Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54627.1
JCVISYN3A_0129

CTP synthase.
M. mycoides homolog: Q6MUA3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 35
Unique PROST Go: 8
Unique BLAST Go: 0
Unique Foldseek Go: 9

Total Homologs: 1184
Unique PROST Homologs: 352
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 111

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: pyrG; CTP synthase
Zhang et al. [4]: GO:0044210|'de novo' CTP biosynthetic process
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q6MPP0 (CTP synthase) with a FATCAT P-Value: 0 and RMSD of 1.10 angstrom. The sequence alignment identity is 48.3%.
Structural alignment shown in left. Query protein AVX54627.1 colored as red in alignment, homolog Q6MPP0 colored as blue. Query protein AVX54627.1 is also shown in right top, homolog Q6MPP0 showed in right bottom. They are colored based on secondary structures. 

  AVX54627.1 M-AKFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGETDLDLGHYERFIDEELTKLSSTTSGKIYLSVI 99
      Q6MPP0 MKQKFIFVTGGVVSSIGKGLTAASLGALLEGRGHKVTIMKFDPYLNVDPGTMSPLQHGEVYVTEDGAETDLDLGHYERFTSALMNRSNSVSTGQIYDTVL 100

  AVX54627.1 QGERKGVNSGKTIQVVPHITDAIKQKVYQAAEQSQADVIISEIGGTVGDIESQPFIEAIRQIRLEQGKENVMFVHVVLLLWLAASKEYKTKPIQNSVKAM 199
      Q6MPP0 NRERRGDYLGGTVQVIPHITEEIKARIYEAAQGS--EIILVEIGGTVGDIESQPFLEAIRQMRIDVGQENSVLVHVTYVPYIAAAGELKSKPTQHSVKEL 198

  AVX54627.1 ASLGIQPDVIVCRSDSSSPKDIKEKISLFCNV-PITNIIDAIDQDS--IYRVPLALAKQNIQDIIIEQLQLKAKNIDLSLWKQFNKKIDSSTEEIEISFV 296
      Q6MPP0 REIGLQPDFLVCRSEKVIDDNLKAKIGLFCSVKP-ENVIAA--QDSRFIYEVPLALHREKLDELIVARLGLSAGKLNMKGWQNLVKILGNPSHTVKIGVV 295

  AVX54627.1 GKYIELQDAYLSVLESLKIAGWEFNKKIKIRWVQADKL-DESNYKEILKNSQGILVPGGFGKRGIEGMMLASRYARENDIPYLGICLGMQIATISIARDL 395
      Q6MPP0 GKYVDLKESYKSLHEALVHGGVANNARVEIIYVDSEKVTDKTVHS-LLGKVDGILVPGGFGTRGVEGKITAIKYAREKRVPFFGICFGMQLSAIEFARNV 394

  AVX54627.1 LNWTDADSTEF---NKNTTHPIFDYI---KGIDRDNIGGTLRLGTMVTKLEKDSLVSKLYNSDVALERHRHRYEFNNEYKKDL-ESVGLRFSGIYEEKNL 488
      Q6MPP0 CGIKDATSREFHAENKRTGNFVIDSMAEQRGV--INKGGTMRLGAFPCAIASGSRAYQVYKASSIMERHRHRFEFNNKY-KDLFEKNGMMASGICKERDL 491

  AVX54627.1 VEVVEMPSLKFFVASQFHPEFTSRPNKPTPLFRGFIKAIVENNK 532
      Q6MPP0 VEIVELPDHPWFVGVQFHPEFKSKPLAPHPLFVHFVKASL-KKK 534

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0006541 glutamine metabolic process
1. PBF GO:0097268 cytoophidium
1. PBF GO:0005886 plasma membrane
1. PBF GO:0019856 pyrimidine nucleobase biosynthetic process
1. PBF GO:0003883 CTP synthase activity
1. PBF GO:0042802 identical protein binding
1. PBF GO:0005737 cytoplasm
1. PBF GO:0005524 ATP binding
1. PBF GO:0006241 CTP biosynthetic process
1. PBF GO:0046872 metal ion binding
1. PBF GO:0044210 'de novo' CTP biosynthetic process
2. PF GO:0009236 cobalamin biosynthetic process
2. PF GO:0043802 hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing) activity
2. PF GO:0015948 methanogenesis
2. PF GO:0042242 cobyrinic acid a,c-diamide synthase activity
4. PB GO:0042100 B cell proliferation
4. PB GO:0000287 magnesium ion binding
4. PB GO:0042098 T cell proliferation
5. P GO:0006526 arginine biosynthetic process
5. P GO:0016020 membrane
5. P GO:0044205 'de novo' UMP biosynthetic process
5. P GO:0005739 mitochondrion
5. P GO:0015420 ABC-type vitamin B12 transporter activity
5. P GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
5. P GO:0003824 catalytic activity
5. P GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
6. F GO:0051539 4 iron, 4 sulfur cluster binding
6. F GO:0016226 iron-sulfur cluster assembly
6. F GO:0051536 iron-sulfur cluster binding
6. F GO:0009029 tetraacyldisaccharide 4'-kinase activity
6. F GO:0009102 biotin biosynthetic process
6. F GO:0005634 nucleus
6. F GO:0004141 dethiobiotin synthase activity
6. F GO:1904564 Nbp35-Cfd1 ATPase complex
6. F GO:0009245 lipid A biosynthetic process

Uniprot GO Annotations

GO Description
GO:0006221 pyrimidine nucleotide biosynthetic process
GO:0004359 glutaminase activity
GO:0006541 glutamine metabolic process
GO:0003883 CTP synthase activity
GO:0016874 ligase activity
GO:0005524 ATP binding
GO:0006241 CTP biosynthetic process
GO:0046872 metal ion binding
GO:0044210 'de novo' CTP biosynthetic process
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF B7MZ76 CTP synthase 0.00e+00 2.85e-73 0.0 0.9725
1. PBF Q32CD5 CTP synthase 0.00e+00 2.85e-73 0.0 0.9747
1. PBF B3R496 CTP synthase 0.00e+00 4.56e-77 2.71e-177 0.9683
1. PBF Q83B36 CTP synthase 0.00e+00 1.92e-61 0.0 0.9732
1. PBF Q6MPP0 CTP synthase 0.00e+00 2.69e-79 0.0 0.9716
1. PBF B2TZF3 CTP synthase 0.00e+00 2.85e-73 0.0 0.9745
1. PBF Q6F0G9 CTP synthase 0.00e+00 1.31e-92 0.0 0.9944
1. PBF A4SRC2 CTP synthase 0.00e+00 5.51e-74 0.0 0.9705
1. PBF B4S3A5 CTP synthase 0.00e+00 1.97e-65 1.06e-178 0.9707
1. PBF Q74BY3 CTP synthase 0.00e+00 2.99e-77 0.0 0.9726
1. PBF Q2NH50 CTP synthase 0.00e+00 1.12e-61 0.0 0.9688
1. PBF Q1DDB7 CTP synthase 0.00e+00 1.69e-75 0.0 0.9676
1. PBF B3Q0M2 CTP synthase 0.00e+00 1.51e-79 8.41e-165 0.9671
1. PBF A9MF10 CTP synthase 0.00e+00 7.26e-73 0.0 0.9719
1. PBF A5U357 CTP synthase 0.00e+00 1.43e-51 1.24e-180 0.9654
1. PBF Q9WZR0 CTP synthase 0.00e+00 5.96e-70 4.89e-139 0.9246
1. PBF Q5FNN2 CTP synthase 0.00e+00 6.51e-76 1.30e-167 0.9707
1. PBF A3ML79 CTP synthase 0.00e+00 5.57e-72 9.19e-171 0.9712
1. PBF Q2FF01 CTP synthase 0.00e+00 2.71e-82 0.0 0.9818
1. PBF Q822T2 CTP synthase 0.00e+00 2.88e-74 6.87e-160 0.9709
1. PBF Q1LTN7 CTP synthase 0.00e+00 2.85e-73 0.0 0.9709
1. PBF C4LBR2 CTP synthase 0.00e+00 1.75e-74 0.0 0.9727
1. PBF B2K560 CTP synthase 0.00e+00 2.69e-73 0.0 0.9721
1. PBF C4K2E0 CTP synthase 0.00e+00 2.86e-79 1.30e-166 0.9717
1. PBF Q1GF61 CTP synthase 0.00e+00 1.16e-74 7.92e-163 0.9651
1. PBF A6H0U1 CTP synthase 0.00e+00 1.71e-78 0.0 0.9779
1. PBF Q5NZ71 CTP synthase 0.00e+00 1.12e-76 0.0 0.9668
1. PBF B7HY98 CTP synthase 0.00e+00 4.76e-84 0.0 0.9882
1. PBF Q2JLG7 CTP synthase 0.00e+00 5.62e-70 0.0 0.9759
1. PBF A8FJJ0 CTP synthase 0.00e+00 5.04e-74 0.0 0.9638
1. PBF A2CDX8 CTP synthase 0.00e+00 5.56e-62 0.0 0.9738
1. PBF Q3A371 CTP synthase 0.00e+00 5.97e-77 0.0 0.9717
1. PBF Q0SI74 CTP synthase 0.00e+00 8.07e-51 1.70e-179 0.9672
1. PBF Q98PQ3 CTP synthase 0.00e+00 3.33e-59 4.53e-164 0.9702
1. PBF Q14J73 CTP synthase 0.00e+00 1.30e-76 0.0 0.9708
1. PBF A4VJT9 CTP synthase 0.00e+00 2.00e-70 0.0 0.9671
1. PBF Q8G5X7 CTP synthase 0.00e+00 1.50e-70 7.94e-178 0.9738
1. PBF Q9HM27 CTP synthase 0.00e+00 4.33e-64 3.51e-162 0.9507
1. PBF Q1J4X1 CTP synthase 0.00e+00 2.14e-80 0.0 0.9894
1. PBF A3PFH8 CTP synthase 0.00e+00 1.89e-81 0.0 0.9864
1. PBF B7JVR6 CTP synthase 0.00e+00 3.76e-74 0.0 0.9776
1. PBF Q630R0 CTP synthase 0.00e+00 5.22e-84 0.0 0.9831
1. PBF A5F5I4 CTP synthase 0.00e+00 6.46e-73 0.0 0.967
1. PBF A1TA81 CTP synthase 0.00e+00 2.55e-55 6.94e-179 0.9709
1. PBF Q65DT7 CTP synthase 0.00e+00 3.84e-83 0.0 0.983
1. PBF A0M3I8 CTP synthase 0.00e+00 4.05e-73 5.41e-179 0.9781
1. PBF Q980S6 CTP synthase 0.00e+00 3.93e-65 2.78e-175 0.968
1. PBF Q7UJ86 CTP synthase 0.00e+00 5.81e-68 0.0 0.9815
1. PBF A0B7H6 CTP synthase 0.00e+00 3.04e-69 5.36e-168 0.9545
1. PBF A6ZQ59 CTP synthase 2 0.00e+00 8.33e-62 4.31e-149 0.9428
1. PBF Q8R720 CTP synthase 0.00e+00 2.01e-81 0.0 0.9811
1. PBF Q83IC4 CTP synthase 0.00e+00 1.47e-67 2.56e-174 0.9577
1. PBF Q2NK04 CTP synthase 0.00e+00 7.36e-77 0.0 0.9782
1. PBF Q0VQD8 CTP synthase 0.00e+00 9.12e-75 3.02e-178 0.9703
1. PBF Q110M9 CTP synthase 0.00e+00 1.12e-61 0.0 0.9713
1. PBF A6QIX1 CTP synthase 0.00e+00 2.71e-82 0.0 0.9801
1. PBF Q7N836 CTP synthase 0.00e+00 1.15e-73 1.02e-169 0.9681
1. PBF B1LQB3 CTP synthase 0.00e+00 2.85e-73 0.0 0.9747
1. PBF Q5YY90 CTP synthase 0.00e+00 8.78e-63 3.75e-176 0.9662
1. PBF B4RVU4 CTP synthase 0.00e+00 3.15e-67 0.0 0.9701
1. PBF A5FHA4 CTP synthase 0.00e+00 1.21e-77 9.70e-176 0.9766
1. PBF B0VQI6 CTP synthase 0.00e+00 7.55e-76 7.41e-177 0.9682
1. PBF B7VK69 CTP synthase 0.00e+00 3.61e-72 0.0 0.9651
1. PBF Q3AUG4 CTP synthase 0.00e+00 2.10e-68 0.0 0.9852
1. PBF Q3Z6N1 CTP synthase 0.00e+00 1.05e-75 0.0 0.977
1. PBF B4RBW5 CTP synthase 0.00e+00 3.59e-76 3.96e-157 0.9638
1. PBF Q3KMH9 CTP synthase 0.00e+00 2.91e-70 2.38e-164 0.9689
1. PBF A1US92 CTP synthase 0.00e+00 2.34e-75 2.53e-161 0.9701
1. PBF B7JHG1 CTP synthase 0.00e+00 5.22e-84 0.0 0.9881
1. PBF A8YY92 CTP synthase 0.00e+00 2.71e-82 0.0 0.9789
1. PBF C0MFQ9 CTP synthase 0.00e+00 1.22e-79 0.0 0.9877
1. PBF A1UH74 CTP synthase 0.00e+00 7.22e-57 0.0 0.9724
1. PBF Q9RU23 CTP synthase 0.00e+00 4.83e-76 1.42e-171 0.9655
1. PBF Q8SQI7 CTP synthase 0.00e+00 8.18e-67 8.47e-117 0.9325
1. PBF Q7ZXP9 CTP synthase 1-B 0.00e+00 2.27e-44 1.59e-164 0.957
1. PBF B7H225 CTP synthase 0.00e+00 7.55e-76 7.41e-177 0.9606
1. PBF Q4QLL2 CTP synthase 0.00e+00 5.92e-73 0.0 0.9767
1. PBF A2BZ76 CTP synthase 0.00e+00 4.34e-81 0.0 0.9758
1. PBF Q6AGG5 CTP synthase 0.00e+00 1.47e-62 3.48e-180 0.9768
1. PBF A5IUS2 CTP synthase 0.00e+00 2.71e-82 0.0 0.9815
1. PBF B9DME0 CTP synthase 0.00e+00 1.66e-78 0.0 0.983
1. PBF B5BF03 CTP synthase 0.00e+00 1.55e-72 0.0 0.9721
1. PBF B7N716 CTP synthase 0.00e+00 2.85e-73 0.0 0.9727
1. PBF B1JUY8 CTP synthase 0.00e+00 4.42e-73 7.18e-173 0.9688
1. PBF Q9ZDF1 CTP synthase 0.00e+00 1.29e-53 5.66e-162 0.9683
1. PBF Q57D05 CTP synthase 0.00e+00 8.76e-76 6.49e-164 0.9676
1. PBF Q215B2 CTP synthase 0.00e+00 7.14e-77 2.97e-164 0.9641
1. PBF Q9PKL0 CTP synthase 0.00e+00 1.46e-74 1.20e-162 0.9633
1. PBF B5RDS6 CTP synthase 0.00e+00 1.38e-72 0.0 0.9724
1. PBF Q1GTY6 CTP synthase 0.00e+00 4.04e-76 1.56e-169 0.9603
1. PBF O83327 CTP synthase 0.00e+00 2.64e-63 1.05e-173 0.9782
1. PBF B2HR69 CTP synthase 0.00e+00 3.35e-54 0.0 0.9752
