Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54629.1

JCVISYN3A_0132

Toxin-antitoxin AAA ATPase.
M. mycoides homolog: Q6MRS8.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 339
Unique PROST Go: 17
Unique BLAST Go: 157
Unique Foldseek Go: 5

Total Homologs: 2574
Unique PROST Homologs: 1225
Unique BLAST Homologs: 285
Unique Foldseek Homologs: 563

Literature

Danchin and Fang [1]: ATP-dependent informational activity|not ClpX (no cysteine cluster); not FtsH (no membrane binding); not Lon, not Clp; involved in global protein disaggregation
Yang and Tsui [2]: ATP-dependent zinc metalloprotease HflB
Antczak et al. [3]: ATPase, AAA family
Zhang et al. [4]: GO:0045898|regulation of RNA polymerase II transcriptional preinitiation complex assembly
Bianchi et al. [5]: AAA+ ATPase

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was F2Z6D2 (Cell division protein C) with a FATCAT P-Value: 1.28e-09 and RMSD of 2.98 angstrom. The sequence alignment identity is 27.2%.
Structural alignment shown in left. Query protein AVX54629.1 colored as red in alignment, homolog F2Z6D2 colored as blue. Query protein AVX54629.1 is also shown in right top, homolog F2Z6D2 showed in right bottom. They are colored based on secondary structures.

  AVX54629.1 MKKANVL--NLIR-YHIEENDISFRKEARIIAEEF---YKMGDDELAEYV-LFMLRDAN--HFVPQIDQEY----DI---QIP----------FTQ-KI- 72
      F2Z6D2 M-SAQVMLEEMARKYAI--NAVKADKEGN--AEEAITNYKKAIEVLAQLVSLY--RDGSTAAIYEQMINEYKRRIEVLKELIPADGAGNGNGKHSQVSVD 93

  AVX54629.1 ELERNSEP-LPLPQVIS-EEIKGVIN-AI-SKNRKINKF--------LFQGFPGTGKTETVKQIARILNRNLFMVDFNNLIDSHLGQSSKNIAELFQKIN 160
      F2Z6D2 DLVMKEKPKVNFNDIVGLEDVKEALKEAIVYPTRRPDLFPLGWPRGILVYGPPGCGKTMIAAAVANEIDSYFIQVDAASVMSKWLGEAEKNVAKIFNSAR 193

  AVX54629.1 Q--TPNPKKIIICFDEIDALALDRTNKTDLREMG---RVTTAV---FQGL-DKLDT-DIIVFATTNLFK--HFDKALIRRFDLVIDFNR-YTKKDML-DI 246
      F2Z6D2 ELSKKDGKPVIIFIDEIDAL-LGTYN----SENGGEVRVRNQFLKEMDGLQDKSENFKVYVIGATN--KPWRLDEPFLRRFQ-----KRIYIR---LPDI 278

  AVX54629.1 AE---IILKHYI-K-KVDNIK-SELRLFRKIISLSEELIY-PGDLKNIIKSSIYLSDYEDQYDYLKRIYKKITDDKLD-IRQLNENNFTVREIEILKGLS 338
      F2Z6D2 EQRKSLLL-HYTSKIKMDNVNIDEL---AK---MTEG--YTASDIKDIVQAA-HI-----------RVVKEMFDKKLEQPRAVNMEDFK----EILK-IR 352

