy-manno-octulosonate cytidylyltransferase	5.54e-10	7.82e-05	NA	NA
5. P	C0PXA7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.78e-10	7.99e-05	NA	NA
5. P	Q9ZMK4	3-deoxy-manno-octulosonate cytidylyltransferase	1.38e-09	1.03e-05	NA	NA
5. P	Q5GYK6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.80e-09	2.55e-04	NA	NA
5. P	A7ZQJ1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.80e-10	1.07e-04	NA	NA
5. P	Q7VLT5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.17e-09	2.24e-04	NA	NA
5. P	A7GJ99	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.22e-06	1.37e-04	NA	NA
5. P	Q1R7U4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.38e-10	1.58e-04	NA	NA
5. P	A7ZYM0	3-deoxy-manno-octulosonate cytidylyltransferase	1.96e-10	3.70e-05	NA	NA
5. P	Q7MHQ4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.91e-10	8.55e-04	NA	NA
5. P	Q6MEE8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.20e-10	2.89e-04	NA	NA
5. P	Q4FR76	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.32e-06	2.98e-06	NA	NA
5. P	Q2SWT6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.39e-10	1.68e-04	NA	NA
5. P	B3H1E1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.80e-10	4.27e-03	NA	NA
5. P	B7NMJ5	Glucose-1-phosphate adenylyltransferase	7.96e-11	3.84e-02	NA	NA
5. P	B7J4C0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.25e-09	1.43e-04	NA	NA
5. P	Q7N8K7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.63e-09	4.01e-04	NA	NA
5. P	Q3Z3K3	3-deoxy-manno-octulosonate cytidylyltransferase	1.31e-10	2.83e-05	NA	NA
5. P	Q02RA5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.50e-05	8.29e-04	NA	NA
5. P	B7GMX1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.21e-08	2.08e-02	NA	NA
5. P	Q8XWE2	3-deoxy-manno-octulosonate cytidylyltransferase	4.03e-10	3.18e-04	NA	NA
5. P	Q8RKI9	Ribitol-5-phosphate cytidylyltransferase	3.91e-11	4.05e-04	NA	NA
5. P	Q9Z7X5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.18e-10	2.88e-02	NA	NA
5. P	B3PFR9	3-deoxy-manno-octulosonate cytidylyltransferase	1.76e-10	7.24e-05	NA	NA
5. P	Q1QBV8	3-deoxy-manno-octulosonate cytidylyltransferase	2.30e-09	8.53e-05	NA	NA
5. P	Q8R7S6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.79e-06	2.82e-03	NA	NA
5. P	B5FAF7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.06e-05	7.90e-05	NA	NA
5. P	Q31XA9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.80e-10	1.07e-04	NA	NA
5. P	Q6LMT3	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.07e-05	2.22e-04	NA	NA
5. P	Q5HJC5	Ribitol-5-phosphate cytidylyltransferase 2	5.60e-11	2.79e-03	NA	NA
5. P	B7LE16	3-deoxy-manno-octulosonate cytidylyltransferase	1.46e-10	5.04e-05	NA	NA
5. P	P57495	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.92e-10	9.27e-06	NA	NA
5. P	A0PXS4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.74e-06	1.41e-05	NA	NA
5. P	Q9HNV0	2-phospho-L-lactate guanylyltransferase	6.50e-04	7.96e-03	NA	NA
5. P	Q82UR9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.09e-09	3.46e-05	NA	NA
5. P	A1V500	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.71e-10	1.42e-04	NA	NA
5. P	Q4FS44	3-deoxy-manno-octulosonate cytidylyltransferase	3.03e-09	1.46e-05	NA	NA
5. P	A6KXL8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.09e-09	1.58e-03	NA	NA
5. P	Q7NGU6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.23e-11	3.16e-06	NA	NA
5. P	Q9JYM4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.29e-09	7.32e-05	NA	NA
5. P	Q65PD2	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.73e-11	1.03e-04	NA	NA
5. P	Q9ZL74	Molybdenum cofactor guanylyltransferase	8.05e-09	3.19e-02	NA	NA
5. P	Q165P6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.57e-09	1.13e-03	NA	NA
5. P	A1KST6	3-deoxy-manno-octulosonate cytidylyltransferase	3.67e-10	4.89e-04	NA	NA
5. P	B5Z3A9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.35e-10	4.77e-05	NA	NA
5. P	Q3A9N7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.98e-10	8.96e-06	NA	NA
5. P	B3EQ34	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.32e-10	3.13e-05	NA	NA
5. P	B7LXF9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.34e-10	1.07e-04	NA	NA
5. P	A3NS88	3-deoxy-manno-octulosonate cytidylyltransferase	2.80e-10	2.44e-04	NA	NA
5. P	Q04VR0	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.92e-10	4.22e-03	NA	NA
5. P	A6V3B9	3-deoxy-manno-octulosonate cytidylyltransferase	5.33e-10	5.95e-05	NA	NA
5. P	Q1CA60	3-deoxy-manno-octulosonate cytidylyltransferase	3.71e-10	1.00e-06	NA	NA
5. P	B4T152	3-deoxy-manno-octulosonate cytidylyltransferase	3.20e-10	3.54e-05	NA	NA
5. P	C7P592	2-phospho-L-lactate guanylyltransferase	1.64e-03	1.88e-02	NA	NA
5. P	Q13Z31	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.48e-09	5.33e-05	NA	NA
5. P	Q3B3A7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.33e-08	7.01e-05	NA	NA
5. P	A9BE76	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	8.74e-11	1.36e-05	NA	NA
5. P	A3M5X8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.38e-06	9.87e-04	NA	NA
5. P	B8CJP8	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.35e-10	2.93e-03	NA	NA
5. P	A8G3G9	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.74e-10	5.12e-07	NA	NA
5. P	Q83LN8	3-deoxy-manno-octulosonate cytidylyltransferase	1.41e-10	2.93e-05	NA	NA
5. P	B6EKL6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.34e-06	1.81e-05	NA	NA
5. P	A9IQ35	3-deoxy-manno-octulosonate cytidylyltransferase	4.93e-10	7.29e-06	NA	NA
5. P	B0VD12	3-deoxy-manno-octulosonate cytidylyltransferase	2.19e-09	1.04e-05	NA	NA
5. P	B3GZS5	3-deoxy-manno-octulosonate cytidylyltransferase	1.84e-10	3.39e-06	NA	NA
5. P	Q6LPK9	3-deoxy-manno-octulosonate cytidylyltransferase	4.58e-10	6.08e-05	NA	NA
5. P	B2JDV2	3-deoxy-manno-octulosonate cytidylyltransferase	7.03e-10	5.85e-06	NA	NA
5. P	A3MKM4	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.71e-10	1.42e-04	NA	NA
5. P	B7UKY7	Glucose-1-phosphate adenylyltransferase	7.88e-11	4.78e-02	NA	NA
5. P	A1AEU1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	6.43e-10	1.58e-04	NA	NA
5. P	A1JMK9	3-deoxy-manno-octulosonate cytidylyltransferase	3.68e-10	3.95e-06	NA	NA
5. P	A5G938	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	7.55e-10	8.34e-05	NA	NA
5. P	Q1ICZ9	3-deoxy-manno-octulosonate cytidylyltransferase	4.11e-10	3.62e-05	NA	NA