1. PBF Q8D2K0 CTP synthase 0.00e+00 2.51e-76 4.01e-176 0.9709
1. PBF Q9K6D7 CTP synthase 0.00e+00 7.48e-80 0.0 0.98
1. PBF A6VR01 CTP synthase 0.00e+00 6.14e-68 0.0 0.9632
1. PBF B8IZF5 CTP synthase 0.00e+00 4.69e-77 4.57e-176 0.9697
1. PBF O87761 CTP synthase 0.00e+00 1.69e-75 0.0 0.9863
1. PBF B0U0L7 CTP synthase 0.00e+00 1.29e-75 0.0 0.9721
1. PBF A5CYA0 CTP synthase 0.00e+00 1.49e-84 0.0 0.9809
1. PBF B5Z3E4 CTP synthase 0.00e+00 2.85e-73 0.0 0.9745
1. PBF A4SXE7 CTP synthase 0.00e+00 2.28e-74 7.66e-170 0.9667
1. PBF B5ZPZ7 CTP synthase 0.00e+00 8.45e-80 1.39e-164 0.9674
1. PBF B3EAK5 CTP synthase 0.00e+00 4.79e-79 9.63e-179 0.9711
1. PBF Q4JVX2 CTP synthase 0.00e+00 2.71e-68 0.0 0.9672
1. PBF C4K4K0 CTP synthase 0.00e+00 1.74e-75 1.71e-174 0.9742
1. PBF A1W4R3 CTP synthase 0.00e+00 1.84e-70 1.36e-180 0.9702
1. PBF B0CGT4 CTP synthase 0.00e+00 8.01e-76 2.01e-164 0.9671
1. PBF A9BN39 CTP synthase 0.00e+00 2.14e-72 1.53e-180 0.9764
1. PBF B7KUU9 CTP synthase 0.00e+00 5.05e-75 1.68e-166 0.9627
1. PBF A2C5F9 CTP synthase 0.00e+00 5.48e-65 0.0 0.9769
1. PBF B0BS41 CTP synthase 0.00e+00 6.49e-70 0.0 0.976
1. PBF P65922 CTP synthase 0.00e+00 1.38e-72 0.0 0.9722
1. PBF Q89KU5 CTP synthase 0.00e+00 5.05e-75 6.12e-166 0.9641
1. PBF B4TFZ2 CTP synthase 0.00e+00 1.38e-72 0.0 0.9722
1. PBF A6U8E2 CTP synthase 0.00e+00 1.99e-78 3.99e-163 0.9647
1. PBF Q9PQK7 Putative CTP synthase 0.00e+00 3.67e-42 1.49e-124 0.946
1. PBF Q97CR8 CTP synthase 0.00e+00 4.29e-67 4.09e-156 0.9545
1. PBF Q0AU97 CTP synthase 0.00e+00 1.15e-79 0.0 0.989
1. PBF Q254V9 CTP synthase 0.00e+00 6.38e-74 1.76e-164 0.9655
1. PBF Q751L7 CTP synthase 0.00e+00 4.51e-65 3.16e-156 0.9442
1. PBF A0PPA8 CTP synthase 0.00e+00 7.46e-55 0.0 0.9749
1. PBF Q6N5T4 CTP synthase 0.00e+00 1.05e-76 8.21e-166 0.9627
1. PBF A9WJ75 CTP synthase 0.00e+00 5.03e-71 0.0 0.9741
1. PBF B1XDJ0 CTP synthase 0.00e+00 2.85e-73 0.0 0.9745
1. PBF B4UIT6 CTP synthase 0.00e+00 1.03e-62 0.0 0.9663
1. PBF Q18FG3 CTP synthase 0.00e+00 2.46e-62 4.38e-172 0.9515
1. PBF Q6MD01 CTP synthase 0.00e+00 8.60e-75 5.82e-172 0.9712
1. PBF A7MQY9 CTP synthase 0.00e+00 1.64e-70 0.0 0.977
1. PBF P52200 CTP synthase 0.00e+00 9.62e-79 0.0 0.9843
1. PBF Q3IS15 CTP synthase 0.00e+00 2.67e-62 4.50e-175 0.9586
1. PBF Q4L808 CTP synthase 0.00e+00 1.65e-82 0.0 0.9826
1. PBF Q7VNV5 CTP synthase 0.00e+00 3.82e-73 0.0 0.974
1. PBF A9M5E7 CTP synthase 0.00e+00 8.76e-76 8.62e-163 0.9649
1. PBF Q54775 CTP synthase 0.00e+00 1.73e-73 0.0 0.9759
1. PBF Q31XL0 CTP synthase 0.00e+00 2.85e-73 0.0 0.9745
1. PBF C5B8X3 CTP synthase 0.00e+00 1.85e-74 0.0 0.9758
1. PBF Q1CUG1 CTP synthase 0.00e+00 1.12e-73 1.97e-161 0.9552
1. PBF C3LFL2 CTP synthase 0.00e+00 6.11e-84 0.0 0.9832
1. PBF Q7V9I0 CTP synthase 0.00e+00 6.90e-71 0.0 0.9742
1. PBF Q6G7I3 CTP synthase 0.00e+00 2.71e-82 0.0 0.98
1. PBF A5WG19 CTP synthase 0.00e+00 1.45e-75 1.25e-177 0.9724
1. PBF A4SCI7 CTP synthase 0.00e+00 1.21e-41 3.21e-171 0.9739
1. PBF A4YVC9 CTP synthase 0.00e+00 1.23e-74 3.68e-165 0.97
1. PBF Q8DC63 CTP synthase 0.00e+00 5.31e-70 0.0 0.9663
1. PBF A8AZ08 CTP synthase 0.00e+00 3.18e-77 0.0 0.9864
1. PBF B5FAG0 CTP synthase 0.00e+00 1.82e-69 0.0 0.9784
1. PBF O29987 CTP synthase 0.00e+00 1.38e-76 2.99e-177 0.9589
1. PBF B4RJ40 CTP synthase 0.00e+00 1.02e-67 0.0 0.97
1. PBF Q30NS7 CTP synthase 0.00e+00 3.44e-74 8.63e-168 0.9659
1. PBF B2VFY9 CTP synthase 0.00e+00 2.54e-72 0.0 0.9766
1. PBF B2I2A7 CTP synthase 0.00e+00 5.62e-77 3.73e-177 0.9591
1. PBF A9B6S7 CTP synthase 0.00e+00 2.74e-81 0.0 0.9857
1. PBF A4XWS3 CTP synthase 0.00e+00 7.97e-71 0.0 0.9674
1. PBF A5VQQ9 CTP synthase 0.00e+00 8.01e-76 6.85e-164 0.9663
1. PBF Q0C195 CTP synthase 0.00e+00 5.20e-74 2.50e-164 0.9661
1. PBF Q5WXA8 CTP synthase 0.00e+00 1.68e-71 1.69e-172 0.9694
1. PBF B3QRL0 CTP synthase 0.00e+00 1.03e-62 5.62e-177 0.9729
1. PBF A8FSS7 CTP synthase 0.00e+00 2.79e-75 0.0 0.967
1. PBF B8F5Q9 CTP synthase 0.00e+00 4.29e-67 0.0 0.9725
1. PBF Q11HU6 CTP synthase 0.00e+00 1.85e-77 6.60e-173 0.9713
1. PBF B2S2Q3 CTP synthase 0.00e+00 2.64e-63 1.05e-173 0.9704
1. PBF B8GAQ5 CTP synthase 0.00e+00 2.16e-68 0.0 0.9749
1. PBF Q6FAT7 CTP synthase 0.00e+00 8.05e-77 2.93e-175 0.9591
1. PBF B4U6A9 CTP synthase 0.00e+00 2.70e-72 0.0 0.9648
1. PBF Q2GCQ2 CTP synthase 0.00e+00 1.03e-71 7.50e-163 0.9461
1. PBF Q9ZM99 CTP synthase 0.00e+00 3.44e-74 6.79e-161 0.9568
1. PBF Q3AFT7 CTP synthase 0.00e+00 1.88e-83 0.0 0.9836
1. PBF Q5GTB4 CTP synthase 0.00e+00 6.89e-79 2.79e-173 0.9603
1. PBF Q8NZF8 CTP synthase 0.00e+00 2.73e-80 0.0 0.9897
1. PBF Q2SKX2 CTP synthase 0.00e+00 4.76e-74 0.0 0.9681
1. PBF Q6D181 CTP synthase 0.00e+00 2.14e-72 0.0 0.9733
1. PBF Q8ZSY7 CTP synthase 0.00e+00 4.40e-69 1.43e-166 0.976
1. PBF Q1IKC9 CTP synthase 0.00e+00 1.65e-64 0.0 0.9721
1. PBF Q9HP32 CTP synthase 0.00e+00 8.19e-59 3.73e-171 0.954
1. PBF Q48965 CTP synthase 0.00e+00 4.83e-111 0.0 0.9991
1. PBF O59456 CTP synthase 0.00e+00 1.95e-75 0.0 0.9733
1. PBF A2BTS1 CTP synthase 0.00e+00 7.78e-81 0.0 0.9749
1. PBF B9L1H7 CTP synthase 0.00e+00 7.43e-66 0.0 0.9702
1. PBF A3PLA0 CTP synthase 0.00e+00 2.63e-75 2.56e-162 0.9675
1. PBF B5EPM5 CTP synthase 0.00e+00 4.48e-71 5.97e-168 0.9731
1. PBF Q9Z8U8 CTP synthase 0.00e+00 6.59e-75 1.54e-159 0.9707
1. PBF Q63SP8 CTP synthase 0.00e+00 5.57e-72 9.19e-171 0.9686
1. PBF Q7MWR7 CTP synthase 0.00e+00 6.20e-74 1.50e-179 0.9762
1. PBF Q0A7K2 CTP synthase 0.00e+00 3.27e-77 0.0 0.9685
1. PBF P65925 CTP synthase 0.00e+00 1.09e-80 0.0 0.9891
1. PBF B2SFK1 CTP synthase 0.00e+00 1.50e-75 0.0 0.9691
1. PBF B2A3K5 CTP synthase 0.00e+00 1.10e-83 0.0 0.9793
1. PBF B1W203 CTP synthase 0.00e+00 8.70e-69 1.19e-174 0.9688
1. PBF Q3JQQ4 CTP synthase 0.00e+00 5.57e-72 9.19e-171 0.9712
1. PBF Q5FFC3 CTP synthase 0.00e+00 1.86e-76 5.47e-168 0.9687
1. PBF A5W831 CTP synthase 0.00e+00 4.82e-73 0.0 0.9748
1. PBF A3QC76 CTP synthase 0.00e+00 1.80e-76 0.0 0.9782
1. PBF A4WDW8 CTP synthase 0.00e+00 5.21e-69 0.0 0.9721
1. PBF A9VSD6 CTP synthase 0.00e+00 3.17e-84 0.0 0.9882
1. PBF Q03T27 CTP synthase 0.00e+00 4.92e-83 0.0 0.9822
1. PBF B7KF08 CTP synthase 0.00e+00 1.01e-65 0.0 0.9796
1. PBF A1K7F8 CTP synthase 0.00e+00 4.11e-78 0.0 0.9679
1. PBF B8DJR8 CTP synthase 0.00e+00 9.03e-76 6.98e-179 0.9685
1. PBF A6V1F1 CTP synthase 0.00e+00 6.68e-70 0.0 0.9681
1. PBF Q6HAU5 CTP synthase 0.00e+00 7.84e-84 0.0 0.9832
1. PBF Q814T2 CTP synthase 0.00e+00 6.92e-84 0.0 0.9827
1. PBF Q72BL2 CTP synthase 0.00e+00 1.46e-76 1.96e-176 0.9686
1. PBF P44341 CTP synthase 0.00e+00 2.53e-73 0.0 0.9729
1. PBF P57491 CTP synthase 0.00e+00 1.91e-77 0.0 0.9752
1. PBF Q9PDU1 CTP synthase 0.00e+00 1.13e-63 0.0 0.9669
1. PBF Q1R7R3 CTP synthase 0.00e+00 2.85e-73 0.0 0.9729
1. PBF Q1H009 CTP synthase 0.00e+00 4.36e-78 0.0 0.9707
1. PBF A6SXG2 CTP synthase 0.00e+00 1.06e-68 5.49e-171 0.9617
1. PBF A8YXF8 CTP synthase 0.00e+00 9.94e-85 0.0 0.9811
1. PBF Q8Y0B8 CTP synthase 0.00e+00 2.33e-72 4.73e-177 0.9664
1. PBF C4ZZT3 CTP synthase 0.00e+00 2.85e-73 0.0 0.9726
1. PBF Q46I97 CTP synthase 0.00e+00 1.01e-64 0.0 0.9863
1. PBF B4SAT4 CTP synthase 0.00e+00 8.09e-63 4.86e-175 0.9709
1. PBF A9N2F5 CTP synthase 0.00e+00 1.38e-72 0.0 0.9724
1. PBF B0CBC7 CTP synthase 0.00e+00 1.16e-65 0.0 0.98
1. PBF B2SUA3 CTP synthase 0.00e+00 1.19e-65 0.0 0.9732
1. PBF Q4FM39 CTP synthase 0.00e+00 3.22e-78 0.0 0.9663
1. PBF A9KYH1 CTP synthase 0.00e+00 5.84e-74 0.0 0.9698
1. PBF A7IA93 CTP synthase 0.00e+00 3.04e-69 2.23e-169 0.9468
1. PBF Q8TZY6 CTP synthase 0.00e+00 1.12e-74 0.0 0.9709
1. PBF B9L7R9 CTP synthase 0.00e+00 1.22e-79 1.87e-171 0.9698
1. PBF B6J4W8 CTP synthase 0.00e+00 3.80e-62 0.0 0.9749
1. PBF Q136D7 CTP synthase 0.00e+00 7.28e-78 9.09e-169 0.9681
1. PBF B0BXB3 CTP synthase 0.00e+00 1.70e-79 6.31e-166 0.9713
1. PBF Q3ZYU1 CTP synthase 0.00e+00 1.50e-75 0.0 0.9762
1. PBF A7HIF0 CTP synthase 0.00e+00 1.03e-62 0.0 0.9695
1. PBF A8ANY8 CTP synthase 0.00e+00 8.91e-73 0.0 0.9766
1. PBF Q47DH9 CTP synthase 0.00e+00 6.13e-76 0.0 0.9723
1. PBF B0TK03 CTP synthase 0.00e+00 1.84e-73 0.0 0.9709
1. PBF P9WHK6 CTP synthase 0.00e+00 7.86e-52 6.63e-180 0.966
1. PBF B2U9C0 CTP synthase 0.00e+00 1.41e-73 5.13e-178 0.966
1. PBF B8EJS8 CTP synthase 0.00e+00 1.80e-76 7.84e-158 0.9651
1. PBF Q6MUA3 CTP synthase 0.00e+00 4.15e-116 0.0 0.9946
1. PBF Q2RFU8 CTP synthase 0.00e+00 2.71e-84 0.0 0.9787
1. PBF Q8YMD4 CTP synthase 0.00e+00 5.85e-75 0.0 0.9805
1. PBF Q1B7T3 CTP synthase 0.00e+00 7.22e-57 0.0 0.9736
1. PBF Q2M197 CTP synthase 0.00e+00 7.26e-17 7.47e-152 0.9553
1. PBF Q886M5 CTP synthase 0.00e+00 1.06e-71 0.0 0.9685
1. PBF Q1JF16 CTP synthase 0.00e+00 1.44e-80 0.0 0.9892
1. PBF A5UD28 CTP synthase 0.00e+00 1.41e-73 0.0 0.9708
1. PBF Q8DKT7 CTP synthase 0.00e+00 7.26e-73 0.0 0.9802
1. PBF A5N3K4 CTP synthase 0.00e+00 2.14e-81 0.0 0.9889
1. PBF C6DDJ6 CTP synthase 0.00e+00 4.42e-72 0.0 0.9701
1. PBF Q9CJW9 CTP synthase 0.00e+00 3.61e-72 0.0 0.9704
1. PBF C4LIF4 CTP synthase 0.00e+00 6.19e-69 0.0 0.9687
1. PBF A8MB89 CTP synthase 0.00e+00 7.92e-68 5.01e-171 0.9636
1. PBF Q66ED9 CTP synthase 0.00e+00 2.69e-73 0.0 0.9729
1. PBF Q5SIA8 CTP synthase 0.00e+00 2.31e-67 5.48e-175 0.9716
1. PBF Q6G027 CTP synthase 0.00e+00 2.53e-78 1.07e-160 0.966
1. PBF C1DSS8 CTP synthase 0.00e+00 1.19e-70 0.0 0.9681
1. PBF B7LEK0 CTP synthase 0.00e+00 2.85e-73 0.0 0.9721
1. PBF B0B9T3 CTP synthase 0.00e+00 3.60e-69 2.05e-163 0.9711
1. PBF Q7NSG9 CTP synthase 0.00e+00 4.17e-73 0.0 0.9696
1. PBF Q829A7 CTP synthase 0.00e+00 4.68e-72 1.92e-173 0.9597
1. PBF C1F0R6 CTP synthase 0.00e+00 7.84e-84 0.0 0.9882
1. PBF B6IQ27 CTP synthase 0.00e+00 1.59e-77 1.29e-163 0.9567