  AVX54629.1 KSSV---ALKV--------KELNSNE 353
      F2Z6D2 KPSVNSEVIKVYEAWHEKYKAL---- 374

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0000502	proteasome complex
1. PBF	GO:0005778	peroxisomal membrane
1. PBF	GO:0022624	proteasome accessory complex
1. PBF	GO:0022623	proteasome-activating nucleotidase complex
1. PBF	GO:0140603	obsolete ATP hydrolysis activity
1. PBF	GO:0045899	positive regulation of RNA polymerase II transcription preinitiation complex assembly
1. PBF	GO:0030433	ubiquitin-dependent ERAD pathway
1. PBF	GO:0005634	nucleus
1. PBF	GO:0043335	protein unfolding
1. PBF	GO:0140567	transmembrane protein dislocase activity
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0051261	protein depolymerization
1. PBF	GO:0036402	proteasome-activating activity
1. PBF	GO:0032510	endosome to lysosome transport via multivesicular body sorting pathway
1. PBF	GO:0031597	cytosolic proteasome complex
1. PBF	GO:0008540	proteasome regulatory particle, base subcomplex
1. PBF	GO:0008270	zinc ion binding
1. PBF	GO:0016887	ATP hydrolysis activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0008568	microtubule-severing ATPase activity
1. PBF	GO:0019941	modification-dependent protein catabolic process
1. PBF	GO:0010498	proteasomal protein catabolic process
1. PBF	GO:0030163	protein catabolic process
1. PBF	GO:0140570	extraction of mislocalized protein from mitochondrial outer membrane
1. PBF	GO:0006508	proteolysis
2. PF	GO:0031411	gas vesicle
2. PF	GO:0009378	four-way junction helicase activity
2. PF	GO:0046863	ribulose-1,5-bisphosphate carboxylase/oxygenase activator activity
2. PF	GO:0009432	SOS response
2. PF	GO:0003688	DNA replication origin binding
2. PF	GO:0006281	DNA repair
2. PF	GO:0005829	cytosol
2. PF	GO:0016020	membrane
2. PF	GO:0005739	mitochondrion
2. PF	GO:0006310	DNA recombination
2. PF	GO:0006270	DNA replication initiation
2. PF	GO:0006275	regulation of DNA replication
2. PF	GO:0031412	gas vesicle organization
3. BF	GO:0016558	protein import into peroxisome matrix
3. BF	GO:0003677	DNA binding
3. BF	GO:0004176	ATP-dependent peptidase activity
3. BF	GO:1900074	negative regulation of neuromuscular synaptic transmission
3. BF	GO:0005819	spindle
3. BF	GO:0005811	lipid droplet
3. BF	GO:0045886	negative regulation of synaptic assembly at neuromuscular junction
3. BF	GO:0048487	beta-tubulin binding
3. BF	GO:0106300	protein-DNA covalent cross-linking repair
3. BF	GO:0050775	positive regulation of dendrite morphogenesis
3. BF	GO:0031468	nuclear membrane reassembly
3. BF	GO:0045834	positive regulation of lipid metabolic process
3. BF	GO:0032506	cytokinetic process
3. BF	GO:0051228	mitotic spindle disassembly
3. BF	GO:0034098	VCP-NPL4-UFD1 AAA ATPase complex
3. BF	GO:1904115	axon cytoplasm
3. BF	GO:0008344	adult locomotory behavior
3. BF	GO:0004222	metalloendopeptidase activity
3. BF	GO:0035617	stress granule disassembly
3. BF	GO:0007409	axonogenesis
3. BF	GO:0007026	negative regulation of microtubule depolymerization
3. BF	GO:0031117	positive regulation of microtubule depolymerization
3. BF	GO:0045887	positive regulation of synaptic assembly at neuromuscular junction
3. BF	GO:0019985	translesion synthesis
3. BF	GO:0035099	hemocyte migration
3. BF	GO:0031531	thyrotropin-releasing hormone receptor binding
3. BF	GO:0031595	nuclear proteasome complex
3. BF	GO:2000331	regulation of terminal button organization
3. BF	GO:0000281	mitotic cytokinesis
3. BF	GO:0097431	mitotic spindle pole
3. BF	GO:0043195	terminal bouton
3. BF	GO:0034214	protein hexamerization
3. BF	GO:0046872	metal ion binding
3. BF	GO:0008089	anterograde axonal transport
3. BF	GO:0031122	cytoplasmic microtubule organization
3. BF	GO:0016562	protein import into peroxisome matrix, receptor recycling