5. P	B4TFW7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.54e-10	4.62e-05	NA	NA
5. P	Q027G1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.45e-06	3.09e-06	NA	NA
5. P	Q66CH8	3-deoxy-manno-octulosonate cytidylyltransferase	3.75e-10	1.00e-06	NA	NA
5. P	A2BVB5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.46e-10	3.24e-05	NA	NA
5. P	Q8YAB5	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	9.39e-11	7.18e-04	NA	NA
5. P	A6TD39	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	2.50e-10	2.37e-04	NA	NA
5. P	B2I6C4	3-deoxy-manno-octulosonate cytidylyltransferase	2.77e-10	1.22e-06	NA	NA
5. P	Q88MF7	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.62e-09	2.30e-02	NA	NA
5. P	C1FMX6	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	4.45e-06	1.01e-04	NA	NA
5. P	B4SR88	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	5.42e-10	2.77e-05	NA	NA
5. P	Q3K8J4	3-deoxy-manno-octulosonate cytidylyltransferase	5.11e-10	2.04e-04	NA	NA
5. P	Q2P3E9	3-deoxy-manno-octulosonate cytidylyltransferase	1.20e-10	1.51e-05	NA	NA
5. P	O05029	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	1.41e-09	4.93e-05	NA	NA
5. P	Q4A0A8	Ribitol-5-phosphate cytidylyltransferase	4.79e-11	7.99e-05	NA	NA
5. P	Q8Z471	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	3.17e-10	5.95e-05	NA	NA
6. F	Q57IU0	Glucose-1-phosphate adenylyltransferase	5.89e-11	NA	NA	0.706
6. F	A5G0T8	Bifunctional protein GlmU	2.45e-11	NA	NA	0.6827
6. F	B0RVK6	Xanthan biosynthesis protein XanB	2.55e-09	NA	NA	0.6287
6. F	A1KR65	Bifunctional protein GlmU	4.25e-11	NA	NA	0.6739
6. F	A9KX04	Bifunctional protein GlmU	3.79e-11	NA	NA	0.6898
6. F	Q8E8C2	Bifunctional protein GlmU	8.92e-11	NA	NA	0.6549
6. F	Q8XP97	Glucose-1-phosphate adenylyltransferase	1.16e-13	NA	NA	0.7204
6. F	Q0AA25	Glucose-1-phosphate adenylyltransferase 2	1.55e-11	NA	NA	0.6997
6. F	A5GFZ5	Dolichol-phosphate mannosyltransferase subunit 1	3.07e-05	NA	NA	0.5048
6. F	Q1IQY5	Bifunctional protein GlmU	1.81e-11	NA	NA	0.6357
6. F	Q3J6N3	Bifunctional protein GlmU	9.87e-11	NA	NA	0.6883
6. F	A3D289	Glucose-1-phosphate adenylyltransferase	1.28e-11	NA	NA	0.7082
6. F	Q50986	Bifunctional protein GlmU	3.17e-11	NA	NA	0.6748
6. F	Q81VZ1	Bifunctional protein GlmU	2.73e-12	NA	NA	0.6619
6. F	Q38V29	Bifunctional protein GlmU	1.14e-11	NA	NA	0.683
6. F	Q2IM42	Glucose-1-phosphate adenylyltransferase	1.04e-11	NA	NA	0.6885
6. F	Q42882	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic	1.69e-10	NA	NA	0.6882
6. F	Q9KDX4	Glucose-1-phosphate adenylyltransferase	1.44e-13	NA	NA	0.7177
6. F	A4Y4U6	Glucose-1-phosphate adenylyltransferase	1.01e-11	NA	NA	0.6949
6. F	Q081Q7	Glucose-1-phosphate adenylyltransferase	1.41e-11	NA	NA	0.7059
6. F	Q8DT53	Glucose-1-phosphate adenylyltransferase	1.43e-13	NA	NA	0.7145
6. F	Q0SQ61	Bifunctional protein GlmU	1.19e-12	NA	NA	0.6549
6. F	Q2K486	Glucose-1-phosphate adenylyltransferase	3.62e-11	NA	NA	0.6722
6. F	A6TG34	Bifunctional protein GlmU	2.57e-11	NA	NA	0.6849
6. F	Q5NXZ4	Glucose-1-phosphate adenylyltransferase	3.07e-12	NA	NA	0.6986
6. F	Q0RH38	Glucose-1-phosphate adenylyltransferase	1.78e-11	NA	NA	0.6955
6. F	Q2RPX0	Bifunctional protein GlmU	1.02e-11	NA	NA	0.6581
6. F	Q7MEE9	Glucose-1-phosphate adenylyltransferase 2	6.97e-12	NA	NA	0.6944
6. F	A5U1R1	Glucose-1-phosphate adenylyltransferase	1.13e-11	NA	NA	0.7074
6. F	C1A2N3	Glucose-1-phosphate adenylyltransferase	2.47e-11	NA	NA	0.6815
6. F	A2RG45	Bifunctional protein GlmU	2.63e-12	NA	NA	0.6866
6. F	Q88Z86	Bifunctional protein GlmU	3.03e-12	NA	NA	0.6751
6. F	Q6AA20	Glucose-1-phosphate adenylyltransferase	1.26e-11	NA	NA	0.6756
6. F	A8HAG0	Bifunctional protein GlmU	1.28e-11	NA	NA	0.6671
6. F	B8F3K4	Bifunctional protein GlmU	1.72e-11	NA	NA	0.6601
6. F	Q0I3H9	Glucose-1-phosphate adenylyltransferase	3.98e-11	NA	NA	0.6821
6. F	Q9L385	Glucose-1-phosphate adenylyltransferase	1.21e-12	NA	NA	0.718
6. F	O08327	Glycogen biosynthesis protein GlgD	1.14e-08	NA	NA	0.5789
6. F	P33697	Succinoglycan biosynthesis protein ExoO	4.74e-03	NA	NA	0.4212
6. F	Q57DG4	Molybdenum cofactor guanylyltransferase	1.37e-08	NA	NA	0.5931
6. F	Q57HY1	Bifunctional protein GlmU	1.96e-11	NA	NA	0.6821
6. F	Q163N8	Bifunctional protein GlmU	3.00e-11	NA	NA	0.7003
6. F	A5GT42	Bifunctional protein GlmU	8.64e-12	NA	NA	0.6733
6. F	A1RLX5	Glucose-1-phosphate adenylyltransferase	1.12e-11	NA	NA	0.7075
6. F	P0C0H1	Hyaluronan synthase	8.50e-05	NA	NA	0.4175
6. F	Q3SF69	Bifunctional protein GlmU	1.07e-10	NA	NA	0.6958
6. F	Q9KRB5	Glucose-1-phosphate adenylyltransferase 1	1.17e-11	NA	NA	0.7038
6. F	A0AF03	Bifunctional protein GlmU	1.91e-12	NA	NA	0.6685
6. F	C1CRR4	Bifunctional protein GlmU	1.05e-11	NA	NA	0.6592
6. F	Q2YVU6	Bifunctional protein GlmU	3.62e-12	NA	NA	0.6716
6. F	A7FPD8	Bifunctional protein GlmU	3.14e-11	NA	NA	0.6563
6. F	Q1QSD2	Bifunctional protein GlmU	3.61e-11	NA	NA	0.6462
6. F	A0PXK8	Bifunctional protein GlmU	3.80e-12	NA	NA	0.6956
6. F	B4RS18	Glucose-1-phosphate adenylyltransferase	3.37e-11	NA	NA	0.69
6. F	B5XK49	Bifunctional protein GlmU	5.71e-12	NA	NA	0.6904
6. F	B5YIR0	Glucose-1-phosphate adenylyltransferase	7.09e-12	NA	NA	0.686
6. F	Q92PS3	Bifunctional protein GlmU	8.23e-12	NA	NA	0.6658
6. F	B7M586	Bifunctional protein GlmU	2.14e-11	NA	NA	0.6929
6. F	B9JF80	Bifunctional protein GlmU	3.74e-11	NA	NA	0.6489
6. F	A8YX58	Bifunctional protein GlmU	2.61e-12	NA	NA	0.653
6. F	Q5L3V0	Bifunctional protein GlmU	1.76e-12	NA	NA	0.664
6. F	Q1JD75	Bifunctional protein GlmU	2.39e-12	NA	NA	0.6937
6. F	Q1CCH7	Bifunctional protein GlmU	3.06e-11	NA	NA	0.6579
6. F	A5I7S0	Bifunctional protein GlmU	7.21e-12	NA	NA	0.6913
6. F	A0PVW7	Glucose-1-phosphate adenylyltransferase	1.25e-11	NA	NA	0.6879
6. F	C1CDY3	Bifunctional protein GlmU	1.08e-11	NA	NA	0.6537
6. F	B2SB72	Bifunctional protein GlmU	1.25e-11	NA	NA	0.6602
6. F	Q8E080	Glucose-1-phosphate adenylyltransferase	7.33e-14	NA	NA	0.7121
6. F	Q18A75	Glucose-1-phosphate adenylyltransferase	3.13e-13	NA	NA	0.6996
6. F	B2TI07	Bifunctional protein GlmU	1.19e-12	NA	NA	0.6202
6. F	Q3IK30	Bifunctional protein GlmU	2.02e-11	NA	NA	0.653
6. F	A0L2S6	Bifunctional protein GlmU	4.86e-11	NA	NA	0.6565
6. F	Q2IGL4	Bifunctional protein GlmU	2.52e-11	NA	NA	0.7182
6. F	A3QJQ7	Bifunctional protein GlmU	5.40e-11	NA	NA	0.6582