1. PBF B3QWC0 CTP synthase 0.00e+00 4.79e-69 0.0 0.9735
1. PBF Q3IDM3 CTP synthase 0.00e+00 2.35e-68 1.15e-169 0.9738
1. PBF B0V675 CTP synthase 0.00e+00 7.55e-76 7.41e-177 0.9591
1. PBF A7ZQM3 CTP synthase 0.00e+00 2.85e-73 0.0 0.9724
1. PBF O26519 CTP synthase 0.00e+00 1.87e-68 2.24e-178 0.97
1. PBF Q1MR71 CTP synthase 0.00e+00 8.55e-77 5.75e-174 0.9714
1. PBF B3Q6M4 CTP synthase 0.00e+00 1.05e-76 8.21e-166 0.9633
1. PBF Q0TE79 CTP synthase 0.00e+00 2.85e-73 0.0 0.972
1. PBF Q48RF1 CTP synthase 0.00e+00 1.23e-80 0.0 0.9893
1. PBF Q97F61 CTP synthase 0.00e+00 4.77e-83 0.0 0.9816
1. PBF C5A7F1 CTP synthase 0.00e+00 8.29e-77 0.0 0.9723
1. PBF Q5ZWA4 CTP synthase 0.00e+00 7.11e-71 2.42e-172 0.9709
1. PBF Q2S538 CTP synthase 0.00e+00 2.40e-60 0.0 0.9752
1. PBF Q168S7 CTP synthase 0.00e+00 5.36e-75 4.83e-166 0.9638
1. PBF Q28MG4 CTP synthase 0.00e+00 6.02e-74 1.32e-162 0.9656
1. PBF B7LXJ6 CTP synthase 0.00e+00 2.85e-73 0.0 0.9728
1. PBF Q0SQX5 CTP synthase 0.00e+00 8.78e-79 0.0 0.979
1. PBF Q5FME6 CTP synthase 0.00e+00 2.08e-81 0.0 0.981
1. PBF Q7UZH7 CTP synthase 0.00e+00 1.39e-80 0.0 0.9869
1. PBF Q0KCE5 CTP synthase 0.00e+00 6.91e-76 2.84e-178 0.9672
1. PBF Q47QN2 CTP synthase 0.00e+00 2.81e-67 0.0 0.9733
1. PBF Q4UTN9 CTP synthase 0.00e+00 4.12e-62 0.0 0.9734
1. PBF Q1JK23 CTP synthase 0.00e+00 1.09e-80 0.0 0.9892
1. PBF A5GPM2 CTP synthase 0.00e+00 3.14e-75 0.0 0.9751
1. PBF Q1QZX9 CTP synthase 0.00e+00 6.69e-68 0.0 0.9685
1. PBF Q38V48 CTP synthase 0.00e+00 1.14e-83 0.0 0.9871
1. PBF A7MTS6 CTP synthase 0.00e+00 5.79e-70 0.0 0.9723
1. PBF Q6A7X4 CTP synthase 0.00e+00 1.55e-61 0.0 0.9736
1. PBF Q8Q0L8 CTP synthase 0.00e+00 3.64e-78 2.98e-178 0.9681
1. PBF A8G9W0 CTP synthase 0.00e+00 3.99e-70 4.57e-180 0.9705
1. PBF Q8UEY5 CTP synthase 0.00e+00 5.39e-81 1.06e-164 0.9651
1. PBF Q8ZBN1 CTP synthase 0.00e+00 2.69e-73 0.0 0.9777
1. PBF B2RKS1 CTP synthase 0.00e+00 1.73e-73 1.89e-179 0.9788
1. PBF A4IZP3 CTP synthase 0.00e+00 1.30e-76 0.0 0.9706
1. PBF Q5LC42 CTP synthase 0.00e+00 1.50e-75 0.0 0.974
1. PBF A3M5Y3 CTP synthase 0.00e+00 7.55e-76 7.41e-177 0.9595
1. PBF Q8P9Z6 CTP synthase 0.00e+00 4.12e-62 0.0 0.9737
1. PBF A8FIE5 CTP synthase 0.00e+00 1.73e-81 0.0 0.9834
1. PBF Q493N6 CTP synthase 0.00e+00 3.82e-73 2.66e-178 0.9766
1. PBF Q7MAI3 CTP synthase 0.00e+00 3.20e-73 2.00e-159 0.9668
1. PBF A5UIK2 CTP synthase 0.00e+00 4.97e-73 0.0 0.9766
1. PBF B6YTF0 CTP synthase 0.00e+00 1.42e-76 0.0 0.9732
1. PBF Q0BTX6 CTP synthase 0.00e+00 1.05e-76 3.14e-168 0.9636
1. PBF P65921 CTP synthase 0.00e+00 1.38e-72 0.0 0.9721
1. PBF O67353 CTP synthase 0.00e+00 5.78e-76 0.0 0.9711
1. PBF A5FPS8 CTP synthase 0.00e+00 1.50e-75 0.0 0.9768
1. PBF Q72S46 CTP synthase 0.00e+00 6.26e-78 0.0 0.9777
1. PBF Q5HE73 CTP synthase 0.00e+00 2.71e-82 0.0 0.9812
1. PBF Q9PJ84 CTP synthase 0.00e+00 1.51e-74 0.0 0.961
1. PBF A9N9V5 CTP synthase 0.00e+00 9.80e-62 0.0 0.9749
1. PBF A9BDD9 CTP synthase 0.00e+00 7.66e-63 0.0 0.9863
1. PBF Q87LP9 CTP synthase 0.00e+00 1.74e-72 0.0 0.9712
1. PBF Q1I644 CTP synthase 0.00e+00 4.05e-72 0.0 0.9682
1. PBF P59040 CTP synthase 0.00e+00 2.15e-62 7.76e-178 0.9644
1. PBF Q2Y9P1 CTP synthase 0.00e+00 9.85e-57 6.37e-176 0.9674
1. PBF Q0I677 CTP synthase 0.00e+00 2.04e-60 0.0 0.9856
1. PBF Q92QA0 CTP synthase 0.00e+00 3.86e-78 1.23e-163 0.9652
1. PBF C1ASX9 CTP synthase 0.00e+00 7.68e-51 3.02e-178 0.9737
1. PBF B7I920 CTP synthase 0.00e+00 7.55e-76 7.41e-177 0.9689
1. PBF Q2RT58 CTP synthase 0.00e+00 1.82e-78 1.81e-166 0.9628
1. PBF B1IU61 CTP synthase 0.00e+00 2.85e-73 0.0 0.9725
1. PBF A7Z9T4 CTP synthase 0.00e+00 3.87e-85 0.0 0.9837
1. PBF A6WR29 CTP synthase 0.00e+00 5.84e-74 0.0 0.9784
1. PBF Q5F3Z1 CTP synthase 2 0.00e+00 3.33e-41 7.28e-157 0.9574
1. PBF B1JBP2 CTP synthase 0.00e+00 5.20e-74 0.0 0.9681
1. PBF Q8EBQ9 CTP synthase 0.00e+00 1.06e-74 0.0 0.976
1. PBF A3MXN2 CTP synthase 0.00e+00 6.40e-75 3.07e-176 0.9734
1. PBF A9HJ81 CTP synthase 0.00e+00 1.65e-76 4.82e-170 0.9671
1. PBF Q8YHF2 CTP synthase 0.00e+00 1.11e-75 3.94e-164 0.9709
1. PBF Q1RHU4 CTP synthase 0.00e+00 5.79e-77 3.95e-167 0.9722
1. PBF B8D9J4 CTP synthase 0.00e+00 1.21e-77 0.0 0.9703
1. PBF A1VXA6 CTP synthase 0.00e+00 6.03e-75 0.0 0.9703
1. PBF Q0HXH1 CTP synthase 0.00e+00 3.20e-73 0.0 0.9788
1. PBF A0K8N3 CTP synthase 0.00e+00 2.69e-73 1.47e-173 0.9688
1. PBF A7X4X7 CTP synthase 0.00e+00 2.71e-82 0.0 0.9821
1. PBF Q81JW1 CTP synthase 0.00e+00 6.11e-84 0.0 0.9834
1. PBF Q73HS5 CTP synthase 0.00e+00 5.55e-78 0.0 0.9702
1. PBF Q4ULX9 CTP synthase 0.00e+00 8.20e-80 6.86e-167 0.9723
1. PBF Q64T27 CTP synthase 0.00e+00 1.50e-75 0.0 0.9746
1. PBF Q5F7G6 CTP synthase 0.00e+00 1.02e-67 0.0 0.9696
1. PBF A2SAU5 CTP synthase 0.00e+00 3.93e-72 8.71e-171 0.9712
1. PBF A1AEW8 CTP synthase 0.00e+00 2.85e-73 0.0 0.9748
1. PBF B9M9Q5 CTP synthase 0.00e+00 9.16e-83 3.94e-175 0.9733
1. PBF Q5L5S1 CTP synthase 0.00e+00 1.86e-76 1.32e-160 0.9691
1. PBF B5Y8A3 CTP synthase 0.00e+00 2.64e-74 0.0 0.9681
1. PBF Q1AW18 CTP synthase 0.00e+00 5.03e-66 0.0 0.9724
1. PBF Q24MK9 CTP synthase 0.00e+00 1.81e-82 0.0 0.9793
1. PBF G0HV10 CTP synthase 0.00e+00 2.44e-63 2.49e-174 0.9542
1. PBF Q8TKW5 CTP synthase 0.00e+00 9.91e-79 5.55e-180 0.9619
1. PBF B7J6R2 CTP synthase 0.00e+00 4.48e-71 5.97e-168 0.9738
1. PBF B7NV70 CTP synthase 0.00e+00 2.85e-73 0.0 0.9722
1. PBF Q87DY8 CTP synthase 0.00e+00 9.02e-63 0.0 0.9749
1. PBF Q3B6P1 CTP synthase 0.00e+00 6.85e-38 4.57e-175 0.9718
1. PBF Q12WH5 CTP synthase 0.00e+00 1.95e-80 5.61e-178 0.9631
1. PBF P13242 CTP synthase 0.00e+00 2.04e-84 0.0 0.9834
1. PBF A1SSQ6 CTP synthase 0.00e+00 1.50e-73 0.0 0.9656
1. PBF Q1J9X6 CTP synthase 0.00e+00 1.09e-80 0.0 0.9899
1. PBF Q6YPW4 CTP synthase 0.00e+00 7.97e-78 0.0 0.9826
1. PBF Q88MG1 CTP synthase 0.00e+00 4.82e-73 0.0 0.9679
1. PBF B4T484 CTP synthase 0.00e+00 1.46e-72 0.0 0.9769
1. PBF Q9V1S2 CTP synthase 0.00e+00 4.98e-76 0.0 0.9708
1. PBF Q6G410 CTP synthase 0.00e+00 7.61e-74 5.06e-163 0.9654
1. PBF A7FLZ6 CTP synthase 0.00e+00 2.69e-73 0.0 0.9711
1. PBF Q3YY76 CTP synthase 0.00e+00 2.85e-73 0.0 0.975
1. PBF Q6GME1 CTP synthase 2 0.00e+00 2.68e-49 2.48e-161 0.9512
1. PBF A5FXW7 CTP synthase 0.00e+00 2.96e-75 8.64e-162 0.9624
1. PBF Q02RA9 CTP synthase 0.00e+00 6.68e-70 0.0 0.9683
1. PBF P0DD70 CTP synthase 0.00e+00 1.09e-80 0.0 0.9891
1. PBF Q2P1K5 CTP synthase 0.00e+00 1.19e-65 0.0 0.9733
1. PBF Q0AD92 CTP synthase 0.00e+00 4.70e-59 4.90e-176 0.9712
1. PBF B5FTV0 CTP synthase 0.00e+00 1.38e-72 0.0 0.9721
1. PBF B2IKQ2 CTP synthase 0.00e+00 1.12e-71 4.97e-159 0.9642
1. PBF A5UXX5 CTP synthase 0.00e+00 1.03e-61 0.0 0.9834
1. PBF Q1QMJ4 CTP synthase 0.00e+00 6.45e-78 5.86e-166 0.9676
1. PBF Q5KUG2 CTP synthase 0.00e+00 1.89e-80 0.0 0.9804
1. PBF Q8XIB3 CTP synthase 0.00e+00 8.78e-79 0.0 0.9789
1. PBF B8HNM9 CTP synthase 0.00e+00 4.79e-69 0.0 0.9872
1. PBF Q39W62 CTP synthase 0.00e+00 1.99e-78 0.0 0.9709
1. PBF B5XV18 CTP synthase 0.00e+00 6.90e-71 0.0 0.9731
1. PBF A1RHF2 CTP synthase 0.00e+00 7.61e-74 0.0 0.9703
1. PBF Q21V39 CTP synthase 0.00e+00 1.33e-68 7.28e-173 0.9708
1. PBF Q6L1K7 CTP synthase 0.00e+00 1.69e-66 1.29e-165 0.9527
1. PBF Q7V3W8 CTP synthase 0.00e+00 4.60e-62 0.0 0.9844
1. PBF Q2YPU8 CTP synthase 0.00e+00 8.76e-76 6.49e-164 0.966
1. PBF B2JIX2 CTP synthase 0.00e+00 3.20e-73 9.00e-174 0.9713
1. PBF A0RLC3 CTP synthase 0.00e+00 7.84e-84 0.0 0.9817
1. PBF B9KHF1 CTP synthase 0.00e+00 7.09e-55 2.04e-158 0.9626
1. PBF Q317V2 CTP synthase 0.00e+00 2.99e-80 0.0 0.9788
1. PBF Q5HC60 CTP synthase 0.00e+00 5.72e-78 1.49e-166 0.9675
1. PBF Q0BDS1 CTP synthase 0.00e+00 7.93e-73 1.31e-172 0.9684
1. PBF Q9CI75 CTP synthase 0.00e+00 4.55e-76 0.0 0.988
1. PBF Q5PEJ0 CTP synthase 0.00e+00 1.55e-72 0.0 0.9722
1. PBF A6U3L2 CTP synthase 0.00e+00 2.71e-82 0.0 0.9791
1. PBF Q2J878 CTP synthase 0.00e+00 1.09e-30 0.0 0.9677
1. PBF Q8AA75 CTP synthase 0.00e+00 1.80e-74 1.32e-178 0.9741
1. PBF A8A3R5 CTP synthase 0.00e+00 2.85e-73 0.0 0.9747
1. PBF B4SR82 CTP synthase 0.00e+00 6.33e-63 3.04e-176 0.9752
1. PBF Q98MF0 CTP synthase 0.00e+00 7.55e-79 1.36e-162 0.9673
1. PBF A1S4D6 CTP synthase 0.00e+00 4.69e-73 0.0 0.9791
1. PBF A7ND08 CTP synthase 0.00e+00 2.58e-77 0.0 0.9707
1. PBF Q71WM0 CTP synthase 0.00e+00 4.34e-81 0.0 0.9816
1. PBF Q2NVN8 CTP synthase 0.00e+00 1.84e-73 0.0 0.9777
1. PBF B0SYY1 CTP synthase 0.00e+00 5.42e-73 2.71e-156 0.9669
1. PBF Q97S93 CTP synthase 0.00e+00 1.65e-79 0.0 0.9897
1. PBF A4T9Y6 CTP synthase 0.00e+00 4.10e-53 2.72e-177 0.9736
1. PBF P53529 CTP synthase 0.00e+00 3.56e-48 3.49e-174 0.9685
1. PBF A1WWZ4 CTP synthase 0.00e+00 7.71e-70 0.0 0.9746
1. PBF A0LUA5 CTP synthase 0.00e+00 7.43e-65 2.45e-177 0.9682
1. PBF B2SXV1 CTP synthase 0.00e+00 1.29e-68 1.73e-173 0.9723
1. PBF B7V7V1 CTP synthase 0.00e+00 6.68e-70 0.0 0.9679
1. PBF Q3KH94 CTP synthase 0.00e+00 1.19e-70 0.0 0.9679
1. PBF A6UTE4 CTP synthase 0.00e+00 2.01e-75 0.0 0.9699
1. PBF A7NN90 CTP synthase 0.00e+00 2.10e-60 0.0 0.9832
1. PBF A1SJK4 CTP synthase 0.00e+00 2.04e-62 0.0 0.97
1. PBF A4G738 CTP synthase 0.00e+00 8.18e-67 4.24e-171 0.9698
1. PBF Q8F3J3 CTP synthase 0.00e+00 6.26e-78 0.0 0.9774
1. PBF Q2NAA7 CTP synthase 0.00e+00 1.78e-73 2.35e-170 0.9579
1. PBF Q5M1S7 CTP synthase 0.00e+00 1.02e-79 0.0 0.9893
1. PBF C1CWM4 CTP synthase 0.00e+00 2.28e-68 1.10e-173 0.9625
1. PBF B1XMC5 CTP synthase 0.00e+00 9.21e-69 0.0 0.9787
1. PBF C1DCC1 CTP synthase 0.00e+00 1.18e-75 0.0 0.9741
1. PBF B1WV74 CTP synthase 0.00e+00 6.24e-82 0.0 0.9861
1. PBF A1JJR3 CTP synthase 0.00e+00 1.19e-72 0.0 0.9678
1. PBF Q9S224 CTP synthase 0.00e+00 1.12e-69 1.06e-173 0.969
1. PBF Q7VQH4 CTP synthase 0.00e+00 4.42e-73 7.46e-171 0.9639