3. BF	GO:0071712	ER-associated misfolded protein catabolic process
3. BF	GO:0010458	exit from mitosis
3. BF	GO:0000922	spindle pole
3. BF	GO:0005874	microtubule
3. BF	GO:0031594	neuromuscular junction
3. BF	GO:0016853	isomerase activity
3. BF	GO:0008017	microtubule binding
3. BF	GO:0000022	mitotic spindle elongation
3. BF	GO:0030970	retrograde protein transport, ER to cytosol
3. BF	GO:0007079	mitotic chromosome movement towards spindle pole
3. BF	GO:0090148	membrane fission
3. BF	GO:1900075	positive regulation of neuromuscular synaptic transmission
3. BF	GO:1903843	cellular response to arsenite ion
3. BF	GO:0008021	synaptic vesicle
3. BF	GO:0000287	magnesium ion binding
3. BF	GO:0005813	centrosome
3. BF	GO:0061857	endoplasmic reticulum stress-induced pre-emptive quality control
3. BF	GO:0140296	general transcription initiation factor binding
3. BF	GO:0019896	axonal transport of mitochondrion
3. BF	GO:0001578	microtubule bundle formation
3. BF	GO:1905634	regulation of protein localization to chromatin
3. BF	GO:0036503	ERAD pathway
3. BF	GO:0030496	midbody
3. BF	GO:0051013	microtubule severing
3. BF	GO:0048691	positive regulation of axon extension involved in regeneration
3. BF	GO:0009579	thylakoid
3. BF	GO:0097352	autophagosome maturation
3. BF	GO:0043014	alpha-tubulin binding
3. BF	GO:0017025	TBP-class protein binding
3. BF	GO:0036297	interstrand cross-link repair
3. BF	GO:0015630	microtubule cytoskeleton
4. PB	GO:0001556	oocyte maturation
4. PB	GO:0048477	oogenesis
4. PB	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
4. PB	GO:1903724	positive regulation of centriole elongation
4. PB	GO:0030301	cholesterol transport
4. PB	GO:0032367	intracellular cholesterol transport
4. PB	GO:0007612	learning
4. PB	GO:0061641	CENP-A containing chromatin organization
4. PB	GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
4. PB	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
4. PB	GO:0039702	viral budding via host ESCRT complex
4. PB	GO:0034058	endosomal vesicle fusion
4. PB	GO:0007094	mitotic spindle assembly checkpoint signaling
4. PB	GO:0007286	spermatid development
4. PB	GO:0007130	synaptonemal complex assembly
4. PB	GO:0061738	late endosomal microautophagy
4. PB	GO:0140545	protein disaggregase activity
4. PB	GO:0072319	vesicle uncoating
4. PB	GO:0033993	response to lipid
4. PB	GO:0051967	negative regulation of synaptic transmission, glutamatergic
4. PB	GO:1903542	negative regulation of exosomal secretion
4. PB	GO:0007131	reciprocal meiotic recombination
4. PB	GO:0002092	positive regulation of receptor internalization
4. PB	GO:1903076	regulation of protein localization to plasma membrane
4. PB	GO:0006900	vesicle budding from membrane
4. PB	GO:1904903	ESCRT III complex disassembly
4. PB	GO:1904896	ESCRT complex disassembly
4. PB	GO:0032466	negative regulation of cytokinesis
4. PB	GO:0009838	abscission
4. PB	GO:0007080	mitotic metaphase plate congression
4. PB	GO:0051598	meiotic recombination checkpoint signaling
4. PB	GO:1903543	positive regulation of exosomal secretion
4. PB	GO:0036258	multivesicular body assembly
4. PB	GO:0044878	mitotic cytokinesis checkpoint signaling
4. PB	GO:0006997	nucleus organization
4. PB	GO:0016021	integral component of membrane
4. PB	GO:1903902	positive regulation of viral life cycle
4. PB	GO:0046761	viral budding from plasma membrane
4. PB	GO:0006302	double-strand break repair
4. PB	GO:0007141	male meiosis I
4. PB	GO:0006622	protein targeting to lysosome
4. PB	GO:0031902	late endosome membrane
4. PB	GO:0090543	Flemming body
4. PB	GO:0016197	endosomal transport
4. PB	GO:1901673	regulation of mitotic spindle assembly
4. PB	GO:0001673	male germ cell nucleus
4. PB	GO:0061952	midbody abscission