6. F	B2T2Z5	Glucose-1-phosphate adenylyltransferase	2.44e-11	NA	NA	0.6994
6. F	Q11HG1	Bifunctional protein GlmU	1.91e-11	NA	NA	0.667
6. F	A5UE94	Bifunctional protein GlmU	3.85e-11	NA	NA	0.6796
6. F	P55232	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic (Fragment)	6.70e-11	NA	NA	0.7033
6. F	Q8NRD4	Glucose-1-phosphate adenylyltransferase	9.66e-12	NA	NA	0.6709
6. F	B9DRS6	Glucose-1-phosphate adenylyltransferase	1.64e-13	NA	NA	0.7267
6. F	Q608L6	Glucose-1-phosphate adenylyltransferase	1.60e-11	NA	NA	0.7078
6. F	Q9EUT6	Glucose-1-phosphate adenylyltransferase	4.06e-11	NA	NA	0.6827
6. F	A2SD80	Bifunctional protein GlmU	5.70e-11	NA	NA	0.7089
6. F	Q02WW6	Bifunctional protein GlmU	4.19e-12	NA	NA	0.7066
6. F	Q9CCA8	Glucose-1-phosphate adenylyltransferase	5.26e-12	NA	NA	0.6929
6. F	P30523	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic	9.18e-11	NA	NA	0.6822
6. F	A0LVY3	Glucose-1-phosphate adenylyltransferase	1.59e-11	NA	NA	0.6365
6. F	Q12FR3	Bifunctional protein GlmU	4.13e-11	NA	NA	0.7045
6. F	Q1J021	Glucose-1-phosphate adenylyltransferase	4.12e-12	NA	NA	0.7239
6. F	Q07TH7	Glucose-1-phosphate adenylyltransferase	3.23e-11	NA	NA	0.6799
6. F	Q0HPG3	Bifunctional protein GlmU	6.12e-11	NA	NA	0.6571
6. F	C1ESX9	Bifunctional protein GlmU	1.57e-11	NA	NA	0.6619
6. F	A1SBT8	Bifunctional protein GlmU	5.18e-11	NA	NA	0.6521
6. F	Q5FMG0	Bifunctional protein GlmU	2.92e-12	NA	NA	0.6553
6. F	Q5YQG3	Glucose-1-phosphate adenylyltransferase	1.69e-11	NA	NA	0.6747
6. F	B1KQ31	Bifunctional protein GlmU	4.67e-11	NA	NA	0.7136
6. F	Q8U8L5	Glucose-1-phosphate adenylyltransferase	2.94e-11	NA	NA	0.6887
6. F	P0C7J3	Xanthan biosynthesis protein XanB	2.91e-09	NA	NA	0.6315
6. F	A1KI01	Glucose-1-phosphate adenylyltransferase	1.93e-11	NA	NA	0.7018
6. F	C3P9J5	Bifunctional protein GlmU	1.55e-11	NA	NA	0.6623
6. F	A3DAR2	Bifunctional protein GlmU	7.73e-11	NA	NA	0.6905
6. F	A8G1W3	Bifunctional protein GlmU	6.49e-11	NA	NA	0.6533
6. F	Q8ET56	Glucose-1-phosphate adenylyltransferase	1.90e-13	NA	NA	0.7194
6. F	P0DB62	Bifunctional protein GlmU	1.51e-11	NA	NA	0.7047
6. F	Q72C30	Bifunctional enzyme IspD/IspF	3.57e-05	NA	NA	0.5905
6. F	B0TBA0	Bifunctional protein GlmU	1.79e-12	NA	NA	0.7088
6. F	Q50864	O-antigen biosynthesis protein RfbC	3.26e-01	NA	NA	0.4236
6. F	Q07537	Polypeptide N-acetylgalactosaminyltransferase 1	2.68e-03	NA	NA	0.4098
6. F	Q9RNH7	Glucose-1-phosphate adenylyltransferase	2.95e-11	NA	NA	0.6839
6. F	A4WGF8	Bifunctional protein GlmU	2.11e-11	NA	NA	0.6738
6. F	Q3A0D8	Bifunctional protein GlmU	2.50e-12	NA	NA	0.6573
6. F	B9K6N9	Glucose-1-phosphate adenylyltransferase	7.55e-13	NA	NA	0.7439
6. F	B7JK56	Bifunctional protein GlmU	2.64e-12	NA	NA	0.6621
6. F	Q8DAR1	Glucose-1-phosphate adenylyltransferase 1	1.99e-11	NA	NA	0.7091
6. F	Q6NCT8	Glucose-1-phosphate adenylyltransferase	3.03e-11	NA	NA	0.6894
6. F	Q5NQ83	Bifunctional protein GlmU	3.64e-11	NA	NA	0.6956
6. F	B8CVU0	Bifunctional protein GlmU	5.94e-11	NA	NA	0.6624
6. F	B3Q000	Glucose-1-phosphate adenylyltransferase	5.46e-11	NA	NA	0.6772
6. F	A5N2Y9	Glucose-1-phosphate adenylyltransferase	8.84e-14	NA	NA	0.7156
6. F	B5EUW3	Glucose-1-phosphate adenylyltransferase	7.74e-12	NA	NA	0.6935
6. F	Q5HKQ0	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	3.65e-03	NA	NA	0.4269
6. F	A3CPC4	Bifunctional protein GlmU	2.38e-12	NA	NA	0.7056
6. F	Q8NXZ7	Bifunctional protein GlmU	3.58e-12	NA	NA	0.657
6. F	Q0S3Y4	Glucose-1-phosphate adenylyltransferase	2.31e-11	NA	NA	0.683
6. F	Q8Z2Q3	Bifunctional protein GlmU	1.86e-11	NA	NA	0.6838
6. F	B2SFB5	Bifunctional protein GlmU	9.04e-11	NA	NA	0.6939
6. F	P0C0H0	Hyaluronan synthase	9.25e-05	NA	NA	0.4414
6. F	Q0A4N0	Bifunctional protein GlmU	5.05e-11	NA	NA	0.6722
6. F	A1ALB2	Bifunctional protein GlmU	4.38e-12	NA	NA	0.6987
6. F	Q8DSX2	Bifunctional protein GlmU	2.35e-12	NA	NA	0.6869
6. F	A5D662	Bifunctional protein GlmU	3.31e-12	NA	NA	0.6572
6. F	A5N4I5	Bifunctional protein GlmU	2.15e-12	NA	NA	0.6532
6. F	Q4L3F6	Bifunctional protein GlmU	2.90e-12	NA	NA	0.6558
6. F	Q04KG7	Glucose-1-phosphate adenylyltransferase	1.11e-13	NA	NA	0.7201
6. F	B8EDU8	Bifunctional protein GlmU	5.73e-11	NA	NA	0.6437
6. F	P9WMX0	Pre-mycofactocin glycosyltransferase	4.71e-03	NA	NA	0.4246
6. F	Q97R46	Bifunctional protein GlmU	1.03e-11	NA	NA	0.655
6. F	C1CV18	Glucose-1-phosphate adenylyltransferase	2.19e-12	NA	NA	0.7176
6. F	A4YCH6	Bifunctional protein GlmU	8.92e-11	NA	NA	0.6888
6. F	Q2K8G2	Bifunctional protein GlmU	1.56e-11	NA	NA	0.655
6. F	A4VS60	Bifunctional protein GlmU	4.48e-11	NA	NA	0.6711
6. F	A9KTJ4	Glucose-1-phosphate adenylyltransferase	1.44e-11	NA	NA	0.7146
6. F	Q5M0U2	Bifunctional protein GlmU	2.48e-12	NA	NA	0.7128
6. F	P52417	Glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic	1.57e-10	NA	NA	0.6941
6. F	B2GFE2	Bifunctional protein GlmU	2.28e-12	NA	NA	0.6426
6. F	B9L1J9	Glucose-1-phosphate adenylyltransferase	2.11e-12	NA	NA	0.6986
6. F	C4XSW4	Bifunctional enzyme IspD/IspF	5.01e-05	NA	NA	0.5889
6. F	C3KWA1	Bifunctional protein GlmU	1.54e-12	NA	NA	0.6899
6. F	A1TUE2	Bifunctional protein GlmU	6.85e-11	NA	NA	0.6865
6. F	Q1GXN2	Bifunctional protein GlmU	6.65e-11	NA	NA	0.6972
6. F	Q21DL5	Bifunctional protein GlmU	5.59e-11	NA	NA	0.6812
6. F	Q2JCE9	Glucose-1-phosphate adenylyltransferase	1.77e-11	NA	NA	0.7013
6. F	C1DMJ0	Bifunctional protein GlmU	4.15e-11	NA	NA	0.6449
6. F	Q1C097	Bifunctional protein GlmU	3.24e-11	NA	NA	0.6564
6. F	Q036S8	Glucose-1-phosphate adenylyltransferase	3.10e-13	NA	NA	0.719
6. F	A6U9C1	Bifunctional protein GlmU	1.02e-11	NA	NA	0.6592
6. F	B7ISV9	Bifunctional protein GlmU	2.76e-12	NA	NA	0.6498
6. F	Q251V1	Bifunctional protein GlmU	1.11e-12	NA	NA	0.6768
6. F	Q49V08	Bifunctional protein GlmU	2.39e-12	NA	NA	0.6562
6. F	B3Q9C1	Glucose-1-phosphate adenylyltransferase	3.21e-11	NA	NA	0.689
6. F	Q15RP8	Glucose-1-phosphate adenylyltransferase 2	6.73e-12	NA	NA	0.6976
6. F	B1XLT6	Bifunctional protein GlmU	1.08e-11	NA	NA	0.6602
6. F	P55357	Mannose-1-phosphate guanylyltransferase	1.36e-08	NA	NA	0.6252
6. F	B2V046	Glucose-1-phosphate adenylyltransferase	9.80e-14	NA	NA	0.7138
6. F	Q28MN1	Glucose-1-phosphate adenylyltransferase	1.58e-11	NA	NA	0.6982
6. F	B3PZN3	Bifunctional protein GlmU	1.50e-11	NA	NA	0.6562
6. F	Q8D7E0	Glucose-1-phosphate adenylyltransferase 2	1.39e-11	NA	NA	0.7066