1. PBF B8GQ73 CTP synthase 0.00e+00 9.87e-76 0.0 0.9706
1. PBF Q07NF1 CTP synthase 0.00e+00 1.21e-77 1.79e-167 0.9673
1. PBF P0A7E8 CTP synthase 0.00e+00 2.85e-73 0.0 0.973
1. PBF Q0HL73 CTP synthase 0.00e+00 1.19e-74 0.0 0.9689
1. PBF Q88Z76 CTP synthase 0.00e+00 4.87e-82 0.0 0.9871
1. PBF B2FK84 CTP synthase 0.00e+00 7.45e-63 4.73e-177 0.9764
1. PBF B1KPT7 CTP synthase 0.00e+00 2.49e-74 0.0 0.9689
1. PBF Q9JYJ8 CTP synthase 0.00e+00 1.49e-68 0.0 0.9665
1. PBF B0BBG3 CTP synthase 0.00e+00 3.60e-69 2.05e-163 0.9714
1. PBF Q2IWB8 CTP synthase 0.00e+00 6.15e-77 3.41e-166 0.9692
1. PBF A8H1S4 CTP synthase 0.00e+00 3.99e-74 0.0 0.9712
1. PBF C0RJA5 CTP synthase 0.00e+00 8.01e-76 6.85e-164 0.9706
1. PBF Q5JGF1 CTP synthase 0.00e+00 1.37e-77 0.0 0.977
1. PBF Q8G0G1 CTP synthase 0.00e+00 8.76e-76 8.62e-163 0.97
1. PBF A6LQF6 CTP synthase 0.00e+00 1.25e-83 0.0 0.989
1. PBF Q8E7P8 CTP synthase 0.00e+00 1.11e-79 0.0 0.9885
1. PBF Q6FUD0 CTP synthase 0.00e+00 3.31e-58 1.16e-158 0.9475
1. PBF B6J3W7 CTP synthase 0.00e+00 2.09e-62 0.0 0.975
1. PBF P59577 CTP synthase 0.00e+00 2.79e-75 2.20e-178 0.9706
1. PBF Q2W6A0 CTP synthase 0.00e+00 1.46e-77 9.55e-170 0.9722
1. PBF A4JFY7 CTP synthase 0.00e+00 1.90e-72 7.69e-172 0.9682
1. PBF O85347 CTP synthase 0.00e+00 3.39e-58 8.65e-175 0.9736
1. PBF Q5LTV0 CTP synthase 0.00e+00 1.33e-75 5.07e-163 0.9651
1. PBF Q73J84 CTP synthase 0.00e+00 1.01e-82 0.0 0.9764
1. PBF B9LB79 CTP synthase 0.00e+00 5.03e-71 0.0 0.9837
1. PBF B2IUT0 CTP synthase 0.00e+00 1.70e-74 0.0 0.9793
1. PBF B6EKL9 CTP synthase 0.00e+00 1.18e-71 0.0 0.972
1. PBF B2S5Y5 CTP synthase 0.00e+00 1.50e-75 5.95e-164 0.9668
1. PBF B0RUK3 CTP synthase 0.00e+00 4.32e-63 0.0 0.9737
1. PBF Q12PZ5 CTP synthase 0.00e+00 8.82e-74 1.75e-180 0.9714
1. PBF A4Y944 CTP synthase 0.00e+00 7.61e-74 0.0 0.9704
1. PBF C6BWN7 CTP synthase 0.00e+00 6.79e-75 1.76e-177 0.969
1. PBF Q5PBX6 CTP synthase 0.00e+00 6.40e-55 2.62e-158 0.9603
1. PBF B0U802 CTP synthase 0.00e+00 8.29e-77 1.29e-166 0.963
1. PBF A5G5T3 CTP synthase 0.00e+00 1.33e-83 1.64e-180 0.9708
1. PBF Q7MHQ0 CTP synthase 0.00e+00 5.31e-70 0.0 0.9672
1. PBF Q47WQ9 CTP synthase 0.00e+00 1.74e-72 1.58e-180 0.9707
1. PBF B7IQZ1 CTP synthase 0.00e+00 2.98e-84 0.0 0.9832
1. PBF C3P2A0 CTP synthase 0.00e+00 6.11e-84 0.0 0.9835
1. PBF A9IIP5 CTP synthase 0.00e+00 5.61e-76 1.61e-173 0.9677
1. PBF Q1Q9K1 CTP synthase 0.00e+00 1.16e-70 1.74e-177 0.9746
1. PBF Q7RZV2 CTP synthase 0.00e+00 4.32e-54 1.12e-131 0.929
1. PBF Q3SL45 CTP synthase 0.00e+00 2.79e-75 0.0 0.9724
1. PBF Q836G5 CTP synthase 0.00e+00 6.65e-78 0.0 0.9881
1. PBF Q72IN0 CTP synthase 0.00e+00 1.32e-67 4.01e-174 0.9781
1. PBF O74638 CTP synthase 0.00e+00 5.66e-59 6.94e-133 0.9221
1. PBF Q1WV30 CTP synthase 0.00e+00 3.49e-80 0.0 0.9861
1. PBF Q2FSE6 CTP synthase 0.00e+00 3.45e-70 2.12e-156 0.9535
1. PBF Q7VW76 CTP synthase 0.00e+00 2.08e-74 1.01e-173 0.9665
1. PBF Q0T1P8 CTP synthase 0.00e+00 2.85e-73 0.0 0.9723
1. PBF A1V5K4 CTP synthase 0.00e+00 5.57e-72 9.19e-171 0.9683
1. PBF A4QE10 CTP synthase 0.00e+00 6.84e-66 8.42e-167 0.9669
1. PBF P0A7E7 CTP synthase 0.00e+00 2.85e-73 0.0 0.9724
1. PBF B1Y4K6 CTP synthase 0.00e+00 1.85e-67 4.72e-170 0.9694
1. PBF Q8Y495 CTP synthase 0.00e+00 1.67e-81 0.0 0.9815
1. PBF Q72XB0 CTP synthase 0.00e+00 4.20e-84 0.0 0.9832
1. PBF Q9A7K3 CTP synthase 0.00e+00 4.76e-74 2.73e-156 0.9664
1. PBF Q8E290 CTP synthase 0.00e+00 2.11e-79 0.0 0.9887
1. PBF A3CQB0 CTP synthase 0.00e+00 1.97e-77 0.0 0.9868
1. PBF Q2KZF8 CTP synthase 0.00e+00 8.76e-76 7.43e-175 0.9665
1. PBF Q62J08 CTP synthase 0.00e+00 5.57e-72 9.19e-171 0.9677
1. PBF Q1RMS2 CTP synthase 2 0.00e+00 7.63e-45 3.48e-154 0.9565
1. PBF Q3JCT3 CTP synthase 0.00e+00 9.13e-72 0.0 0.9705
1. PBF Q15QR7 CTP synthase 0.00e+00 7.70e-68 3.25e-180 0.9701
1. PBF Q740E5 CTP synthase 0.00e+00 2.83e-52 1.66e-174 0.9672
1. PBF B8GW64 CTP synthase 0.00e+00 4.76e-74 2.73e-156 0.9643
1. PBF Q2A2S0 CTP synthase 0.00e+00 2.58e-77 0.0 0.9706
1. PBF B0KSB7 CTP synthase 0.00e+00 1.30e-72 0.0 0.9755
1. PBF A9IS43 CTP synthase 0.00e+00 5.78e-76 2.22e-162 0.9708
1. PBF Q3BUT3 CTP synthase 0.00e+00 5.33e-65 0.0 0.975
1. PBF B3EE77 CTP synthase 0.00e+00 1.63e-59 4.40e-179 0.9722
1. PBF A9R1D2 CTP synthase 0.00e+00 2.69e-73 0.0 0.9708
1. PBF A1BJR8 CTP synthase 0.00e+00 2.01e-63 1.03e-176 0.9722
1. PBF Q7NKF4 CTP synthase 0.00e+00 4.17e-67 0.0 0.9838
1. PBF A3DGR3 CTP synthase 0.00e+00 5.39e-81 0.0 0.9797
1. PBF Q92I97 CTP synthase 0.00e+00 2.46e-78 3.51e-166 0.9706
1. PBF Q59321 CTP synthase 0.00e+00 4.10e-70 3.20e-164 0.9707
1. PBF P99072 CTP synthase 0.00e+00 2.71e-82 0.0 0.9807
1. PBF A1TZ46 CTP synthase 0.00e+00 2.51e-71 0.0 0.977
1. PBF Q3YSZ0 CTP synthase 0.00e+00 7.55e-81 6.31e-166 0.9674
1. PBF Q3SRJ8 CTP synthase 0.00e+00 4.63e-78 5.35e-163 0.9625
1. PBF Q39EV7 CTP synthase 0.00e+00 5.85e-75 8.38e-172 0.9681
1. PBF Q9YBJ4 CTP synthase 0.00e+00 2.90e-65 1.36e-157 0.9691
1. PBF Q5XA10 CTP synthase 0.00e+00 1.09e-80 0.0 0.9894
1. PBF Q5E325 CTP synthase 0.00e+00 1.00e-70 0.0 0.9716
1. PBF A5EK18 CTP synthase 0.00e+00 2.42e-74 1.75e-166 0.9702
1. PBF P74208 CTP synthase 0.00e+00 7.28e-70 0.0 0.9813
1. PBF Q927T4 CTP synthase 0.00e+00 7.10e-81 0.0 0.9811
1. PBF A9M0Y3 CTP synthase 0.00e+00 8.95e-69 0.0 0.9686
1. PBF Q7W5N6 CTP synthase 0.00e+00 2.08e-74 1.01e-173 0.9658
1. PBF A3CWS5 CTP synthase 0.00e+00 6.85e-73 3.53e-160 0.9558
1. PBF B7LWP4 CTP synthase 0.00e+00 2.85e-73 0.0 0.9729
1. PBF A9KDH0 CTP synthase 0.00e+00 9.28e-62 0.0 0.9766
1. PBF Q473G7 CTP synthase 0.00e+00 6.40e-75 4.05e-177 0.9698
1. PBF Q5R142 CTP synthase 0.00e+00 1.23e-70 1.68e-180 0.9654
1. PBF Q3J0Z1 CTP synthase 0.00e+00 1.05e-76 3.55e-162 0.969
1. PBF A8G7J4 CTP synthase 0.00e+00 1.05e-79 0.0 0.9773
1. PBF Q67TG8 CTP synthase 0.00e+00 4.63e-78 0.0 0.977
1. PBF Q57KG9 CTP synthase 0.00e+00 1.38e-72 0.0 0.972
1. PBF Q465Q4 CTP synthase 0.00e+00 1.12e-76 2.64e-174 0.9723
1. PBF P28595 CTP synthase 0.00e+00 1.02e-75 5.68e-166 0.9673
1. PBF Q74LG2 CTP synthase 0.00e+00 1.60e-82 0.0 0.9803
1. PBF A5V8U1 CTP synthase 0.00e+00 6.91e-76 1.62e-171 0.965
1. PBF Q5HM95 CTP synthase 0.00e+00 4.91e-81 0.0 0.9821
1. PBF B6I6H6 CTP synthase 0.00e+00 2.85e-73 0.0 0.975
1. PBF B2I935 CTP synthase 0.00e+00 9.02e-63 0.0 0.9747
1. PBF Q4KHF8 CTP synthase 0.00e+00 2.82e-71 0.0 0.9669
1. PBF C5CSV3 CTP synthase 0.00e+00 8.65e-67 2.83e-173 0.9742
1. PBF Q4JAK8 CTP synthase 0.00e+00 2.44e-63 1.59e-167 0.9719
1. PBF Q1GBQ2 CTP synthase 0.00e+00 3.88e-86 0.0 0.9828
1. PBF Q04C51 CTP synthase 0.00e+00 1.37e-85 0.0 0.9818
1. PBF A7HXX9 CTP synthase 0.00e+00 9.68e-75 5.36e-161 0.9643
1. PBF Q3K3S2 CTP synthase 0.00e+00 1.11e-79 0.0 0.9886
1. PBF A8GRV6 CTP synthase 0.00e+00 1.70e-79 6.31e-166 0.973
1. PBF Q0SMT3 CTP synthase 0.00e+00 2.31e-78 4.16e-134 0.9445
1. PBF Q604M6 CTP synthase 0.00e+00 1.56e-67 0.0 0.9696
1. PBF P65924 CTP synthase 0.00e+00 2.71e-82 0.0 0.9819
1. PBF Q6AQ78 CTP synthase 0.00e+00 2.08e-74 1.40e-179 0.9645
1. PBF B1YT11 CTP synthase 0.00e+00 7.26e-73 8.27e-173 0.9676
1. PBF Q5UX57 CTP synthase 0.00e+00 1.64e-62 7.73e-174 0.9547
1. PBF Q8EM53 CTP synthase 0.00e+00 5.75e-83 0.0 0.9806
1. PBF A7GV88 CTP synthase 0.00e+00 1.12e-81 0.0 0.9831
1. PBF A4FKA9 CTP synthase 0.00e+00 3.91e-68 0.0 0.9751
1. PBF Q1LPI8 CTP synthase 0.00e+00 1.93e-78 4.42e-179 0.9668
1. PBF Q5NHS1 CTP synthase 0.00e+00 1.30e-76 0.0 0.9712
1. PBF A0QH68 CTP synthase 0.00e+00 2.83e-52 1.66e-174 0.9675
1. PBF Q5HXD1 CTP synthase 0.00e+00 6.03e-75 0.0 0.9692
1. PBF C0PXD6 CTP synthase 0.00e+00 1.38e-72 0.0 0.9733
1. PBF Q128E7 CTP synthase 0.00e+00 3.23e-62 1.36e-177 0.9765
1. PBF A1VDL2 CTP synthase 0.00e+00 1.46e-76 1.96e-176 0.9688
1. PBF Q2GLS9 CTP synthase 0.00e+00 1.73e-71 2.05e-165 0.9558
1. PBF Q48F77 CTP synthase 0.00e+00 1.12e-71 0.0 0.9681
1. PBF B5QW41 CTP synthase 0.00e+00 1.38e-72 0.0 0.9721
1. PBF Q8FTL2 CTP synthase 0.00e+00 4.35e-62 3.12e-163 0.9653
1. PBF P0A7E6 CTP synthase 0.00e+00 2.85e-73 0.0 0.9747
1. PBF A1KJB5 CTP synthase 0.00e+00 1.43e-51 1.24e-180 0.9649
1. PBF B8JBN6 CTP synthase 0.00e+00 1.18e-62 0.0 0.9672
1. PBF P59039 CTP synthase 0.00e+00 1.64e-70 1.06e-178 0.9748
1. PBF A1APF9 CTP synthase 0.00e+00 1.48e-80 1.20e-176 0.9737
1. PBF Q3AGF7 CTP synthase 0.00e+00 9.76e-71 0.0 0.9747
1. PBF B1M5Q9 CTP synthase 0.00e+00 2.36e-76 7.31e-169 0.9692
1. PBF P50547 CTP synthase 1 (Fragment) 0.00e+00 2.22e-20 3.51e-128 0.9058
1. PBF Q0BLA3 CTP synthase 0.00e+00 2.58e-77 0.0 0.9709
1. PBF Q660U9 CTP synthase 0.00e+00 1.25e-77 4.06e-135 0.9413
1. PBF Q5GYK0 CTP synthase 0.00e+00 1.19e-65 0.0 0.9736
1. PBF B4TTY6 CTP synthase 0.00e+00 1.30e-72 0.0 0.9721
1. PBF A0Q4L3 CTP synthase 0.00e+00 1.30e-76 0.0 0.9704
1. PBF B7HFN6 CTP synthase 0.00e+00 7.60e-84 0.0 0.983
1. PBF O25116 CTP synthase 0.00e+00 1.22e-73 5.07e-161 0.955
1. PBF Q5X5Y6 CTP synthase 0.00e+00 7.11e-71 2.42e-172 0.9693
1. PBF Q1CLT3 CTP synthase 0.00e+00 2.69e-73 0.0 0.9712
1. PBF A8LIN6 CTP synthase 0.00e+00 3.44e-74 9.51e-164 0.9653
1. PBF Q0I200 CTP synthase 0.00e+00 3.30e-72 0.0 0.9692
1. PBF Q8PLS3 CTP synthase 0.00e+00 1.75e-64 0.0 0.9731
1. PBF Q1BHS2 CTP synthase 0.00e+00 2.69e-73 1.47e-173 0.9694
1. PBF Q4FR69 CTP synthase 0.00e+00 1.55e-70 2.30e-176 0.975
1. PBF Q6LMT0 CTP synthase 0.00e+00 1.84e-70 0.0 0.9753
1. PBF Q086B1 CTP synthase 0.00e+00 2.08e-74 2.80e-180 0.9692
1. PBF C1ANX1 CTP synthase 0.00e+00 1.43e-51 1.24e-180 0.9653
1. PBF Q2K871 CTP synthase 0.00e+00 2.53e-79 2.55e-164 0.9709
1. PBF Q5N040 CTP synthase 0.00e+00 7.84e-74 0.0 0.9864
1. PBF A1WL89 CTP synthase 0.00e+00 5.91e-72 3.83e-173 0.9748
1. PBF A2SSJ7 CTP synthase 0.00e+00 9.40e-72 6.52e-149 0.9555