6. F	Q8PGH2	Bifunctional protein GlmU	5.42e-11	NA	NA	0.6519
6. F	B2GHR6	Glucose-1-phosphate adenylyltransferase	1.53e-11	NA	NA	0.7022
6. F	Q118R6	Bifunctional protein GlmU	4.45e-11	NA	NA	0.6909
6. F	Q6GDD8	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	4.84e-03	NA	NA	0.4131
6. F	Q5SLA8	Bifunctional protein GlmU	3.52e-11	NA	NA	0.6843
6. F	Q0HD81	Bifunctional protein GlmU	5.05e-11	NA	NA	0.6583
6. F	P55243	Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic/amyloplastic	2.02e-10	NA	NA	0.6886
6. F	A4WRM1	Glucose-1-phosphate adenylyltransferase	1.87e-11	NA	NA	0.7006
6. F	B9DRD5	Bifunctional protein GlmU	2.51e-12	NA	NA	0.6829
6. F	C6DJH5	Bifunctional protein GlmU	2.29e-11	NA	NA	0.6733
6. F	Q1MGP8	Bifunctional protein GlmU	1.57e-11	NA	NA	0.6554
6. F	P46370	Uncharacterized 55.3 kDa protein in thcA 5'region	1.60e-03	NA	NA	0.4097
6. F	Q82XP7	Bifunctional protein GlmU	8.48e-11	NA	NA	0.673
6. F	Q9A5Z3	Bifunctional protein GlmU	3.18e-11	NA	NA	0.6548
6. F	Q1JQ93	Dolichol-phosphate mannosyltransferase subunit 1	1.94e-04	NA	NA	0.4672
6. F	B0JJ82	Bifunctional protein GlmU	4.83e-11	NA	NA	0.6728
6. F	Q030T6	Glucose-1-phosphate adenylyltransferase	2.06e-13	NA	NA	0.7005
6. F	A9IS87	Bifunctional enzyme IspD/IspF	5.70e-06	NA	NA	0.5241
6. F	B4SJR6	Bifunctional protein GlmU	6.82e-11	NA	NA	0.6601
6. F	Q29121	Polypeptide N-acetylgalactosaminyltransferase 1	2.78e-03	NA	NA	0.4179
6. F	Q46632	Amylovoran biosynthesis glycosyltransferase AmsB	7.95e-03	NA	NA	0.3964
6. F	A6U8F8	Bifunctional enzyme IspD/IspF	3.76e-06	NA	NA	0.5825
6. F	P0ACC8	Bifunctional protein GlmU	4.44e-11	NA	NA	0.6702
6. F	Q165E3	Glucose-1-phosphate adenylyltransferase	4.82e-11	NA	NA	0.6813
6. F	P37820	Putative mannose-1-phosphate guanyltransferase	2.58e-13	NA	NA	0.7019
6. F	P39669	Glucose-1-phosphate adenylyltransferase	6.08e-11	NA	NA	0.6877
6. F	B2HS55	Glucose-1-phosphate adenylyltransferase	1.18e-11	NA	NA	0.6874
6. F	Q0BPL4	Glucose-1-phosphate adenylyltransferase	3.54e-11	NA	NA	0.7073
6. F	B2IU73	Bifunctional protein GlmU	3.79e-12	NA	NA	0.7099
6. F	Q6G608	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.96e-02	NA	NA	0.4139
6. F	Q0HGJ1	Glucose-1-phosphate adenylyltransferase	8.17e-12	NA	NA	0.7028
6. F	B8ZQY9	Glucose-1-phosphate adenylyltransferase	4.98e-12	NA	NA	0.6937
6. F	A7FPK2	Bifunctional protein GlmU	8.07e-12	NA	NA	0.6888
6. F	C0MH79	Glucose-1-phosphate adenylyltransferase	1.42e-13	NA	NA	0.6963
6. F	Q9A163	Bifunctional protein GlmU	2.34e-12	NA	NA	0.7197
6. F	Q02DF6	Bifunctional protein GlmU	9.38e-11	NA	NA	0.6476
6. F	Q8YAD4	Bifunctional protein GlmU	2.00e-12	NA	NA	0.6815
6. F	B7V789	Bifunctional protein GlmU	5.54e-11	NA	NA	0.649
6. F	Q2A4U5	Glucose-1-phosphate adenylyltransferase	2.08e-11	NA	NA	0.7051
6. F	Q5PKV8	Bifunctional protein GlmU	2.13e-11	NA	NA	0.7016
6. F	Q5PBV0	Bifunctional protein GlmU	2.94e-11	NA	NA	0.631
6. F	B8J9N1	Bifunctional protein GlmU	3.47e-11	NA	NA	0.7199
6. F	A1WZS9	Bifunctional protein GlmU	6.33e-11	NA	NA	0.6595
6. F	Q65PH1	Bifunctional protein GlmU	3.60e-12	NA	NA	0.6599
6. F	A6VLS5	Bifunctional protein GlmU	2.18e-11	NA	NA	0.6649
6. F	P9WN42	Glucose-1-phosphate adenylyltransferase	1.17e-11	NA	NA	0.6994
6. F	A1R6L8	Glucose-1-phosphate adenylyltransferase	1.15e-10	NA	NA	0.7179
6. F	Q2RMC5	Bifunctional protein GlmU	1.39e-12	NA	NA	0.7144
6. F	Q8E5V7	Glucose-1-phosphate adenylyltransferase	1.16e-13	NA	NA	0.7107
6. F	Q3J3H0	Bifunctional protein GlmU	5.20e-11	NA	NA	0.6848
6. F	P55648	Uncharacterized protein y4rO	2.82e-05	NA	NA	0.5973
6. F	C5BQ92	Glucose-1-phosphate adenylyltransferase	1.35e-11	NA	NA	0.6981
6. F	A6WUI8	Bifunctional protein GlmU	8.93e-11	NA	NA	0.6883
6. F	B9JWC4	Bifunctional protein GlmU	9.94e-12	NA	NA	0.637
6. F	A5IKI1	Glucose-1-phosphate adenylyltransferase	8.68e-13	NA	NA	0.7202
6. F	Q46635	Amylovoran biosynthesis glycosyltransferase AmsE	1.58e-03	NA	NA	0.4721
6. F	Q8Z233	Glucose-1-phosphate adenylyltransferase	6.09e-11	NA	NA	0.7083
6. F	Q2YCA1	Bifunctional protein GlmU	6.62e-11	NA	NA	0.6856
6. F	A7NAF3	Bifunctional protein GlmU	6.58e-11	NA	NA	0.7014
6. F	Q8GQP7	Bifunctional protein GlmU	2.67e-11	NA	NA	0.6858
6. F	Q8FQV1	Bifunctional protein GlmU	3.31e-11	NA	NA	0.6763
6. F	A5PJI7	Translation initiation factor eIF-2B subunit gamma	3.94e-06	NA	NA	0.6208
6. F	Q8FQE4	Glucose-1-phosphate adenylyltransferase	1.08e-11	NA	NA	0.7004
6. F	Q72LP1	Bifunctional protein GlmU	1.08e-12	NA	NA	0.6727
6. F	Q5HIH6	Bifunctional protein GlmU	2.72e-12	NA	NA	0.6667
6. F	Q60CR2	Bifunctional protein GlmU	6.61e-11	NA	NA	0.6581
6. F	Q141E6	Glucose-1-phosphate adenylyltransferase	1.90e-11	NA	NA	0.6907
6. F	Q9HT22	Bifunctional protein GlmU	8.45e-11	NA	NA	0.6471
6. F	B3E414	Bifunctional protein GlmU	4.63e-12	NA	NA	0.6932
6. F	Q0AJA8	Bifunctional protein GlmU	4.89e-11	NA	NA	0.6877
6. F	P0DB61	Hyaluronan synthase	8.88e-05	NA	NA	0.4338
6. F	B8G1G5	Glucose-1-phosphate adenylyltransferase	2.44e-13	NA	NA	0.727
6. F	Q6LKA2	Glucose-1-phosphate adenylyltransferase	8.96e-12	NA	NA	0.7048
6. F	A0Q565	Bifunctional protein GlmU	6.74e-11	NA	NA	0.7008
6. F	Q8UEH0	Bifunctional protein GlmU	2.22e-11	NA	NA	0.652
6. F	B0VPT6	Bifunctional protein GlmU	5.63e-12	NA	NA	0.6629
6. F	Q8DPS5	Glucose-1-phosphate adenylyltransferase	1.57e-13	NA	NA	0.7228
6. F	A8AY88	Bifunctional protein GlmU	2.37e-12	NA	NA	0.7055
6. F	A4VWR1	Bifunctional protein GlmU	1.21e-11	NA	NA	0.6798
6. F	A9KBF4	Bifunctional protein GlmU	3.13e-11	NA	NA	0.667
6. F	A1SZH6	Bifunctional protein GlmU	6.74e-11	NA	NA	0.6697
6. F	Q87HX3	Glucose-1-phosphate adenylyltransferase 2	1.15e-11	NA	NA	0.6957
6. F	B9JF01	Bifunctional enzyme IspD/IspF	4.52e-06	NA	NA	0.5673
6. F	Q8ZA77	Glucose-1-phosphate adenylyltransferase	1.05e-10	NA	NA	0.686
6. F	Q0TMG3	Bifunctional protein GlmU	1.18e-12	NA	NA	0.6396
6. F	P0DB60	Hyaluronan synthase	9.29e-05	NA	NA	0.434
6. F	Q4R6T3	Translation initiation factor eIF-2B subunit gamma	4.48e-06	NA	NA	0.6037
6. F	A8KYU3	Glucose-1-phosphate adenylyltransferase	2.21e-11	NA	NA	0.705
6. F	Q2YB46	Glucose-1-phosphate adenylyltransferase	1.32e-11	NA	NA	0.7062
6. F	Q6LLH1	Bifunctional protein GlmU	1.57e-11	NA	NA	0.6537
6. F	C4K351	Bifunctional protein GlmU	4.65e-11	NA	NA	0.6626
6. F	Q31UN0	Bifunctional protein GlmU	2.54e-11	NA	NA	0.6925