1. PBF A1B8D4 CTP synthase 0.00e+00 3.60e-73 1.21e-170 0.9606
1. PBF Q8CNI2 CTP synthase 0.00e+00 4.91e-81 0.0 0.9791
1. PBF Q2SXC7 CTP synthase 0.00e+00 1.06e-71 1.84e-170 0.9691
1. PBF Q0TNA4 CTP synthase 0.00e+00 8.78e-79 0.0 0.9784
1. PBF B8IP92 CTP synthase 0.00e+00 2.02e-74 9.07e-165 0.9627
1. PBF B1VAI9 CTP synthase 0.00e+00 2.78e-72 0.0 0.9755
1. PBF Q8DWG1 CTP synthase 0.00e+00 1.38e-78 0.0 0.9877
1. PBF Q65VZ8 CTP synthase 0.00e+00 3.50e-72 0.0 0.9713
1. PBF Q11S24 CTP synthase 0.00e+00 1.50e-77 0.0 0.9777
1. PBF Q7U3K4 CTP synthase 0.00e+00 3.60e-73 0.0 0.9863
1. PBF A6X0L6 CTP synthase 0.00e+00 2.51e-76 5.27e-165 0.9721
1. PBF B0R6G2 CTP synthase 0.00e+00 8.19e-59 3.73e-171 0.959
1. PBF A3Q0R1 CTP synthase 0.00e+00 1.84e-56 0.0 0.9737
1. PBF Q939R0 CTP synthase 0.00e+00 9.08e-60 0.0 0.9711
1. PBF A0KU81 CTP synthase 0.00e+00 5.85e-75 0.0 0.9692
1. PBF Q3ANY4 CTP synthase 0.00e+00 1.39e-61 1.76e-169 0.9745
1. PBF B5F4P0 CTP synthase 0.00e+00 1.55e-72 0.0 0.9722
1. PBF B1JK10 CTP synthase 0.00e+00 2.69e-73 0.0 0.9717
1. PBF Q976E9 CTP synthase 0.00e+00 2.10e-68 9.44e-168 0.9687
1. PBF Q1MGC4 CTP synthase 0.00e+00 1.34e-79 3.94e-163 0.9674
1. PBF Q2YUM6 CTP synthase 0.00e+00 2.71e-82 0.0 0.9819
1. PBF A5EW22 CTP synthase 0.00e+00 7.18e-74 0.0 0.9651
1. PBF Q7VGH1 CTP synthase 0.00e+00 5.12e-73 4.08e-155 0.9693
1. PBF Q21LC4 CTP synthase 0.00e+00 2.83e-70 0.0 0.9675
1. PBF B8ZRH6 CTP synthase 0.00e+00 3.56e-48 3.49e-174 0.9678
1. PBF B9MEQ7 CTP synthase 0.00e+00 2.38e-70 7.64e-179 0.977
1. PBF P65923 CTP synthase 0.00e+00 2.71e-82 0.0 0.9824
1. PBF Q5M6C0 CTP synthase 0.00e+00 1.46e-79 0.0 0.9887
1. PBF C3K6H4 CTP synthase 0.00e+00 3.77e-71 0.0 0.9687
1. PBF A5GWT6 CTP synthase 0.00e+00 1.55e-72 0.0 0.9753
1. PBF B0JU82 CTP synthase 0.00e+00 1.59e-75 0.0 0.9874
1. PBF A4TPY0 CTP synthase 0.00e+00 2.69e-73 0.0 0.9709
1. PBF Q2GHT7 CTP synthase 0.00e+00 5.90e-78 2.65e-167 0.9648
1. PBF Q2IH81 CTP synthase 0.00e+00 1.32e-62 0.0 0.9641
1. PBF A4WQW2 CTP synthase 0.00e+00 3.05e-75 2.20e-162 0.967
1. PBF A3D796 CTP synthase 0.00e+00 5.84e-74 0.0 0.9707
1. PBF C0M8K6 CTP synthase 0.00e+00 1.87e-79 0.0 0.9881
1. PBF C3LQZ1 CTP synthase 0.00e+00 6.46e-73 0.0 0.9715
1. PBF P0A5U3 CTP synthase 0.00e+00 1.43e-51 1.24e-180 0.9656
1. PBF B0U656 CTP synthase 0.00e+00 2.64e-63 0.0 0.9677
1. PBF Q6LYU4 CTP synthase 0.00e+00 7.39e-74 0.0 0.9671
1. PBF Q9JTK1 CTP synthase 0.00e+00 6.36e-69 0.0 0.9696
1. PBF B3GZX8 CTP synthase 0.00e+00 6.49e-70 0.0 0.9726
1. PBF Q68WZ6 CTP synthase 0.00e+00 7.65e-55 2.15e-161 0.9708
1. PBF B7UHJ6 CTP synthase 0.00e+00 2.69e-73 0.0 0.9771
1. PBF B7MLA1 CTP synthase 0.00e+00 2.85e-73 0.0 0.9745
1. PBF Q8DQY0 CTP synthase 0.00e+00 6.83e-80 0.0 0.9898
1. PBF B8D7U6 CTP synthase 0.00e+00 4.16e-77 0.0 0.975
1. PBF A0KGH2 CTP synthase 0.00e+00 3.08e-71 0.0 0.9753
1. PBF Q13X05 CTP synthase 0.00e+00 1.00e-68 1.40e-174 0.9701
1. PBF B9KKB0 CTP synthase 0.00e+00 2.63e-75 2.56e-162 0.9671
1. PBF C1F1E7 CTP synthase 0.00e+00 5.08e-67 0.0 0.9768
1. PBF Q49Z73 CTP synthase 0.00e+00 6.23e-80 0.0 0.9812
1. PBF Q9KPC4 CTP synthase 0.00e+00 6.46e-73 0.0 0.9725
1. PBF B8I598 CTP synthase 0.00e+00 1.66e-83 0.0 0.9794
1. PBF Q2LRK2 CTP synthase 0.00e+00 5.55e-78 0.0 0.9681
1. PBF Q6GEU8 CTP synthase 0.00e+00 2.71e-82 0.0 0.9788
1. PBF Q31G66 CTP synthase 0.00e+00 9.08e-74 2.21e-179 0.9684
1. PBF B3EK39 CTP synthase 0.00e+00 4.09e-63 4.88e-177 0.9727
1. PBF P0DD71 CTP synthase 0.00e+00 1.09e-80 0.0 0.9902
1. PBF O51522 CTP synthase 0.00e+00 7.72e-80 2.78e-135 0.9405
1. PBF A9AGW0 CTP synthase 0.00e+00 6.64e-72 2.34e-173 0.9673
1. PBF A0QYQ7 CTP synthase 0.00e+00 6.20e-50 0.0 0.9719
1. PBF B1XUS0 CTP synthase 0.00e+00 7.28e-70 2.92e-170 0.9676
1. PBF B7IH88 CTP synthase 0.00e+00 8.64e-70 5.10e-143 0.9352
1. PBF B9IRX1 CTP synthase 0.00e+00 4.76e-84 0.0 0.9836
1. PBF A3MYK8 CTP synthase 0.00e+00 8.13e-72 0.0 0.9737
1. PBF B1Z9R0 CTP synthase 0.00e+00 2.36e-76 2.34e-168 0.9639
1. PBF Q5XHA8 CTP synthase 1-A 0.00e+00 1.16e-44 1.16e-165 0.9569
1. PBF Q0APT7 CTP synthase 0.00e+00 9.87e-76 1.98e-169 0.9691
1. PBF Q8TYT7 CTP synthase 0.00e+00 6.59e-75 0.0 0.9585
1. PBF B4EUF6 CTP synthase 0.00e+00 1.45e-73 0.0 0.976
1. PBF Q83GX8 CTP synthase 0.00e+00 1.21e-67 3.25e-174 0.9559
1. PBF Q3MAV1 CTP synthase 0.00e+00 5.85e-75 0.0 0.9804
1. PBF A1VLH3 CTP synthase 0.00e+00 8.39e-60 3.30e-174 0.973
1. PBF Q2G6R7 CTP synthase 0.00e+00 6.57e-74 1.30e-168 0.9623
1. PBF Q7WD72 CTP synthase 0.00e+00 2.08e-74 1.01e-173 0.9661
1. PBF B4EDA3 CTP synthase 0.00e+00 4.42e-73 7.18e-173 0.9697
1. PBF B8GIB3 CTP synthase 0.00e+00 7.97e-71 1.82e-155 0.9549
1. PBF B8E8T0 CTP synthase 0.00e+00 9.08e-74 0.0 0.9712
1. PBF Q1C3Y5 CTP synthase 0.00e+00 2.69e-73 0.0 0.9776
1. PBF A6TD54 CTP synthase 0.00e+00 4.48e-74 0.0 0.9721
1. PBF Q5WB43 CTP synthase 0.00e+00 1.57e-81 0.0 0.9838
1. PBF A7H1B7 CTP synthase 0.00e+00 4.42e-72 0.0 0.9593
1. PBF A1TLT0 CTP synthase 0.00e+00 1.69e-66 1.67e-174 0.969
1. PBF A1KUX8 CTP synthase 0.00e+00 1.16e-68 0.0 0.9712
1. PBF Q4ZWR0 CTP synthase 0.00e+00 2.00e-71 0.0 0.9676
1. PBF Q2JUH1 CTP synthase 0.00e+00 9.48e-71 0.0 0.98
1. PBF Q5NQB9 CTP synthase 0.00e+00 1.22e-73 9.00e-169 0.9659
1. PBF Q9HXZ4 CTP synthase 0.00e+00 6.68e-70 0.0 0.9681
1. PBF A5IB79 CTP synthase 0.00e+00 7.11e-71 2.42e-172 0.9691
1. PBF Q310T4 CTP synthase 0.00e+00 5.97e-77 1.24e-176 0.9659
1. PBF Q8NQL7 CTP synthase 0.00e+00 6.84e-66 8.42e-167 0.9647
1. PBF Q1J055 CTP synthase 0.00e+00 2.06e-66 1.32e-175 0.9674
2. PF A4G3R1 Cobyrinate a,c-diamide synthase 1.33e-04 5.17e-16 NA 0.3405
2. PF Q8UBQ8 Hydrogenobyrinate a,c-diamide synthase 2.33e-05 2.64e-14 NA 0.2831
2. PF Q980B1 Cobyrinate a,c-diamide synthase 2.51e-08 6.86e-14 NA 0.3373
2. PF Q8TK00 Cobyrinate a,c-diamide synthase 1.40e-07 2.01e-19 NA 0.3438
2. PF Q5V0Z6 Probable cobyric acid synthase 8.62e-06 1.86e-13 NA 0.5036
2. PF O68108 Hydrogenobyrinate a,c-diamide synthase 3.17e-05 2.29e-14 NA 0.3187
2. PF O28054 Cobyrinate a,c-diamide synthase 2.58e-06 1.03e-15 NA 0.3707
2. PF Q9RJ16 Hydrogenobyrinate a,c-diamide synthase 8.53e-07 4.81e-15 NA 0.3373
2. PF Q98KP1 Hydrogenobyrinate a,c-diamide synthase 3.05e-05 4.45e-16 NA 0.3258
2. PF Q3ZA71 Cobyrinate a,c-diamide synthase 1.54e-07 1.47e-20 NA 0.3673
2. PF A3CL56 Cobyrinate a,c-diamide synthase 9.48e-07 3.30e-20 NA 0.3727
2. PF Q97BP4 Cobyrinate a,c-diamide synthase 1.69e-06 7.99e-19 NA 0.3553
2. PF A0L8B9 Cobyrinate a,c-diamide synthase 9.08e-07 6.00e-19 NA 0.3375
2. PF A6X051 Hydrogenobyrinate a,c-diamide synthase 4.93e-05 5.56e-15 NA 0.3496
2. PF Q975N0 Cobyrinate a,c-diamide synthase 1.32e-08 3.11e-16 NA 0.3641
2. PF Q7NF32 Cobyrinate a,c-diamide synthase 8.95e-07 3.06e-16 NA 0.3571
2. PF Q2NHQ3 Cobyrinate a,c-diamide synthase 1.39e-06 2.76e-16 NA 0.3721
2. PF Q75FQ8 Cobyrinate a,c-diamide synthase 8.11e-07 8.24e-20 NA 0.3384
2. PF P21632 Hydrogenobyrinate a,c-diamide synthase 1.03e-04 1.53e-15 NA 0.3341
2. PF A4FW46 Cobyrinate a,c-diamide synthase 3.12e-05 4.95e-16 NA 0.3703
2. PF A1AT17 Cobyrinate a,c-diamide synthase 2.45e-07 2.13e-17 NA 0.3327
2. PF Q5V341 Cobyrinate a,c-diamide synthase 8.42e-08 1.47e-13 NA 0.3643
2. PF Q46FL0 Cobyrinate a,c-diamide synthase 1.13e-07 2.33e-20 NA 0.3248
2. PF Q8G020 Hydrogenobyrinate a,c-diamide synthase 1.20e-04 7.90e-14 NA 0.3616
2. PF Q4JAI7 Cobyrinate a,c-diamide synthase 1.26e-06 1.46e-15 NA 0.3557
4. PB P9WHK7 CTP synthase 0.00e+00 1.43e-51 1.24e-180 NA
4. PB P70698 CTP synthase 1 0.00e+00 1.29e-42 4.27e-163 NA
4. PB P0A7E5 CTP synthase 0.00e+00 2.85e-73 0.0 NA
4. PB Q5U2N0 CTP synthase 2 0.00e+00 3.98e-46 1.50e-150 NA
4. PB P70303 CTP synthase 2 0.00e+00 8.38e-45 4.34e-152 NA
4. PB P38627 CTP synthase 2 0.00e+00 5.41e-62 3.51e-149 NA
4. PB Q58574 CTP synthase 0.00e+00 1.34e-74 0.0 NA
4. PB O42644 CTP synthase 0.00e+00 3.22e-46 1.84e-144 NA
4. PB Q2FWD1 CTP synthase 0.00e+00 1.65e-82 0.0 NA
4. PB P28274 CTP synthase 1 0.00e+00 9.95e-58 1.77e-151 NA
4. PB P17812 CTP synthase 1 0.00e+00 1.10e-42 1.95e-162 NA
4. PB Q54V77 CTP synthase 0.00e+00 5.99e-63 5.31e-165 NA
4. PB Q9VUL1 CTP synthase 0.00e+00 2.87e-21 8.40e-156 NA
4. PB Q6PEI7 CTP synthase 1 0.00e+00 9.41e-45 1.29e-165 NA
4. PB Q9NRF8 CTP synthase 2 0.00e+00 7.18e-46 2.03e-154 NA
5. P A1VP76 Cobyric acid synthase 4.27e-05 5.92e-12 NA NA
5. P B0R5X2 Probable cobyric acid synthase 6.80e-06 9.49e-14 NA NA
5. P C1DPP2 Cobyric acid synthase 8.68e-05 4.23e-12 NA NA
5. P Q7VB41 Cobyric acid synthase 6.14e-05 1.31e-13 NA NA
5. P Q6B940 Carbamoyl-phosphate synthase small chain 3.87e-03 3.23e-02 NA NA
5. P B7GLS9 Cobyric acid synthase 1.93e-06 2.17e-13 NA NA
5. P P0CY57 Cobyric acid synthase 2.23e-04 5.47e-14 NA NA
5. P B4T8X1 Cobyric acid synthase 5.51e-07 2.56e-15 NA NA
5. P B5YL83 Cobyric acid synthase 6.55e-05 8.60e-14 NA NA
5. P Q8Y7R3 Cobyric acid synthase 1.45e-05 3.06e-15 NA NA
5. P Q466W7 Probable cobyric acid synthase 1.31e-05 9.82e-16 NA NA
5. P Q3IG44 Cobyric acid synthase 8.87e-05 1.37e-11 NA NA
5. P Q1MFE8 Cobyric acid synthase 1.21e-04 7.89e-15 NA NA
5. P A6LSX2 Cobyric acid synthase 3.53e-05 8.85e-16 NA NA
5. P Q720M1 Cobyric acid synthase 1.58e-05 7.55e-15 NA NA
5. P A6X034 Cobyric acid synthase 8.52e-05 4.23e-14 NA NA
5. P C5DAP4 Cobyric acid synthase 7.54e-08 2.01e-14 NA NA
5. P Q9HPL7 Cobyrinate a,c-diamide synthase 2.27e-07 8.08e-13 NA NA
5. P Q5PDU3 Cobyric acid synthase 5.32e-07 2.56e-15 NA NA
5. P A6TDB1 Cobyric acid synthase 5.95e-06 1.38e-16 NA NA
5. P C0RJS3 Cobyric acid synthase 1.13e-04 1.58e-14 NA NA
5. P Q8YHV6 Cobyric acid synthase 1.02e-04 1.58e-14 NA NA
5. P Q8Z5N6 Cobyric acid synthase 9.68e-07 2.56e-15 NA NA