6. F	Q00473	Mannose-1-phosphate guanylyltransferase	1.82e-06	NA	NA	0.599
6. F	A2BVS4	Bifunctional protein GlmU	2.27e-10	NA	NA	0.6786
6. F	Q87QX6	Glucose-1-phosphate adenylyltransferase 1	1.49e-11	NA	NA	0.7113
6. F	Q0HST8	Glucose-1-phosphate adenylyltransferase	1.25e-11	NA	NA	0.7014
6. F	Q48215	Uncharacterized glycosyltransferase HI_1695	1.33e-02	NA	NA	0.4479
6. F	Q81J98	Bifunctional protein GlmU	2.73e-12	NA	NA	0.6616
6. F	Q2NQ84	Bifunctional protein GlmU	9.43e-12	NA	NA	0.6683
6. F	P50356	N-acetylglucosaminyltransferase	6.18e-04	NA	NA	0.4176
6. F	P05415	Glucose-1-phosphate adenylyltransferase	6.08e-11	NA	NA	0.7098
6. F	Q5FUY6	Bifunctional protein GlmU	8.46e-12	NA	NA	0.6774
6. F	C5BF42	Bifunctional protein GlmU	1.53e-11	NA	NA	0.6726
6. F	C3MCF7	Bifunctional protein GlmU	2.22e-11	NA	NA	0.6582
6. F	Q8P286	Bifunctional protein GlmU	2.59e-12	NA	NA	0.7191
6. F	Q839U1	Bifunctional protein GlmU	6.51e-12	NA	NA	0.6872
6. F	B1IX08	Bifunctional protein GlmU	4.49e-11	NA	NA	0.6703
6. F	Q5DZC0	Glucose-1-phosphate adenylyltransferase	1.10e-11	NA	NA	0.7051
6. F	B2JCH8	Glucose-1-phosphate adenylyltransferase	2.84e-11	NA	NA	0.6884
6. F	B4ULA3	Glucose-1-phosphate adenylyltransferase	1.04e-11	NA	NA	0.6936
6. F	A7HN65	Glucose-1-phosphate adenylyltransferase	1.34e-12	NA	NA	0.722
6. F	Q9WY82	Glucose-1-phosphate adenylyltransferase	1.25e-12	NA	NA	0.7268
6. F	B4SVN3	Glucose-1-phosphate adenylyltransferase	7.07e-11	NA	NA	0.7079
6. F	Q73FF9	Bifunctional protein GlmU	2.73e-12	NA	NA	0.6616
6. F	Q8GLC5	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	8.97e-04	NA	NA	0.4258
6. F	Q0I9Y4	Bifunctional protein GlmU	8.38e-12	NA	NA	0.6744
6. F	B0C3K5	Bifunctional protein GlmU	4.40e-11	NA	NA	0.6439
6. F	Q97QS7	Glucose-1-phosphate adenylyltransferase	1.35e-13	NA	NA	0.7233
6. F	Q9ZB73	Processive diacylglycerol beta-glycosyltransferase	4.49e-03	NA	NA	0.4359
6. F	C4LHU9	Glucose-1-phosphate adenylyltransferase	1.32e-11	NA	NA	0.6872
6. F	P43796	Glucose-1-phosphate adenylyltransferase	1.30e-11	NA	NA	0.6955
6. F	A9FSV7	Bifunctional protein GlmU	1.67e-11	NA	NA	0.6666
6. F	B3DSC7	Glucose-1-phosphate adenylyltransferase	1.74e-11	NA	NA	0.7135
6. F	Q14J62	Bifunctional protein GlmU	7.10e-11	NA	NA	0.7011
6. F	C4KZV1	Bifunctional protein GlmU	9.77e-13	NA	NA	0.6927
6. F	B1KTE7	Bifunctional protein GlmU	1.84e-12	NA	NA	0.6958
6. F	Q8EGU3	Glucose-1-phosphate adenylyltransferase	1.32e-11	NA	NA	0.6993
6. F	Q21BQ2	Glucose-1-phosphate adenylyltransferase	3.83e-11	NA	NA	0.6856
6. F	Q6DJR8	Polypeptide N-acetylgalactosaminyltransferase 11	1.10e-01	NA	NA	0.4247
6. F	B8H8I4	Glucose-1-phosphate adenylyltransferase	1.03e-10	NA	NA	0.713
6. F	A0QSC1	Pre-mycofactocin glycosyltransferase	4.17e-03	NA	NA	0.4439
6. F	Q5X9A9	Hyaluronan synthase	9.00e-05	NA	NA	0.4412
6. F	Q13EA6	Glucose-1-phosphate adenylyltransferase	3.35e-11	NA	NA	0.6849
6. F	Q28MG0	Bifunctional protein GlmU	5.86e-11	NA	NA	0.6826
6. F	B2IPY6	Glucose-1-phosphate adenylyltransferase	1.37e-13	NA	NA	0.7254
6. F	Q1H1K1	Glucose-1-phosphate adenylyltransferase	1.08e-11	NA	NA	0.6937
6. F	Q1CDL5	Glucose-1-phosphate adenylyltransferase	8.74e-11	NA	NA	0.6847
6. F	Q8G0X5	Molybdenum cofactor guanylyltransferase	1.27e-08	NA	NA	0.5933
6. F	Q9CK29	Bifunctional protein GlmU	2.16e-11	NA	NA	0.6829
6. F	P72334	N-acetylglucosaminyltransferase	4.31e-03	NA	NA	0.4093
6. F	Q8CMT0	Bifunctional protein GlmU	9.91e-12	NA	NA	0.6711
6. F	Q89B26	Bifunctional protein GlmU	1.34e-11	NA	NA	0.6977
6. F	A4W313	Bifunctional protein GlmU	1.36e-11	NA	NA	0.6796
6. F	Q5HRQ6	Bifunctional protein GlmU	1.10e-11	NA	NA	0.6696
6. F	A6VF30	Bifunctional protein GlmU	5.49e-11	NA	NA	0.6491
6. F	A6TF49	Glucose-1-phosphate adenylyltransferase	7.02e-11	NA	NA	0.7087
6. F	Q7W321	Bifunctional protein GlmU	7.44e-11	NA	NA	0.6588
6. F	Q15U36	Glucose-1-phosphate adenylyltransferase 1	2.10e-11	NA	NA	0.7117
6. F	Q0AR24	Bifunctional protein GlmU	2.42e-11	NA	NA	0.6823
6. F	Q2G7S6	Glucose-1-phosphate adenylyltransferase	3.47e-11	NA	NA	0.6727
6. F	A4WU43	Bifunctional protein GlmU	6.93e-11	NA	NA	0.6685
6. F	B0BUE6	Bifunctional protein GlmU	8.76e-11	NA	NA	0.661
6. F	Q8ZKX0	Bifunctional protein GlmU	2.35e-11	NA	NA	0.682
6. F	C5CFS2	Bifunctional protein GlmU	3.76e-11	NA	NA	0.6497
6. F	Q48214	Uncharacterized glycosyltransferase HI_1696	8.10e-03	NA	NA	0.4178
6. F	Q3AFM0	Bifunctional protein GlmU	1.48e-11	NA	NA	0.6859
6. F	Q899I9	Bifunctional protein GlmU	1.16e-12	NA	NA	0.7201
6. F	Q97E92	Bifunctional protein GlmU	1.20e-12	NA	NA	0.6878
6. F	Q0I1G0	Bifunctional protein GlmU	1.76e-11	NA	NA	0.6546
6. F	Q1J847	Bifunctional protein GlmU	2.66e-12	NA	NA	0.7174
6. F	Q48UZ1	Bifunctional protein GlmU	2.69e-12	NA	NA	0.7194
6. F	B8J7Y5	Glucose-1-phosphate adenylyltransferase	1.17e-11	NA	NA	0.6859
6. F	A0Q595	Glucose-1-phosphate adenylyltransferase	1.86e-11	NA	NA	0.7072
6. F	B2G5J5	Bifunctional protein GlmU	1.13e-11	NA	NA	0.6536
6. F	P12300	Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic (Fragment)	3.09e-10	NA	NA	0.6936
6. F	B9DLD6	Bifunctional protein GlmU	3.42e-12	NA	NA	0.6792
6. F	B8ZPW3	Glucose-1-phosphate adenylyltransferase	1.85e-13	NA	NA	0.7217
6. F	Q04KU2	Bifunctional protein GlmU	1.67e-11	NA	NA	0.6574
6. F	Q6MHV9	Bifunctional protein GlmU	9.96e-11	NA	NA	0.6518
6. F	Q3BP20	Bifunctional protein GlmU	4.09e-11	NA	NA	0.6551
6. F	Q7A351	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	8.97e-04	NA	NA	0.4281
6. F	Q6AF21	Glucose-1-phosphate adenylyltransferase	2.34e-11	NA	NA	0.674
6. F	A0R2E1	Glucose-1-phosphate adenylyltransferase	1.73e-11	NA	NA	0.7046
6. F	Q1JN46	Bifunctional protein GlmU	1.88e-12	NA	NA	0.6882
6. F	B0TZI3	Glucose-1-phosphate adenylyltransferase	1.02e-11	NA	NA	0.7185
6. F	B0RHI9	Bifunctional protein GlmU	3.03e-10	NA	NA	0.6572
6. F	C3LJ22	Bifunctional protein GlmU	2.74e-12	NA	NA	0.6622
6. F	B5EYZ3	Bifunctional protein GlmU	2.03e-11	NA	NA	0.6763
6. F	Q4UQF8	Bifunctional protein GlmU	7.06e-11	NA	NA	0.6515
6. F	A7NAI4	Glucose-1-phosphate adenylyltransferase	1.92e-11	NA	NA	0.7075
6. F	Q9KLP4	Glucose-1-phosphate adenylyltransferase 2	1.19e-11	NA	NA	0.6988
6. F	B5F8Q2	Glucose-1-phosphate adenylyltransferase	5.78e-11	NA	NA	0.7061
6. F	Q6FZH5	Bifunctional protein GlmU	1.01e-11	NA	NA	0.6852
6. F	B0RWB8	Bifunctional protein GlmU	5.97e-11	NA	NA	0.6519
6. F	Q6KHP5	Glucose-1-phosphate adenylyltransferase	4.36e-13	NA	NA	0.7106
6. F	A5PK45	Procollagen galactosyltransferase 1	1.64e-01	NA	NA	0.4861
6. F	Q5ZRK6	Bifunctional protein GlmU	6.07e-11	NA	NA	0.6712
6. F	Q4JUF1	Glucose-1-phosphate adenylyltransferase	2.47e-11	NA	NA	0.7034
6. F	A3CM02	Glucose-1-phosphate adenylyltransferase	1.71e-13	NA	NA	0.7182
6. F	Q1ISX7	Glucose-1-phosphate adenylyltransferase	1.60e-11	NA	NA	0.6925
6. F	B7IFV2	Glucose-1-phosphate adenylyltransferase	6.92e-13	NA	NA	0.7446
6. F	Q92M13	Glucose-1-phosphate adenylyltransferase	5.22e-11	NA	NA	0.6897
6. F	B5RFW6	Bifunctional protein GlmU	2.33e-11	NA	NA	0.676
6. F	A8A6J2	Bifunctional protein GlmU	4.46e-11	NA	NA	0.6703
6. F	A2RMB7	Glucose-1-phosphate adenylyltransferase	2.75e-13	NA	NA	0.702
6. F	A7H6H5	Glucose-1-phosphate adenylyltransferase	1.10e-11	NA	NA	0.6856
6. F	Q8UFF4	Bifunctional enzyme IspD/IspF	3.00e-06	NA	NA	0.5746
6. F	O67379	Bifunctional IPC transferase and DIPP synthase	1.32e-08	NA	NA	0.6625
6. F	A4J0P6	Bifunctional protein GlmU	3.60e-12	NA	NA	0.6493
6. F	B4U648	Bifunctional protein GlmU	5.08e-11	NA	NA	0.647
6. F	Q1DCI1	Bifunctional protein GlmU	1.91e-11	NA	NA	0.7162
6. F	B8EAW7	Glucose-1-phosphate adenylyltransferase	1.11e-11	NA	NA	0.7135
6. F	Q494C1	Bifunctional protein GlmU	1.77e-11	NA	NA	0.7065
6. F	C0Q0L0	Glucose-1-phosphate adenylyltransferase	4.67e-11	NA	NA	0.7104
6. F	Q5P5P9	Bifunctional protein GlmU	2.44e-11	NA	NA	0.6664
6. F	Q1MR76	Bifunctional enzyme IspD/IspF	4.48e-05	NA	NA	0.5603
6. F	Q8G5Y5	Glucose-1-phosphate adenylyltransferase	1.92e-11	NA	NA	0.72
6. F	C3MIS7	Glucose-1-phosphate adenylyltransferase	5.14e-11	NA	NA	0.6933
6. F	P52416	Glucose-1-phosphate adenylyltransferase small subunit 1, chloroplastic	1.22e-10	NA	NA	0.698
6. F	Q826D9	Glucose-1-phosphate adenylyltransferase	1.49e-11	NA	NA	0.7178
6. F	B1MLL3	Glucose-1-phosphate adenylyltransferase	1.43e-11	NA	NA	0.6795
6. F	Q98LX2	Bifunctional protein GlmU	3.06e-11	NA	NA	0.6656
6. F	P0DB63	Bifunctional protein GlmU	2.81e-12	NA	NA	0.717
6. F	A5U161	Bifunctional protein GlmU	5.36e-11	NA	NA	0.65
6. F	P14192	Bifunctional protein GlmU	2.59e-12	NA	NA	0.6599
6. F	A0Q3I7	Glucose-1-phosphate adenylyltransferase	1.29e-13	NA	NA	0.7097
6. F	Q0BSR5	Bifunctional protein GlmU	1.29e-10	NA	NA	0.6665
6. F	A4IZK0	Glucose-1-phosphate adenylyltransferase	2.00e-11	NA	NA	0.7033
6. F	Q03084	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase	2.70e-04	NA	NA	0.422
6. F	B4SYC8	Bifunctional protein GlmU	2.21e-11	NA	NA	0.6835
6. F	C4ZZ08	Bifunctional protein GlmU	4.06e-11	NA	NA	0.6708
6. F	Q7VQV4	Bifunctional protein GlmU	1.04e-10	NA	NA	0.6927
6. F	Q1B4S9	Glucose-1-phosphate adenylyltransferase	1.07e-11	NA	NA	0.7002
6. F	Q4JU42	Bifunctional protein GlmU	4.58e-11	NA	NA	0.6653
6. F	P71054	Putative glycosyltransferase EpsE	2.95e-04	NA	NA	0.438
6. F	A7GJD9	Bifunctional protein GlmU	7.95e-12	NA	NA	0.6887
6. F	B3W9A3	Glucose-1-phosphate adenylyltransferase	3.43e-13	NA	NA	0.7189
6. F	B1X9V8	Bifunctional protein GlmU	3.99e-11	NA	NA	0.689
6. F	Q5HLM5	Teichoic acid poly(glycerol phosphate) polymerase	4.22e-02	NA	NA	0.41
6. F	Q5QZH4	Bifunctional protein GlmU	5.37e-11	NA	NA	0.6971
6. F	Q21ZH9	Bifunctional protein GlmU	3.55e-11	NA	NA	0.6831
6. F	Q04C57	Bifunctional protein GlmU	1.92e-12	NA	NA	0.6561
6. F	Q57287	Uncharacterized glycosyltransferase HI_1578	6.07e-03	NA	NA	0.3454
6. F	A8F3W8	Glucose-1-phosphate adenylyltransferase	7.07e-13	NA	NA	0.7431
6. F	C1FNF1	Bifunctional protein GlmU	7.84e-12	NA	NA	0.6893
6. F	Q9ZFN4	Glucose-1-phosphate adenylyltransferase	1.14e-11	NA	NA	0.6983
6. F	A4T8X4	Glucose-1-phosphate adenylyltransferase	1.84e-11	NA	NA	0.7022
6. F	A1U7H2	Bifunctional protein GlmU	6.68e-11	NA	NA	0.677
6. F	A9MTV2	Glucose-1-phosphate adenylyltransferase	4.11e-11	NA	NA	0.7104
6. F	Q5M5C8	Bifunctional protein GlmU	2.45e-12	NA	NA	0.7054
6. F	Q2W5G1	Glucose-1-phosphate adenylyltransferase	1.97e-11	NA	NA	0.6991
6. F	Q24VW5	Glucose-1-phosphate adenylyltransferase	1.64e-13	NA	NA	0.73
6. F	A6M331	Glucose-1-phosphate adenylyltransferase	1.08e-13	NA	NA	0.7068
6. F	Q6NI74	Bifunctional protein GlmU	3.76e-11	NA	NA	0.6539
6. F	Q2FJE2	Bifunctional protein GlmU	2.98e-12	NA	NA	0.6665
6. F	Q1GIQ5	Bifunctional protein GlmU	2.13e-11	NA	NA	0.7011
6. F	Q65R54	Bifunctional protein GlmU	2.86e-11	NA	NA	0.6682
6. F	C1ACL9	Glucose-1-phosphate adenylyltransferase	3.63e-11	NA	NA	0.6973
6. F	B1IBQ8	Glucose-1-phosphate adenylyltransferase	1.47e-13	NA	NA	0.7244
6. F	Q47UE0	Bifunctional protein GlmU	2.46e-11	NA	NA	0.6753
6. F	A8MK45	Bifunctional protein GlmU	5.93e-12	NA	NA	0.6832
6. F	Q39ZH2	Bifunctional protein GlmU	4.68e-12	NA	NA	0.6877
6. F	P64242	Glucose-1-phosphate adenylyltransferase	1.08e-11	NA	NA	0.6998
6. F	Q73WU6	Glucose-1-phosphate adenylyltransferase	2.07e-11	NA	NA	0.6799
6. F	Q82T88	Glucose-1-phosphate adenylyltransferase	2.83e-11	NA	NA	0.7116
6. F	B1I194	Bifunctional protein GlmU	6.16e-12	NA	NA	0.7068
6. F	Q9GM01	Polypeptide N-acetylgalactosaminyltransferase 9	7.74e-02	NA	NA	0.4049
6. F	A3PJX6	Glucose-1-phosphate adenylyltransferase	2.97e-11	NA	NA	0.6692
6. F	Q89G87	Glucose-1-phosphate adenylyltransferase	3.01e-11	NA	NA	0.6775
6. F	P43889	Bifunctional protein GlmU	1.10e-11	NA	NA	0.6625
6. F	Q63HI4	Bifunctional protein GlmU	1.52e-11	NA	NA	0.6621
6. F	Q5X112	Bifunctional protein GlmU	5.62e-11	NA	NA	0.6723
6. F	Q07VU6	Bifunctional protein GlmU	4.92e-11	NA	NA	0.6711
6. F	B1WT08	Glucose-1-phosphate adenylyltransferase	1.17e-11	NA	NA	0.7094
6. F	A6LPJ1	Bifunctional protein GlmU	1.23e-12	NA	NA	0.6272
6. F	P55465	Uncharacterized protein y4gI	2.17e-01	NA	NA	0.4354
6. F	Q8RF63	Glucose-1-phosphate adenylyltransferase	9.15e-14	NA	NA	0.7156
6. F	D4GYH3	Glucosyl-dolichyl phosphate glucuronosyltransferase	8.66e-05	NA	NA	0.4429
6. F	Q5XDJ2	Bifunctional protein GlmU	2.49e-12	NA	NA	0.7195
6. F	Q1C1E1	Glucose-1-phosphate adenylyltransferase	8.72e-11	NA	NA	0.6825
6. F	Q2J307	Glucose-1-phosphate adenylyltransferase	6.00e-11	NA	NA	0.6857
6. F	Q6GBY9	Bifunctional protein GlmU	2.72e-12	NA	NA	0.6667
6. F	A8AYH2	Glucose-1-phosphate adenylyltransferase	1.19e-13	NA	NA	0.7167
6. F	B9JAA3	Glucose-1-phosphate adenylyltransferase	5.86e-11	NA	NA	0.6802
6. F	A1RQA8	Bifunctional protein GlmU	6.16e-11	NA	NA	0.689