5. P Q72DW3 Cobyric acid synthase 1.90e-06 3.32e-14 NA NA
5. P B3DQ31 Carbamoyl-phosphate synthase small chain 5.10e-03 1.65e-03 NA NA
5. P O27509 Cobyrinate a,c-diamide synthase 5.33e-06 3.14e-14 NA NA
5. P A5VM70 Cobyric acid synthase 3.37e-06 1.70e-14 NA NA
5. P B7KHS7 Cobyric acid synthase 7.58e-05 6.41e-12 NA NA
5. P Q6L2V8 Cobyrinate a,c-diamide synthase 1.91e-07 1.32e-15 NA NA
5. P Q55860 Cobyric acid synthase 1.08e-05 4.78e-12 NA NA
5. P B9DZL9 Cobyric acid synthase 9.44e-05 1.03e-13 NA NA
5. P Q21V75 Cobyric acid synthase 9.51e-06 9.39e-16 NA NA
5. P C3L2K4 Cobyric acid synthase 4.74e-08 3.98e-15 NA NA
5. P A3PY44 Cobyric acid synthase 1.34e-05 9.66e-15 NA NA
5. P Q97AJ4 Carbamoyl-phosphate synthase small chain 7.95e-03 3.60e-03 NA NA
5. P A8G5V0 Cobyric acid synthase 1.21e-04 2.39e-14 NA NA
5. P B8EQG6 Cobyric acid synthase 2.92e-06 4.79e-13 NA NA
5. P B1WYU3 Cobyric acid synthase 5.06e-08 9.62e-14 NA NA
5. P Q8TKZ3 Probable cobyric acid synthase 7.46e-05 1.71e-17 NA NA
5. P A1KBC7 Cobyric acid synthase 1.23e-04 4.79e-13 NA NA
5. P B5EWY5 Cobyric acid synthase 5.87e-07 8.98e-16 NA NA
5. P Q7V6H6 Cobyric acid synthase 3.52e-05 1.30e-15 NA NA
5. P Q48FJ7 Cobyric acid synthase 6.80e-04 1.57e-13 NA NA
5. P Q87HN1 Cobyric acid synthase 5.10e-05 1.78e-12 NA NA
5. P A4JGX5 Cobyric acid synthase 3.58e-04 7.23e-12 NA NA
5. P Q8R659 Cobyrinate a,c-diamide synthase 1.00e-05 9.96e-16 NA NA
5. P A5VRM1 Carbamoyl-phosphate synthase small chain 7.82e-03 2.61e-02 NA NA
5. P Q1GPG1 Cobyric acid synthase 6.70e-05 4.35e-12 NA NA
5. P Q92P31 Cobyric acid synthase 1.35e-04 1.19e-15 NA NA
5. P O28931 Probable cobyric acid synthase 3.88e-05 1.80e-19 NA NA
5. P Q1IDJ9 Cobyric acid synthase 6.58e-04 1.75e-15 NA NA
5. P A9M5X3 Cobyric acid synthase 1.13e-04 7.26e-14 NA NA
5. P B1I5R2 Cobyric acid synthase 1.04e-05 2.80e-14 NA NA
5. P Q7V0U2 Cobyric acid synthase 1.13e-04 7.85e-16 NA NA
5. P Q47T68 Hydrogenobyrinate a,c-diamide synthase 2.62e-06 2.56e-16 NA NA
5. P Q0BY73 Carbamoyl-phosphate synthase small chain 6.67e-03 2.48e-02 NA NA
5. P Q474Y6 Cobyric acid synthase 4.64e-04 3.41e-12 NA NA
5. P A1BFI0 Cobyric acid synthase 1.66e-06 4.87e-16 NA NA
5. P A1KF76 Cobyric acid synthase 7.21e-06 2.19e-12 NA NA
5. P A8I5C0 Cobyric acid synthase 5.88e-05 5.95e-14 NA NA
5. P A1VFG1 Cobyric acid synthase 1.84e-06 1.22e-14 NA NA
5. P A4G3R6 Cobyric acid synthase 6.69e-05 2.43e-14 NA NA
5. P B4S8A8 Cobyric acid synthase 1.95e-06 5.19e-17 NA NA
5. P B0SXF9 Cobyric acid synthase 1.16e-04 4.53e-12 NA NA
5. P A7FSG1 Cobyric acid synthase 4.47e-08 1.77e-15 NA NA
5. P Q8RCP3 Cobyric acid synthase 3.77e-08 4.59e-17 NA NA
5. P Q6L0V5 Probable cobyric acid synthase 8.33e-05 1.51e-15 NA NA
5. P Q0TRJ4 Cobyric acid synthase 6.85e-07 3.07e-18 NA NA
5. P A9WIN9 Cobyric acid synthase 1.69e-06 9.23e-14 NA NA
5. P Q3ARV1 Cobyric acid synthase 1.76e-06 1.34e-17 NA NA
5. P A9MLS5 Cobyric acid synthase 6.09e-07 1.04e-14 NA NA
5. P O25835 Carbamoyl-phosphate synthase small chain 5.16e-03 7.67e-03 NA NA
5. P Q9RJ20 Cobyric acid synthase 5.32e-06 4.47e-15 NA NA
5. P B1KY08 Cobyric acid synthase 3.42e-08 3.59e-15 NA NA
5. P Q43989 Cobyric acid synthase 2.84e-06 3.66e-18 NA NA
5. P A1T225 Cobyric acid synthase 4.77e-06 9.92e-13 NA NA
5. P B0CHS0 Carbamoyl-phosphate synthase small chain 5.80e-03 1.50e-02 NA NA
5. P Q2J9S7 Cobyric acid synthase 2.40e-04 8.09e-16 NA NA
5. P B1Y856 Cobyric acid synthase 4.87e-05 8.72e-16 NA NA
5. P A7I9K5 Probable cobyric acid synthase 4.06e-06 3.45e-16 NA NA
5. P C3MDR9 Cobyric acid synthase 2.21e-04 2.68e-15 NA NA
5. P Q5KZ06 Cobyric acid synthase 1.08e-06 4.61e-14 NA NA
5. P A6LBQ5 Cobyric acid synthase 5.76e-05 5.52e-17 NA NA
5. P Q2YM22 Carbamoyl-phosphate synthase small chain 5.68e-03 2.61e-02 NA NA
5. P P29946 Cobyrinate a,c-diamide synthase 1.33e-05 1.82e-17 NA NA
5. P Q8D737 Cobyric acid synthase 4.71e-05 1.66e-13 NA NA
5. P A5VFK5 Cobyric acid synthase 6.49e-05 6.21e-14 NA NA
5. P Q8RCP4 Cobyrinate a,c-diamide synthase 3.31e-09 2.18e-15 NA NA
5. P Q885W8 Cobyric acid synthase 1.50e-04 1.30e-12 NA NA
5. P B9JGD3 Cobyric acid synthase 1.27e-05 5.65e-15 NA NA
5. P A5EGF9 Cobyric acid synthase 6.30e-05 2.23e-14 NA NA
5. P P9WP94 Cobyric acid synthase 6.66e-06 2.19e-12 NA NA
5. P Q5P3B0 Cobyric acid synthase 2.24e-05 1.85e-11 NA NA
5. P C1B2W9 Cobyric acid synthase 3.13e-05 1.03e-12 NA NA
5. P B0KCS6 Cobyric acid synthase 1.78e-06 1.65e-16 NA NA
5. P A2SI71 Cobyric acid synthase 7.34e-05 1.51e-15 NA NA
5. P Q9KLL6 Cobyric acid synthase 4.07e-05 2.07e-16 NA NA
5. P Q829J5 Cobyric acid synthase 4.84e-06 8.00e-15 NA NA
5. P A5TYY1 Cobyric acid synthase 3.86e-05 2.19e-12 NA NA
5. P A4VJ35 Hydrogenobyrinate a,c-diamide synthase 2.00e-04 5.98e-15 NA NA
5. P B8GDE3 Probable cobyric acid synthase 3.80e-05 7.85e-16 NA NA
5. P A1JTQ2 Cobyric acid synthase 9.28e-07 2.84e-16 NA NA
5. P A2BS60 Cobyric acid synthase 1.07e-04 6.39e-14 NA NA
5. P A8MET3 Cobyric acid synthase 2.01e-05 2.10e-16 NA NA
5. P O19886 Carbamoyl-phosphate synthase small chain 2.15e-03 1.28e-02 NA NA
5. P A1UEN7 Cobyric acid synthase 5.50e-07 9.66e-15 NA NA
5. P B2S6E8 Cobyric acid synthase 1.10e-04 4.42e-14 NA NA
5. P A5UMJ2 Cobyrinate a,c-diamide synthase 2.96e-06 2.07e-18 NA NA
5. P Q8YUG9 Cobyric acid synthase 3.40e-05 2.13e-12 NA NA
5. P P73002 Cobyrinate a,c-diamide synthase 4.54e-06 1.85e-11 NA NA
5. P B2JER3 Cobyric acid synthase 3.31e-04 2.40e-12 NA NA
5. P P9WP96 Hydrogenobyrinate a,c-diamide synthase 3.69e-05 1.60e-16 NA NA
5. P O87698 Cobyrinate a,c-diamide synthase 2.35e-07 2.14e-18 NA NA
5. P Q3Z7Y8 Cobyric acid synthase 1.03e-05 1.34e-15 NA NA
5. P Q8EI15 Cobyric acid synthase 8.30e-04 8.65e-13 NA NA
5. P Q8YIB8 Carbamoyl-phosphate synthase small chain 5.82e-03 2.61e-02 NA NA
5. P A5N643 Cobyric acid synthase 9.30e-05 1.03e-13 NA NA
5. P Q0W1N4 Probable cobyric acid synthase 3.00e-08 1.34e-12 NA NA
5. P Q12TL2 Probable cobyric acid synthase 8.03e-05 6.63e-17 NA NA
5. P Q57C28 Carbamoyl-phosphate synthase small chain 5.77e-03 2.61e-02 NA NA
5. P Q0S258 Cobyric acid synthase 2.52e-05 4.71e-12 NA NA
5. P A5GMB9 Cobyric acid synthase 7.36e-05 7.47e-14 NA NA
5. P Q9I471 Hydrogenobyrinate a,c-diamide synthase 1.73e-04 3.68e-13 NA NA
5. P A6UAC0 Cobyric acid synthase 1.66e-04 3.30e-16 NA NA
5. P C1AJT1 Cobyric acid synthase 5.50e-05 2.19e-12 NA NA
5. P Q21P75 Cobyric acid synthase 3.27e-05 9.67e-11 NA NA
5. P Q57CI7 Cobyric acid synthase 1.10e-04 4.42e-14 NA NA
5. P P63836 Hydrogenobyrinate a,c-diamide synthase 2.61e-05 1.60e-16 NA NA
5. P A4J806 Cobyric acid synthase 1.07e-05 1.18e-12 NA NA
5. P Q167R8 Cobyric acid synthase 2.36e-06 5.24e-14 NA NA
5. P B2T167 Cobyric acid synthase 1.33e-04 4.11e-13 NA NA
5. P Q1GF45 Cobyric acid synthase 1.84e-06 3.39e-13 NA NA
5. P A4YXJ9 Cobyric acid synthase 5.25e-05 1.53e-13 NA NA
5. P Q3MGR4 Cobyric acid synthase 1.41e-05 3.15e-12 NA NA
5. P A5VR62 Hydrogenobyrinate a,c-diamide synthase 3.81e-05 5.39e-14 NA NA
5. P B0K2J6 Cobyric acid synthase 1.42e-06 4.25e-17 NA NA
5. P Q89Q71 Cobyric acid synthase 1.32e-06 1.36e-12 NA NA
5. P B2HNJ6 Cobyric acid synthase 5.65e-06 8.15e-12 NA NA
5. P Q0AMR3 Carbamoyl-phosphate synthase small chain 5.95e-03 9.00e-03 NA NA
5. P B6YV97 Probable cobyric acid synthase 5.05e-06 3.64e-15 NA NA
5. P B0KT65 Cobyric acid synthase 2.12e-04 5.09e-14 NA NA
5. P Q7VHS5 Carbamoyl-phosphate synthase small chain 1.01e-02 5.71e-03 NA NA
5. P Q3KFR7 Cobyric acid synthase 6.56e-05 1.33e-13 NA NA
5. P Q63WA1 Cobyric acid synthase 4.60e-04 2.57e-12 NA NA
5. P Q6LIL7 Cobyric acid synthase 3.38e-04 1.41e-12 NA NA
5. P Q6AAP6 Cobyric acid synthase 2.44e-05 3.28e-14 NA NA
5. P A3PE00 Cobyric acid synthase 1.75e-04 1.86e-16 NA NA
5. P A6UWF6 Probable cobyric acid synthase 2.55e-06 8.86e-15 NA NA
5. P Q897K3 Cobyrinate a,c-diamide synthase 1.07e-06 4.22e-20 NA NA
5. P D5AV13 Cobyric acid synthase 2.13e-06 4.06e-14 NA NA
5. P B2G9J4 Cobyrinate a,c-diamide synthase 3.49e-08 6.00e-19 NA NA
5. P P59576 Carbamoyl-phosphate synthase small chain 2.23e-03 4.27e-02 NA NA
5. P B8IUQ6 Cobyric acid synthase 9.73e-06 2.10e-14 NA NA
5. P Q31RS6 Cobyric acid synthase 4.75e-05 1.91e-13 NA NA
5. P B5BG57 Cobyric acid synthase 5.68e-07 2.56e-15 NA NA
5. P B8G242 Cobyric acid synthase 1.76e-04 9.52e-15 NA NA
5. P B0CHA6 Cobyric acid synthase 4.96e-05 1.12e-13 NA NA
5. P A6SWZ4 Cobyric acid synthase 1.21e-03 1.67e-12 NA NA
5. P B5QYX6 Cobyric acid synthase 6.08e-07 7.97e-16 NA NA
5. P Q9ZJY9 Carbamoyl-phosphate synthase small chain 7.77e-03 8.92e-03 NA NA
5. P Q24Q41 Cobyric acid synthase 6.90e-05 9.52e-15 NA NA
5. P A1B8D6 Cobyric acid synthase 1.19e-05 3.29e-15 NA NA
5. P Q970U8 Carbamoyl-phosphate synthase small chain 1.01e-02 2.82e-02 NA NA
5. P Q4K8B9 Cobyric acid synthase 5.21e-05 3.05e-11 NA NA
5. P Q5YSA4 Cobyric acid synthase 4.82e-04 1.41e-14 NA NA
5. P Q2GBK2 Cobyric acid synthase 3.67e-06 7.44e-10 NA NA
5. P A5D3N4 Cobyric acid synthase 3.54e-05 2.49e-15 NA NA
5. P A6V8T2 Cobyric acid synthase 1.62e-04 1.58e-12 NA NA
5. P O26880 Probable cobyric acid synthase 1.17e-06 7.57e-14 NA NA
5. P Q3ZXQ8 Cobyric acid synthase 5.06e-05 1.15e-16 NA NA
5. P Q92P48 Hydrogenobyrinate a,c-diamide synthase 2.68e-05 7.66e-15 NA NA
5. P Q720N8 Cobyrinate a,c-diamide synthase 9.45e-09 2.73e-19 NA NA
5. P A2C7X7 Cobyric acid synthase 3.72e-05 2.48e-16 NA NA
5. P Q7N2T7 Cobyric acid synthase 7.31e-06 1.00e-13 NA NA
5. P B0JHX2 Cobyric acid synthase 1.71e-06 1.53e-13 NA NA
5. P Q9HPL5 Probable cobyric acid synthase 1.00e-05 9.49e-14 NA NA
5. P Q9I467 Cobyric acid synthase 2.00e-04 1.86e-12 NA NA
5. P A4WPH6 Cobyric acid synthase 9.24e-05 5.06e-13 NA NA
5. P Q47JS8 Cobyric acid synthase 2.32e-04 1.11e-11 NA NA
5. P Q7NXQ0 Cobyric acid synthase 1.55e-05 2.95e-13 NA NA
5. P Q97JB1 Cobyrinate a,c-diamide synthase 2.15e-06 3.07e-21 NA NA
5. P B5ZT17 Cobyric acid synthase 1.16e-04 5.25e-16 NA NA
5. P A1WAM6 Cobyric acid synthase 5.65e-05 1.29e-12 NA NA
5. P B0UH14 Cobyric acid synthase 1.14e-05 4.79e-13 NA NA
5. P C1FVB2 Cobyric acid synthase 3.52e-08 2.23e-14 NA NA
5. P Q0C077 Cobyric acid synthase 8.75e-05 2.90e-12 NA NA
5. P Q8KDV6 Cobyric acid synthase 2.49e-06 9.67e-16 NA NA
5. P B7UWH3 Cobyric acid synthase 1.79e-04 1.20e-12 NA NA
5. P Q02JB8 Cobyric acid synthase 1.61e-04 1.12e-12 NA NA
5. P A7N8K5 Cobyric acid synthase 2.03e-05 8.72e-14 NA NA
5. P B4TZP8 Cobyric acid synthase 5.86e-07 1.28e-15 NA NA
5. P B0CCR3 Cobyric acid synthase 1.08e-05 2.28e-12 NA NA
5. P A5VM87 Cobyrinate a,c-diamide synthase 5.01e-08 6.00e-19 NA NA
5. P Q8FT41 Carbamoyl-phosphate synthase small chain 4.64e-03 3.17e-02 NA NA
5. P A5I0A5 Cobyric acid synthase 4.35e-08 1.77e-15 NA NA
5. P A1TXB6 Cobyric acid synthase 9.49e-05 4.23e-13 NA NA
5. P C0REC2 Carbamoyl-phosphate synthase small chain 5.73e-03 2.61e-02 NA NA
5. P A0PU57 Cobyric acid synthase 9.25e-05 7.62e-12 NA NA
5. P A7NH10 Cobyric acid synthase 1.36e-06 1.53e-16 NA NA
5. P Q3ALJ7 Cobyric acid synthase 2.17e-05 4.99e-13 NA NA
5. P B7GPW1 Carbamoyl-phosphate synthase small chain 5.30e-03 8.00e-04 NA NA
5. P B7JVZ0 Cobyric acid synthase 1.84e-06 5.76e-12 NA NA
5. P P58893 Carbamoyl-phosphate synthase small chain 6.97e-03 2.91e-02 NA NA
5. P Q6LXX9 Probable cobyric acid synthase 2.83e-05 1.23e-15 NA NA
5. P Q9HP42 Carbamoyl-phosphate synthase small chain 1.18e-02 9.49e-03 NA NA
5. P A0AHV1 Cobyric acid synthase 7.22e-05 5.09e-14 NA NA
5. P Q3A7A3 Cobyrinate a,c-diamide synthase 5.39e-06 1.60e-19 NA NA
5. P P0A533 Cobyric acid synthase 7.96e-06 2.19e-12 NA NA
5. P Q2RJH7 Cobyric acid synthase 4.30e-08 1.27e-13 NA NA
5. P A4XT53 Cobyric acid synthase 5.89e-05 6.40e-11 NA NA
5. P B2S6U9 Carbamoyl-phosphate synthase small chain 5.81e-03 2.61e-02 NA NA
5. P Q9HIX6 Cobyrinate a,c-diamide synthase 1.94e-07 6.05e-17 NA NA
5. P A0LJ24 Cobyric acid synthase 1.40e-06 5.73e-15 NA NA
5. P A4INZ4 Cobyric acid synthase 1.10e-06 2.32e-14 NA NA
5. P A1WYA9 Cobyric acid synthase 2.47e-04 2.06e-10 NA NA
5. P Q7NJR0 Cobyric acid synthase 1.96e-06 4.34e-15 NA NA
5. P A7ILW0 Cobyric acid synthase 1.02e-06 3.89e-14 NA NA
5. P A4FWW2 Probable cobyric acid synthase 5.48e-06 3.06e-16 NA NA
5. P A5W7Q6 Cobyric acid synthase 1.63e-04 6.25e-15 NA NA
5. P B3PQX7 Cobyric acid synthase 1.27e-04 5.24e-14 NA NA
5. P P9WP95 Cobyric acid synthase 6.51e-06 2.19e-12 NA NA
5. P Q1GXH3 Cobyric acid synthase 3.11e-05 1.28e-09 NA NA
5. P Q2FTC7 Probable cobyric acid synthase 5.06e-06 5.35e-17 NA NA
5. P Q319X7 Cobyric acid synthase 5.16e-05 3.06e-16 NA NA
5. P Q0BCS3 Cobyric acid synthase 1.88e-04 1.76e-11 NA NA
5. P Q5N0L0 Carbamoyl-phosphate synthase small chain 4.22e-03 2.12e-03 NA NA
5. P Q92CL7 Cobyrinate a,c-diamide synthase 2.81e-07 1.16e-19 NA NA
5. P B0RPU7 Cobyric acid synthase 7.32e-04 2.33e-13 NA NA
5. P Q6NGL6 Cobyric acid synthase 4.77e-04 1.94e-17 NA NA
5. P Q8U3Z8 Probable cobyric acid synthase 3.43e-06 4.41e-18 NA NA
5. P Q17VI1 Carbamoyl-phosphate synthase small chain 8.83e-03 5.08e-03 NA NA
5. P Q9KBM8 Cobyrinate a,c-diamide synthase 6.35e-07 1.40e-18 NA NA
5. P A4FM88 Cobyric acid synthase 1.14e-04 4.73e-16 NA NA
5. P O33475 Probable cobyric acid synthase 3.42e-06 2.31e-15 NA NA
5. P Q3AE11 Cobyric acid synthase 2.26e-08 5.92e-16 NA NA
5. P B8D9Y4 Cobyric acid synthase 1.41e-05 5.48e-15 NA NA
5. P A1TMF3 Cobyric acid synthase 4.73e-05 6.72e-15 NA NA
5. P Q2JRG5 Cobyric acid synthase 8.01e-07 8.42e-13 NA NA
5. P Q0BUF0 Cobyric acid synthase 1.09e-04 6.48e-14 NA NA
5. P B2UXD4 Cobyric acid synthase 3.24e-08 1.55e-16 NA NA
5. P B6ES52 Cobyric acid synthase 1.09e-06 1.62e-14 NA NA
5. P A5GUP3 Cobyric acid synthase 5.29e-05 3.14e-14 NA NA
5. P Q8PHR1 Cobyric acid synthase 8.25e-05 1.35e-11 NA NA
5. P A9M6F1 Carbamoyl-phosphate synthase small chain 5.63e-03 1.40e-02 NA NA
5. P C4ZBD8 Cobyric acid synthase 4.35e-07 4.29e-14 NA NA
5. P Q2YQK2 Cobyric acid synthase 1.09e-04 4.42e-14 NA NA
5. P B2TPE7 Cobyric acid synthase 1.67e-06 2.30e-17 NA NA
5. P A6VH63 Cobyrinate a,c-diamide synthase 3.42e-05 1.16e-16 NA NA
5. P A9KMP5 Cobyric acid synthase 1.02e-03 5.56e-15 NA NA
5. P A2C3V9 Cobyric acid synthase 4.74e-05 2.08e-13 NA NA
5. P Q3IZR0 Cobyric acid synthase 9.61e-05 1.96e-12 NA NA
5. P Q97JB2 Cobyric acid synthase 2.20e-06 9.12e-15 NA NA
5. P Q8G816 Carbamoyl-phosphate synthase small chain 5.32e-03 6.87e-04 NA NA
5. P B8G7Y8 Cobyric acid synthase 9.81e-06 2.26e-13 NA NA
5. P Q9RZU9 Cobyric acid synthase 3.63e-05 4.47e-12 NA NA
5. P B5FLY7 Cobyric acid synthase 6.60e-07 7.97e-16 NA NA
5. P Q05597 Cobyric acid synthase 4.99e-07 1.19e-15 NA NA
5. P Q46JR6 Cobyric acid synthase 3.42e-05 8.85e-16 NA NA
5. P Q64TD9 Cobyric acid synthase 5.64e-05 4.96e-17 NA NA
5. P A6VGF5 Probable cobyric acid synthase 5.55e-06 3.16e-16 NA NA
5. P Q8XLJ6 Cobyric acid synthase 7.39e-07 3.07e-18 NA NA
5. P Q5E0T7 Cobyric acid synthase 7.98e-06 3.16e-13 NA NA
5. P C3K0Z0 Cobyric acid synthase 7.75e-05 8.60e-15 NA NA
5. P B1IHC4 Cobyric acid synthase 4.52e-08 1.12e-15 NA NA
5. P Q9A4J7 Carbamoyl-phosphate synthase small chain 4.40e-03 7.88e-03 NA NA
5. P Q31LB7 Carbamoyl-phosphate synthase small chain 3.63e-03 5.82e-03 NA NA
5. P C5A475 Probable cobyric acid synthase 4.43e-06 1.97e-15 NA NA
5. P Q58816 Cobyrinate a,c-diamide synthase 4.02e-05 6.73e-17 NA NA
5. P Q2NEZ9 Probable cobyric acid synthase 1.65e-06 2.53e-14 NA NA
5. P Q92CK0 Cobyric acid synthase 1.61e-05 1.45e-14 NA NA
5. P Q4ZQ64 Cobyric acid synthase 7.17e-04 5.81e-13 NA NA
5. P B3EJS3 Cobyric acid synthase 2.11e-06 1.60e-14 NA NA
5. P Q8G005 Cobyric acid synthase 1.10e-04 6.67e-14 NA NA
5. P Q8FP85 Cobyric acid synthase 4.47e-04 1.22e-17 NA NA
5. P Q0IBR6 Cobyric acid synthase 1.32e-04 2.07e-14 NA NA
5. P Q8Y7T0 Cobyrinate a,c-diamide synthase 3.51e-07 4.72e-19 NA NA
5. P Q0STW6 Cobyric acid synthase 8.11e-07 3.22e-18 NA NA
5. P B1J1N6 Cobyric acid synthase 1.75e-04 3.47e-14 NA NA
5. P C5CKN7 Cobyric acid synthase 3.59e-05 4.29e-13 NA NA
5. P Q10XP0 Cobyric acid synthase 5.26e-05 1.02e-14 NA NA
5. P A0Q0K2 Cobyric acid synthase 1.20e-06 1.44e-16 NA NA
5. P Q2SNC4 Cobyric acid synthase 2.02e-04 2.07e-12 NA NA
5. P Q3ZWJ9 Cobyrinate a,c-diamide synthase 1.60e-07 6.45e-20 NA NA
5. P B0R6F1 Carbamoyl-phosphate synthase small chain 3.95e-03 9.49e-03 NA NA
5. P B9MD32 Cobyric acid synthase 6.31e-05 5.02e-16 NA NA
5. P A5FQW8 Cobyric acid synthase 9.91e-06 7.96e-17 NA NA
5. P Q88M97 Cobyric acid synthase 2.02e-04 1.27e-14 NA NA
5. P Q7ME60 Cobyric acid synthase 1.60e-05 4.79e-13 NA NA
5. P A1S3L6 Cobyric acid synthase 5.00e-05 1.27e-12 NA NA
5. P A9AA97 Probable cobyric acid synthase 4.43e-06 3.56e-16 NA NA
5. P Q8UBP3 Cobyric acid synthase 9.51e-07 4.48e-14 NA NA
5. P Q8DI74 Cobyric acid synthase 2.81e-05 6.08e-12 NA NA
5. P Q28N58 Cobyric acid synthase 2.21e-06 5.33e-15 NA NA
5. P Q2K7B5 Cobyric acid synthase 9.84e-05 1.14e-15 NA NA
5. P Q73VS8 Cobyric acid synthase 4.54e-06 5.17e-14 NA NA
5. P Q1BAC5 Cobyric acid synthase 5.40e-07 9.66e-15 NA NA
5. P Q7U5J9 Cobyric acid synthase 6.52e-05 1.80e-15 NA NA
5. P Q9HK16 Carbamoyl-phosphate synthase small chain 4.37e-03 8.24e-03 NA NA
5. P Q129W6 Cobyric acid synthase 5.47e-04 1.06e-13 NA NA
5. P B8I0R5 Cobyric acid synthase 6.71e-08 2.32e-14 NA NA
5. P Q8YHU1 Hydrogenobyrinate a,c-diamide synthase 1.65e-04 4.48e-14 NA NA
5. P Q8EXQ4 Cobyrinate a,c-diamide synthase 1.34e-06 5.30e-20 NA NA
5. P A3CL74 Cobyric acid synthase 1.32e-05 9.96e-16 NA NA
5. P A9GM36 Cobyric acid synthase 5.80e-08 1.08e-13 NA NA
5. P P29932 Cobyric acid synthase 1.18e-04 3.19e-15 NA NA
5. P C1L2B3 Cobyric acid synthase 1.50e-05 1.37e-13 NA NA
5. P Q180T4 Cobyric acid synthase 1.06e-05 1.28e-17 NA NA
5. P B2IE16 Cobyric acid synthase 2.84e-05 1.85e-15 NA NA
5. P A0QVI7 Cobyric acid synthase 7.52e-06 3.34e-13 NA NA
5. P B1Z9X0 Cobyric acid synthase 2.14e-04 7.89e-15 NA NA
5. P Q605I0 Cobyric acid synthase 9.37e-04 2.93e-11 NA NA
5. P B9LKN1 Cobyric acid synthase 4.59e-05 9.23e-14 NA NA
5. P Q8Q0P3 Probable cobyric acid synthase 2.57e-05 8.98e-16 NA NA
5. P Q9KCI0 Cobyric acid synthase 9.07e-06 9.85e-17 NA NA
5. P A8AEQ8 Cobyric acid synthase 6.71e-07 5.25e-16 NA NA
5. P Q98L33 Cobyric acid synthase 1.76e-04 4.12e-14 NA NA
5. P A7GBV6 Cobyric acid synthase 4.21e-08 2.45e-15 NA NA
5. P Q5MZU1 Cobyrinate a,c-diamide synthase 9.51e-07 7.51e-18 NA NA
5. P Q8XWT0 Cobyric acid synthase 1.27e-04 1.20e-11 NA NA
5. P A4VJ40 Cobyric acid synthase 5.49e-05 1.11e-11 NA NA
5. P A6L4Y5 Cobyric acid synthase 5.21e-05 7.75e-18 NA NA
5. P Q0VLY5 Cobyric acid synthase 9.43e-05 1.25e-11 NA NA
5. P Q9PMG8 Carbamoyl-phosphate synthase small chain 5.83e-03 4.91e-04 NA NA
5. P A4T0R6 Cobyric acid synthase 8.82e-06 8.37e-12 NA NA
5. P Q57908 Probable cobyric acid synthase 2.64e-05 9.67e-16 NA NA
5. P Q3BQB5 Cobyric acid synthase 1.37e-04 8.95e-11 NA NA
5. P B5RBK9 Cobyric acid synthase 6.53e-07 5.33e-16 NA NA
5. P A6UPL5 Probable cobyric acid synthase 3.12e-06 5.81e-15 NA NA
5. P P9WP97 Hydrogenobyrinate a,c-diamide synthase 3.45e-05 1.60e-16 NA NA
5. P B5ET63 Cobyric acid synthase 8.97e-06 4.06e-14 NA NA
5. P B9JX68 Cobyric acid synthase 1.52e-06 4.97e-12 NA NA
5. P A6W1K0 Cobyric acid synthase 3.30e-04 3.68e-13 NA NA
5. P B2G9H7 Cobyric acid synthase 2.55e-06 1.70e-14 NA NA
5. P Q62LF1 Cobyric acid synthase 3.43e-04 1.05e-12 NA NA