6. F	P55238	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic	9.85e-11	NA	NA	0.6878
6. F	B9IZD2	Bifunctional protein GlmU	2.88e-12	NA	NA	0.662
6. F	Q8NUI7	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.17e-02	NA	NA	0.4225
6. F	C1CEA8	Glucose-1-phosphate adenylyltransferase	1.34e-13	NA	NA	0.7303
6. F	Q3K1K4	Glucose-1-phosphate adenylyltransferase	8.37e-14	NA	NA	0.7097
6. F	A1AZN6	Bifunctional protein GlmU	1.53e-10	NA	NA	0.6557
6. F	A1TDM8	Glucose-1-phosphate adenylyltransferase	2.42e-11	NA	NA	0.698
6. F	C1C6W6	Bifunctional protein GlmU	1.13e-11	NA	NA	0.6767
6. F	B9KHH2	Bifunctional protein GlmU	3.10e-11	NA	NA	0.6441
6. F	Q985P3	Glucose-1-phosphate adenylyltransferase	4.17e-11	NA	NA	0.6829
6. F	C1CKI5	Glucose-1-phosphate adenylyltransferase	1.38e-13	NA	NA	0.7189
6. F	Q0BN96	Bifunctional protein GlmU	5.56e-11	NA	NA	0.6955
6. F	B5ZQ46	Glucose-1-phosphate adenylyltransferase	5.11e-11	NA	NA	0.6895
6. F	B7K5U7	Glucose-1-phosphate adenylyltransferase	4.96e-12	NA	NA	0.7044
6. F	Q8XHJ3	Bifunctional protein GlmU	1.10e-12	NA	NA	0.6423
6. F	Q73G24	Bifunctional enzyme IspD/IspF	1.98e-06	NA	NA	0.5464
6. F	B2S5I0	Molybdenum cofactor guanylyltransferase	1.39e-08	NA	NA	0.585
6. F	A8I4D4	Bifunctional protein GlmU	1.50e-11	NA	NA	0.6584
6. F	B9DY47	Bifunctional protein GlmU	2.05e-12	NA	NA	0.656
6. F	C3K1E4	Bifunctional protein GlmU	9.78e-11	NA	NA	0.6492
6. F	Q31IB9	Glucose-1-phosphate adenylyltransferase	9.10e-12	NA	NA	0.7
6. F	Q47II9	Glucose-1-phosphate adenylyltransferase	2.54e-11	NA	NA	0.7032
6. F	Q99WA4	Bifunctional protein GlmU	3.54e-12	NA	NA	0.6573
6. F	A0JWV0	Glucose-1-phosphate adenylyltransferase	9.01e-11	NA	NA	0.7197
6. F	A9HI46	Bifunctional protein GlmU	4.96e-11	NA	NA	0.6526
6. F	Q5FL67	Glucose-1-phosphate adenylyltransferase	2.69e-13	NA	NA	0.7211
6. F	C4L8R0	Bifunctional protein GlmU	5.44e-11	NA	NA	0.6471
6. F	A1S8E8	Glucose-1-phosphate adenylyltransferase	9.25e-12	NA	NA	0.7014
6. F	B8DGM7	Bifunctional protein GlmU	2.10e-12	NA	NA	0.6818
6. F	Q1IWX3	Bifunctional protein GlmU	3.86e-11	NA	NA	0.6787
6. F	A5II48	Bifunctional protein GlmU	5.17e-11	NA	NA	0.6708
6. F	Q1WV55	Bifunctional protein GlmU	3.71e-12	NA	NA	0.6331
6. F	B0TZM4	Bifunctional protein GlmU	5.89e-11	NA	NA	0.6558
6. F	Q9CHN1	Glucose-1-phosphate adenylyltransferase	2.67e-13	NA	NA	0.7075
6. F	Q7MJ49	Glucose-1-phosphate adenylyltransferase 1	1.98e-11	NA	NA	0.7144
6. F	C5D371	Bifunctional protein GlmU	1.17e-12	NA	NA	0.6795
6. F	B5ER40	Bifunctional protein GlmU	1.68e-10	NA	NA	0.6241
6. F	Q046K2	Bifunctional protein GlmU	2.50e-11	NA	NA	0.661
6. F	A4TQV0	Glucose-1-phosphate adenylyltransferase	8.72e-11	NA	NA	0.6846
6. F	B5BIN3	Bifunctional protein GlmU	1.89e-11	NA	NA	0.6786
6. F	B5YHS4	Bifunctional protein GlmU	2.36e-11	NA	NA	0.6761
6. F	B0U595	Bifunctional protein GlmU	2.26e-11	NA	NA	0.6588
6. F	Q9M462	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic	2.07e-10	NA	NA	0.6908
6. F	A1K6F9	Glucose-1-phosphate adenylyltransferase	3.30e-12	NA	NA	0.6776
6. F	Q9RTR7	Glucose-1-phosphate adenylyltransferase	8.15e-12	NA	NA	0.7068
6. F	Q8NRU8	Bifunctional protein GlmU	2.91e-11	NA	NA	0.6981
6. F	Q310X3	Bifunctional enzyme IspD/IspF	2.03e-06	NA	NA	0.5706
6. F	Q2JVA4	Bifunctional protein GlmU	4.87e-09	NA	NA	0.6532
6. F	B5ZP51	Bifunctional protein GlmU	2.76e-11	NA	NA	0.6569
6. F	Q2RS49	Glucose-1-phosphate adenylyltransferase	1.19e-11	NA	NA	0.6959
6. F	Q65FS5	Glucose-1-phosphate adenylyltransferase	2.30e-13	NA	NA	0.7287
6. F	B5FN29	Bifunctional protein GlmU	2.06e-11	NA	NA	0.6834
6. F	C1AZL1	Glucose-1-phosphate adenylyltransferase	1.31e-11	NA	NA	0.6909
6. F	B9MD63	Bifunctional protein GlmU	3.15e-11	NA	NA	0.7075
6. F	A1VJM6	Bifunctional protein GlmU	4.32e-11	NA	NA	0.7073
6. F	B7HIL7	Bifunctional protein GlmU	3.17e-12	NA	NA	0.6488
6. F	Q1DC47	Glucose-1-phosphate adenylyltransferase	1.11e-11	NA	NA	0.7086
6. F	B2I2B5	Bifunctional protein GlmU	5.66e-11	NA	NA	0.6633
6. F	B7NF46	Bifunctional protein GlmU	4.31e-11	NA	NA	0.6776
6. F	Q2P7P9	Bifunctional protein GlmU	5.40e-11	NA	NA	0.6572
6. F	B1YK68	Glucose-1-phosphate adenylyltransferase	3.05e-13	NA	NA	0.7089
6. F	C4Z4L8	Glucose-1-phosphate adenylyltransferase	1.05e-12	NA	NA	0.7154
6. F	B8DUN4	Glucose-1-phosphate adenylyltransferase	2.34e-11	NA	NA	0.7101
6. F	Q2S6P3	Bifunctional protein GlmU	3.76e-11	NA	NA	0.6628
6. F	C1C7B5	Glucose-1-phosphate adenylyltransferase	1.45e-13	NA	NA	0.7228
6. F	Q8NKX1	Hyaluronan synthase	9.03e-05	NA	NA	0.4412
6. F	A4QCS3	Bifunctional protein GlmU	4.89e-11	NA	NA	0.6754
6. F	A8LIS2	Bifunctional protein GlmU	1.13e-11	NA	NA	0.6704
6. F	B4UGJ1	Bifunctional protein GlmU	2.76e-11	NA	NA	0.7205
6. F	B5XTQ9	Glucose-1-phosphate adenylyltransferase	6.90e-11	NA	NA	0.7088
6. F	Q03LQ1	Bifunctional protein GlmU	1.32e-11	NA	NA	0.7116
6. F	A3DK82	Glucose-1-phosphate adenylyltransferase	9.95e-13	NA	NA	0.7319
6. F	A0R8C1	Bifunctional protein GlmU	2.56e-12	NA	NA	0.6618
6. F	B5BHI0	Glucose-1-phosphate adenylyltransferase	4.72e-11	NA	NA	0.7096
6. F	C1AMK7	Glucose-1-phosphate adenylyltransferase	1.09e-11	NA	NA	0.6998
6. F	Q887Q9	Alginate biosynthesis protein AlgA	3.74e-09	NA	NA	0.5993
6. F	B1IH02	Bifunctional protein GlmU	8.29e-12	NA	NA	0.6886
6. F	B7HPW0	Bifunctional protein GlmU	1.59e-11	NA	NA	0.6623
6. F	A1USU8	Bifunctional protein GlmU	9.10e-12	NA	NA	0.6704
6. F	A4J4I2	Glucose-1-phosphate adenylyltransferase	3.29e-13	NA	NA	0.7202
6. F	A6WKY5	Glucose-1-phosphate adenylyltransferase	1.26e-11	NA	NA	0.7159
6. F	Q5HCN1	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.17e-02	NA	NA	0.4202
6. F	A1W3Q7	Bifunctional protein GlmU	4.30e-11	NA	NA	0.7065
6. F	Q5LPQ1	Bifunctional protein GlmU	1.87e-11	NA	NA	0.6607
6. F	Q8DQ18	Bifunctional protein GlmU	1.66e-11	NA	NA	0.6585
6. F	Q6HPW8	Bifunctional protein GlmU	1.47e-11	NA	NA	0.6621
6. F	B8HM61	Glucose-1-phosphate adenylyltransferase	8.40e-12	NA	NA	0.6894
6. F	C1KYD1	Bifunctional protein GlmU	1.97e-12	NA	NA	0.665
6. F	P72394	Glucose-1-phosphate adenylyltransferase	7.79e-12	NA	NA	0.7058
6. F	Q221N8	Glucose-1-phosphate adenylyltransferase	4.35e-11	NA	NA	0.6938
6. F	A0KZD8	Glucose-1-phosphate adenylyltransferase	1.18e-11	NA	NA	0.7032
6. F	Q74LH7	Bifunctional protein GlmU	1.74e-12	NA	NA	0.6705
6. F	C1CRM1	Glucose-1-phosphate adenylyltransferase	1.81e-13	NA	NA	0.7219