5. P Q2JJP4 Cobyric acid synthase 1.22e-05 2.31e-12 NA NA
5. P A9AZZ2 Cobyric acid synthase 1.08e-04 4.95e-15 NA NA
5. P A2BXM3 Cobyric acid synthase 4.85e-05 2.44e-16 NA NA
5. P Q57MX8 Cobyric acid synthase 6.03e-07 9.96e-16 NA NA
5. P A3CX25 Probable cobyric acid synthase 2.36e-05 3.34e-15 NA NA
5. P Q897L4 Cobyric acid synthase 1.51e-06 1.67e-14 NA NA
5. P Q9HLZ8 Probable cobyric acid synthase 2.27e-06 1.58e-16 NA NA
5. P A6TU70 Cobyric acid synthase 4.61e-06 1.01e-14 NA NA
5. P Q5LCE1 Cobyric acid synthase 5.90e-05 4.96e-17 NA NA
5. P Q5N2H9 Cobyric acid synthase 4.54e-05 3.29e-13 NA NA
5. P A6UQC1 Cobyrinate a,c-diamide synthase 4.78e-05 2.17e-16 NA NA
5. P B5XUV5 Cobyric acid synthase 6.39e-06 1.22e-16 NA NA
5. P B2J764 Cobyric acid synthase 9.92e-07 2.87e-13 NA NA
5. P B4SH62 Cobyric acid synthase 1.86e-06 1.46e-15 NA NA
5. P A5EZT5 Cobyric acid synthase 1.28e-04 6.01e-16 NA NA
5. P Q8FZJ8 Carbamoyl-phosphate synthase small chain 5.77e-03 1.40e-02 NA NA
5. P Q8TVH5 Probable cobyric acid synthase 1.36e-05 6.57e-16 NA NA
5. P Q57CK2 Hydrogenobyrinate a,c-diamide synthase 3.27e-05 4.48e-14 NA NA
6. F A5VTV9 Tetraacyldisaccharide 4'-kinase 1.32e-01 NA NA 0.3679
6. F B0BUY7 Tetraacyldisaccharide 4'-kinase 5.13e-02 NA NA 0.3596
6. F Q131B2 Tetraacyldisaccharide 4'-kinase 5.95e-02 NA NA 0.404
6. F A8EZT1 Tetraacyldisaccharide 4'-kinase 4.94e-02 NA NA 0.2988
6. F B4IAD1 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 7.05e-03 NA NA 0.4607
6. F Q7S8Z0 Cytosolic Fe-S cluster assembly factor nbp35 6.13e-03 NA NA 0.4588
6. F B4H7P4 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 5.95e-03 NA NA 0.4502
6. F Q1QIN5 Tetraacyldisaccharide 4'-kinase 8.16e-02 NA NA 0.4044
6. F Q1EAU8 Cytosolic Fe-S cluster assembly factor NBP35 1.88e-02 NA NA 0.4803
6. F B9MP52 ATP-dependent dethiobiotin synthetase BioD 6.02e-07 NA NA 0.6026
6. F C1ANK7 ATP-dependent dethiobiotin synthetase BioD 2.17e-03 NA NA 0.575
6. F A9V7A1 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 3.78e-02 NA NA 0.4811
6. F Q4HZ34 Cytosolic Fe-S cluster assembly factor NBP35 1.81e-02 NA NA 0.4645
6. F Q1MKV3 Tetraacyldisaccharide 4'-kinase 1.35e-01 NA NA 0.3331
6. F B4LGB4 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.16e-02 NA NA 0.4864
6. F Q89DC5 Tetraacyldisaccharide 4'-kinase 8.23e-02 NA NA 0.4141
6. F B4QJ46 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 6.61e-03 NA NA 0.4389
6. F Q6C5D0 Cytosolic Fe-S cluster assembly factor CFD1 3.57e-02 NA NA 0.4437
6. F Q6FPP7 Cytosolic Fe-S cluster assembly factor CFD1 3.32e-03 NA NA 0.4265
6. F P53558 ATP-dependent dethiobiotin synthetase BioD 3.51e-04 NA NA 0.6339
6. F B9JA09 Tetraacyldisaccharide 4'-kinase 1.61e-01 NA NA 0.3517
6. F B4IUH5 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1 6.98e-03 NA NA 0.4454
6. F Q874M2 Cytosolic Fe-S cluster assembly factor NBP35 7.32e-03 NA NA 0.4799
6. F Q8X0F1 Cytosolic Fe-S cluster assembly factor cfd1 3.02e-02 NA NA 0.4258
6. F Q5HKF0 ATP-dependent dethiobiotin synthetase BioD 3.39e-06 NA NA 0.5722
6. F B1LYS1 Tetraacyldisaccharide 4'-kinase 8.34e-02 NA NA 0.3585
6. F B3NIP2 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 6.96e-03 NA NA 0.4461
6. F Q29DB7 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 5.94e-03 NA NA 0.4512
6. F A9W6S6 Tetraacyldisaccharide 4'-kinase 6.26e-02 NA NA 0.3444
6. F Q5F9Z2 Tetraacyldisaccharide 4'-kinase 1.73e-01 NA NA 0.3252
6. F C4K0S8 Tetraacyldisaccharide 4'-kinase 5.22e-02 NA NA 0.337
6. F Q5BBC5 Cytosolic Fe-S cluster assembly factor nbp35 6.20e-03 NA NA 0.461
6. F Q4WEN1 Cytosolic Fe-S cluster assembly factor cfd1 3.48e-02 NA NA 0.3942
6. F P0C8Q1 Cytosolic Fe-S cluster assembly factor cfd1 3.42e-02 NA NA 0.3769
6. F P72190 Iron-sulfur cluster carrier protein 1.37e-02 NA NA 0.4547
6. F P58186 Tetraacyldisaccharide 4'-kinase 4.33e-02 NA NA 0.3188
6. F Q2YIH4 Tetraacyldisaccharide 4'-kinase 1.43e-01 NA NA 0.358
6. F Q0UAM9 Cytosolic Fe-S cluster assembly factor CFD1 4.15e-02 NA NA 0.4431
6. F Q1DSY6 Cytosolic Fe-S cluster assembly factor CFD1 2.46e-02 NA NA 0.3407
6. F P53382 Iron-sulfur cluster carrier protein 1.85e-01 NA NA 0.4021
6. F Q5EB25 Cytosolic Fe-S cluster assembly factor nubp1 2.57e-02 NA NA 0.4472
6. F Q6DEE4 Cytosolic Fe-S cluster assembly factor nubp2 5.77e-03 NA NA 0.4475
6. F Q5ZKV4 Cytosolic Fe-S cluster assembly factor NUBP2 4.91e-02 NA NA 0.4854
6. F C0QVL9 ATP-dependent dethiobiotin synthetase BioD 1.20e-03 NA NA 0.6084
6. F A1C4X8 Cytosolic Fe-S cluster assembly factor cfd1 3.03e-02 NA NA 0.3414
6. F Q2GWZ4 Cytosolic Fe-S cluster assembly factor CFD1 2.25e-02 NA NA 0.4374
6. F B5ZRZ4 Tetraacyldisaccharide 4'-kinase 1.09e-01 NA NA 0.3351
6. F Q8UHI5 Tetraacyldisaccharide 4'-kinase 1.29e-01 NA NA 0.3286
6. F Q92GN1 Tetraacyldisaccharide 4'-kinase 5.32e-02 NA NA 0.3573
6. F B4UKM8 ATP-dependent dethiobiotin synthetase BioD 1.02e-06 NA NA 0.6299
6. F A1C7T4 Cytosolic Fe-S cluster assembly factor nbp35 1.71e-02 NA NA 0.4858
6. F Q9CN08 ATP-dependent dethiobiotin synthetase BioD 1 4.54e-06 NA NA 0.5783
6. F A6U6K3 Tetraacyldisaccharide 4'-kinase 1.32e-01 NA NA 0.3294
6. F Q2UA27 Cytosolic Fe-S cluster assembly factor cfd1 4.15e-02 NA NA 0.3811
6. F A1BDV6 Tetraacyldisaccharide 4'-kinase 1.03e-01 NA NA 0.3692
6. F Q4G386 Putative septum site-determining protein MinD 4.72e-03 NA NA 0.4923
6. F Q8KBV6 Tetraacyldisaccharide 4'-kinase 1.42e-01 NA NA 0.325
6. F A7SE07 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 5.64e-02 NA NA 0.4076
6. F Q6CQV4 Cytosolic Fe-S cluster assembly factor CFD1 5.67e-03 NA NA 0.431
6. F A8GXU5 Tetraacyldisaccharide 4'-kinase 5.65e-02 NA NA 0.3526
6. F B3M9R3 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.77e-02 NA NA 0.4645
6. F Q8CQD8 ATP-dependent dethiobiotin synthetase BioD 5.02e-06 NA NA 0.5633
6. F O25098 Septum site-determining protein MinD 1.67e-02 NA NA 0.4599
6. F B0BQL1 Tetraacyldisaccharide 4'-kinase 1.10e-01 NA NA 0.3308
6. F A0PYU7 ATP-dependent dethiobiotin synthetase BioD 1.50e-07 NA NA 0.6035
6. F A3N1S8 Tetraacyldisaccharide 4'-kinase 1.03e-01 NA NA 0.3342
6. F B4N4D9 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.99e-02 NA NA 0.4595
6. F P58187 Tetraacyldisaccharide 4'-kinase 5.15e-02 NA NA 0.3585
6. F A7Z5B3 ATP-dependent dethiobiotin synthetase BioD 6.50e-04 NA NA 0.6681
6. F P58185 Tetraacyldisaccharide 4'-kinase 1.14e-01 NA NA 0.3184
6. F B0XDJ0 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.83e-02 NA NA 0.4677
6. F A8F2K3 Tetraacyldisaccharide 4'-kinase 4.34e-02 NA NA 0.3405
6. F Q8ZNN5 Iron-sulfur cluster carrier protein 2.02e-02 NA NA 0.4425
6. F B5YHS9 ATP-dependent dethiobiotin synthetase BioD 1.01e-06 NA NA 0.6296
6. F P45209 ATP-dependent dethiobiotin synthetase BioD 1 3.47e-06 NA NA 0.5993
6. F P0AF09 Iron-sulfur cluster carrier protein 2.03e-02 NA NA 0.4527
6. F B4IYG8 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.77e-02 NA NA 0.4459
6. F P65325 Tetraacyldisaccharide 4'-kinase 1.05e-01 NA NA 0.356
6. F P58188 Tetraacyldisaccharide 4'-kinase 9.14e-02 NA NA 0.3585
6. F B3PRD6 Tetraacyldisaccharide 4'-kinase 1.23e-01 NA NA 0.3225
6. F B8IPK9 Tetraacyldisaccharide 4'-kinase 6.04e-02 NA NA 0.3559
6. F P65442 Iron-sulfur cluster carrier protein 1.55e-01 NA NA 0.4293
6. F Q2KBX9 Tetraacyldisaccharide 4'-kinase 1.14e-01 NA NA 0.3242
6. F B0UJ62 Tetraacyldisaccharide 4'-kinase 9.04e-02 NA NA 0.3839
6. F Q1RK48 Tetraacyldisaccharide 4'-kinase 9.64e-02 NA NA 0.353
6. F A4QNM5 Cytosolic Fe-S cluster assembly factor nubp2 4.80e-02 NA NA 0.4212
6. F Q2UDE2 Cytosolic Fe-S cluster assembly factor nbp35 5.98e-03 NA NA 0.4791
6. F B3H250 Tetraacyldisaccharide 4'-kinase 1.08e-01 NA NA 0.326
6. F B4KY56 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.62e-02 NA NA 0.4326
6. F B4PES4 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 2 6.64e-03 NA NA 0.4409
6. F Q8FPS0 ATP-dependent dethiobiotin synthetase BioD 2.55e-03 NA NA 0.6197
6. F B4N1C3 Cytosolic Fe-S cluster assembly factor NUBP1 homolog 2.94e-02 NA NA 0.495
6. F Q11L82 Tetraacyldisaccharide 4'-kinase 9.47e-02 NA NA 0.3426
6. F P49865 Protein NtpR 2.12e-07 NA NA 0.6066
6. F Q0UI56 Cytosolic Fe-S cluster assembly factor NBP35 1.71e-02 NA NA 0.4656
6. F Q0CVD6 Cytosolic Fe-S cluster assembly factor nbp35 3.18e-02 NA NA 0.4495
6. F Q2H317 Cytosolic Fe-S cluster assembly factor NBP35 6.51e-03 NA NA 0.4503
6. F Q8KZM8 ATP-dependent dethiobiotin synthetase BioD 3.53e-04 NA NA 0.6617
6. F B0T114 Tetraacyldisaccharide 4'-kinase 6.62e-02 NA NA 0.3411
6. F A5CVZ9 Tetraacyldisaccharide 4'-kinase 5.98e-02 NA NA 0.3792
6. F Q6CMN0 Cytosolic Fe-S cluster assembly factor NBP35 5.90e-03 NA NA 0.4606
6. F A4SPR4 ATP-dependent dethiobiotin synthetase BioD 2.66e-06 NA NA 0.5876
6. F Q7QGS3 Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1.40e-02 NA NA 0.4488
6. F Q4WZS2 Cytosolic Fe-S cluster assembly factor nbp35 2.00e-02 NA NA 0.4536
6. F P9WJN6 Iron-sulfur cluster carrier protein 1.69e-01 NA NA 0.4295
6. F B3NNJ9 Cytosolic Fe-S cluster assembly factor NUBP1 homolog 9.57e-03 NA NA 0.4445
6. F Q6C7A6 Cytosolic Fe-S cluster assembly factor NBP35 6.82e-03 NA NA 0.4885
6. F A5H2P4 Pentafunctional AROM polypeptide 2 2.71e-01 NA NA 0.2002
6. F Q6LZC5 Iron-sulfur cluster carrier protein 1.04e-02 NA NA 0.4229
6. F Q0C4B4 Tetraacyldisaccharide 4'-kinase 7.64e-02 NA NA 0.3733
6. F A4XGB6 ATP-dependent dethiobiotin synthetase BioD 6.40e-07 NA NA 0.6113
7. B O28019 Imidazole glycerol phosphate synthase subunit HisH 4.80e-05 NA 0.015 NA
7. B Q93DW6 CTP synthase (Fragment) 6.33e-13 NA 6.49e-62 NA
7. B Q9ZDC7 Putative glutamine amidotransferase-like protein RP404 3.26e-07 NA 0.011 NA