6. F	A1A1B4	Glucose-1-phosphate adenylyltransferase	1.58e-11	NA	NA	0.7052
6. F	A5WHT0	Bifunctional protein GlmU	3.60e-11	NA	NA	0.6488
6. F	Q663R0	Bifunctional protein GlmU	3.17e-11	NA	NA	0.6576
6. F	A9NH16	Bifunctional protein GlmU	1.77e-11	NA	NA	0.671
6. F	Q7V8F2	Bifunctional protein GlmU	7.36e-12	NA	NA	0.6831
6. F	A6VP17	Glucose-1-phosphate adenylyltransferase	1.79e-11	NA	NA	0.7049
6. F	Q6G321	Bifunctional protein GlmU	2.02e-12	NA	NA	0.6703
6. F	Q8PCZ1	Bifunctional protein GlmU	6.91e-11	NA	NA	0.6515
6. F	A6X0N1	Bifunctional enzyme IspD/IspF	7.04e-06	NA	NA	0.4922
6. F	B2SFM9	Glucose-1-phosphate adenylyltransferase	2.19e-11	NA	NA	0.7064
6. F	A1KBP7	Bifunctional protein GlmU	3.45e-11	NA	NA	0.7002
6. F	B0UW09	Bifunctional protein GlmU	2.16e-11	NA	NA	0.6457
6. F	B6J965	Bifunctional protein GlmU	3.27e-11	NA	NA	0.6686
6. F	Q1GBQ8	Bifunctional protein GlmU	2.26e-12	NA	NA	0.6532
6. F	Q83NE5	Bifunctional protein GlmU	1.28e-03	NA	NA	0.5902
6. F	Q0AAX8	Glucose-1-phosphate adenylyltransferase 1	5.60e-12	NA	NA	0.6908
6. F	Q8CXP9	Bifunctional protein GlmU	1.81e-12	NA	NA	0.6528
6. F	Q8XAR5	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.32e-02	NA	NA	0.4424
6. F	B2K849	Bifunctional protein GlmU	3.28e-11	NA	NA	0.6576
6. F	A4IZM7	Bifunctional protein GlmU	6.94e-11	NA	NA	0.7011
6. F	P26404	Mannose-1-phosphate guanylyltransferase RfbM	2.80e-06	NA	NA	0.6031
6. F	A4IJC6	Bifunctional protein GlmU	2.17e-12	NA	NA	0.6656
6. F	B2TR25	Glucose-1-phosphate adenylyltransferase	1.01e-13	NA	NA	0.708
6. F	Q0BN65	Glucose-1-phosphate adenylyltransferase	2.11e-11	NA	NA	0.7076
6. F	Q92F69	Bifunctional protein GlmU	1.89e-12	NA	NA	0.6818
6. F	Q1MBS8	Glucose-1-phosphate adenylyltransferase	5.21e-11	NA	NA	0.6777
6. F	A7ZTU1	Bifunctional protein GlmU	4.13e-11	NA	NA	0.6704
6. F	B6I3W7	Bifunctional protein GlmU	4.54e-11	NA	NA	0.6706
6. F	B1JRN4	Bifunctional protein GlmU	3.15e-11	NA	NA	0.6578
6. F	Q21M27	Glucose-1-phosphate adenylyltransferase	1.69e-11	NA	NA	0.6988
6. F	Q7A7B4	Bifunctional protein GlmU	2.91e-12	NA	NA	0.6666
6. F	B4TAW9	Bifunctional protein GlmU	2.29e-11	NA	NA	0.7001
6. F	Q9RW61	Bifunctional protein GlmU	4.51e-11	NA	NA	0.7007
6. F	Q2A4X7	Bifunctional protein GlmU	6.36e-11	NA	NA	0.7012
6. F	B3H116	Bifunctional protein GlmU	9.08e-11	NA	NA	0.6613
6. F	Q5NHR0	Bifunctional protein GlmU	7.43e-11	NA	NA	0.6738
6. F	B8FY55	Bifunctional protein GlmU	1.24e-12	NA	NA	0.6756
6. F	Q0VKX6	Bifunctional protein GlmU	5.51e-11	NA	NA	0.6522
6. F	Q0SWS5	Glucose-1-phosphate adenylyltransferase	1.12e-13	NA	NA	0.723
6. F	B2UXS6	Bifunctional protein GlmU	1.07e-12	NA	NA	0.642
6. F	A7H7I2	Bifunctional protein GlmU	8.45e-11	NA	NA	0.7182
6. F	Q6GJH2	Bifunctional protein GlmU	3.28e-12	NA	NA	0.6575
6. F	Q5H4Y0	Bifunctional protein GlmU	5.29e-11	NA	NA	0.6566
6. F	Q99QX3	Poly-beta-1,6-N-acetyl-D-glucosamine synthase	1.13e-03	NA	NA	0.4189
6. F	Q8Z9S7	Bifunctional protein GlmU	3.19e-11	NA	NA	0.6562
6. F	A3MZV4	Bifunctional protein GlmU	1.01e-10	NA	NA	0.6612
6. F	B7GS87	Glucose-1-phosphate adenylyltransferase	1.57e-11	NA	NA	0.7132
6. F	B1LL57	Bifunctional protein GlmU	4.40e-11	NA	NA	0.6777
6. F	A7Z0H3	Bifunctional protein GlmU	2.65e-12	NA	NA	0.6611
6. F	P12299	Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic	2.38e-10	NA	NA	0.6974
6. F	A7INP6	Bifunctional protein GlmU	1.82e-11	NA	NA	0.6611
6. F	Q724L5	Bifunctional protein GlmU	1.02e-11	NA	NA	0.6816
6. F	Q0C4B0	Bifunctional protein GlmU	5.14e-11	NA	NA	0.7184
7. B	O74484	Mannose-1-phosphate guanyltransferase	5.93e-14	NA	6.74e-09	NA
7. B	O93827	Mannose-1-phosphate guanyltransferase	6.41e-14	NA	2.30e-08	NA
7. B	A3QMC8	Mannose-1-phosphate guanyltransferase beta	1.35e-10	NA	1.80e-07	NA
7. B	Q8CHW4	Translation initiation factor eIF-2B subunit epsilon	2.92e-07	NA	0.044	NA
7. B	O22287	Mannose-1-phosphate guanylyltransferase 1	8.68e-14	NA	9.76e-09	NA
7. B	P41940	Mannose-1-phosphate guanyltransferase	2.20e-13	NA	4.87e-10	NA
7. B	A1AXS8	Bifunctional protein GlmU	4.45e-11	NA	8.57e-04	NA
7. B	B0KBF5	Bifunctional protein GlmU	1.08e-12	NA	0.009	NA
7. B	Q84JH5	Probable mannose-1-phosphate guanylyltransferase 1	7.22e-15	NA	8.59e-09	NA
7. B	C0ZHD4	Bifunctional protein GlmU	2.07e-12	NA	6.38e-05	NA
7. B	Q941T9	Probable mannose-1-phosphate guanylyltransferase 2	7.83e-14	NA	1.63e-07	NA
7. B	Q54RF3	Translation initiation factor eIF-2B subunit epsilon	1.25e-07	NA	0.031	NA
7. B	Q8BTZ7	Mannose-1-phosphate guanyltransferase beta	2.44e-15	NA	2.76e-10	NA
7. B	Q5XIC1	Mannose-1-phosphate guanyltransferase alpha	7.29e-12	NA	8.16e-06	NA
7. B	Q54K39	Mannose-1-phosphate guanyltransferase beta	2.56e-14	NA	1.52e-08	NA
7. B	Q890J0	Glucose-1-phosphate adenylyltransferase	2.44e-13	NA	0.001	NA
7. B	O66863	Bifunctional protein GlmU	2.43e-11	NA	6.06e-04	NA
7. B	P87163	Translation initiation factor eIF-2B subunit epsilon	2.50e-07	NA	0.002	NA
7. B	Q96IJ6	Mannose-1-phosphate guanyltransferase alpha	5.12e-12	NA	1.15e-05	NA
7. B	Q6DBU5	Mannose-1-phosphate guanyltransferase beta	4.77e-15	NA	6.99e-09	NA
7. B	Q67JC8	Bifunctional protein GlmU	1.60e-11	NA	0.004	NA
7. B	P32501	Translation initiation factor eIF-2B subunit epsilon	1.10e-07	NA	7.85e-04	NA
7. B	Q7JZB4	Mannose-1-phosphate guanyltransferase beta	1.14e-13	NA	6.45e-07	NA
7. B	Q58501	Bifunctional protein GlmU	0.00e+00	NA	3.57e-15	NA
7. B	A5CVK9	Bifunctional protein GlmU	3.99e-11	NA	0.034	NA
7. B	Q9Y5P6	Mannose-1-phosphate guanyltransferase beta	4.85e-14	NA	6.77e-10	NA
7. B	Q6GMK8	Mannose-1-phosphate guanyltransferase alpha-A	3.43e-12	NA	1.61e-06	NA
7. B	P57139	Bifunctional protein GlmU	2.33e-10	NA	0.014	NA
7. B	Q7SXP8	Mannose-1-phosphate guanyltransferase alpha-B	3.34e-12	NA	9.54e-06	NA
7. B	Q922H4	Mannose-1-phosphate guanyltransferase alpha	4.11e-12	NA	2.99e-05	NA
7. B	Q31BS3	Bifunctional protein GlmU	2.80e-10	NA	0.029	NA
7. B	Q5N3K9	Glucose-1-phosphate adenylyltransferase	1.73e-11	NA	0.047	NA
7. B	B8D6U4	Bifunctional protein GlmU	1.09e-10	NA	0.014	NA
7. B	Q9M2S0	Probable mannose-1-phosphate guanylyltransferase 2	2.58e-13	NA	1.58e-05	NA
7. B	Q0B0S9	Bifunctional protein GlmU	3.52e-13	NA	4.95e-04	NA
7. B	I3LUP1	Mannose-1-phosphate guanyltransferase alpha	7.85e-12	NA	1.44e-06	NA
7. B	Q6Z9A3	Probable mannose-1-phosphate guanylyltransferase 3	5.55e-15	NA	9.06e-08	NA