4. PB	GO:0007033	vacuole organization
4. PB	GO:0007144	female meiosis I
4. PB	GO:0140035	ubiquitination-like modification-dependent protein binding
4. PB	GO:0090261	positive regulation of inclusion body assembly
4. PB	GO:0005741	mitochondrial outer membrane
4. PB	GO:1903774	positive regulation of viral budding via host ESCRT complex
4. PB	GO:1990621	ESCRT IV complex
4. PB	GO:1902188	obsolete positive regulation of viral release from host cell
5. P	GO:0016851	magnesium chelatase activity
5. P	GO:0046983	protein dimerization activity
5. P	GO:0032297	negative regulation of DNA-dependent DNA replication initiation
5. P	GO:0030494	bacteriochlorophyll biosynthetic process
5. P	GO:0006260	DNA replication
5. P	GO:0051082	unfolded protein binding
5. P	GO:2000155	positive regulation of cilium-dependent cell motility
5. P	GO:0030164	protein denaturation
5. P	GO:0032508	DNA duplex unwinding
5. P	GO:1901202	negative regulation of extracellular matrix assembly
5. P	GO:0070581	rolling circle DNA replication
5. P	GO:0005886	plasma membrane
5. P	GO:0005654	nucleoplasm
5. P	GO:0020023	kinetoplast
5. P	GO:0006457	protein folding
5. P	GO:0007049	cell cycle
5. P	GO:0009376	HslUV protease complex
6. F	GO:0009570	chloroplast stroma
6. F	GO:0042645	mitochondrial nucleoid
6. F	GO:0009360	DNA polymerase III complex
6. F	GO:0003689	DNA clamp loader activity
6. F	GO:0072715	cellular response to selenite ion
7. B	GO:0034605	cellular response to heat
7. B	GO:0021675	nerve development
7. B	GO:0003697	single-stranded DNA binding
7. B	GO:1990730	VCP-NSFL1C complex
7. B	GO:0006625	protein targeting to peroxisome
7. B	GO:0035255	ionotropic glutamate receptor binding
7. B	GO:0032042	mitochondrial DNA metabolic process
7. B	GO:0009408	response to heat
7. B	GO:0007292	female gamete generation
7. B	GO:0005777	peroxisome
7. B	GO:0008053	mitochondrial fusion
7. B	GO:0006891	intra-Golgi vesicle-mediated transport
7. B	GO:1904813	ficolin-1-rich granule lumen
7. B	GO:0042555	MCM complex
7. B	GO:0003924	GTPase activity
7. B	GO:0035266	meristem growth
7. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
7. B	GO:0001921	positive regulation of receptor recycling
7. B	GO:0039529	RIG-I signaling pathway
7. B	GO:0031593	polyubiquitin modification-dependent protein binding
7. B	GO:0035861	site of double-strand break
7. B	GO:0035694	mitochondrial protein catabolic process
7. B	GO:0045879	negative regulation of smoothened signaling pathway
7. B	GO:0042802	identical protein binding
7. B	GO:0005576	extracellular region
7. B	GO:0051229	meiotic spindle disassembly
7. B	GO:0032467	positive regulation of cytokinesis
7. B	GO:0097002	mitochondrial inner boundary membrane
7. B	GO:0048827	phyllome development
7. B	GO:0032979	protein insertion into mitochondrial inner membrane from matrix
7. B	GO:0010091	trichome branching
7. B	GO:0045037	protein import into chloroplast stroma
7. B	GO:0070414	trehalose metabolism in response to heat stress
7. B	GO:0043273	CTPase activity
7. B	GO:0005887	integral component of plasma membrane
7. B	GO:0055001	muscle cell development
7. B	GO:0010304	PSII associated light-harvesting complex II catabolic process
7. B	GO:0140374	antiviral innate immune response
7. B	GO:0070651	nonfunctional rRNA decay
7. B	GO:0007283	spermatogenesis
7. B	GO:0043008	ATP-dependent protein binding
7. B	GO:0005759	mitochondrial matrix
7. B	GO:0048564	photosystem I assembly
7. B	GO:0042288	MHC class I protein binding
7. B	GO:1990112	RQC complex
7. B	GO:0051973	positive regulation of telomerase activity
7. B	GO:1990171	SCF complex disassembly in response to cadmium stress
7. B	GO:0007084	mitotic nuclear membrane reassembly
7. B	GO:0010008	endosome membrane
7. B	GO:0034599	cellular response to oxidative stress
7. B	GO:0006515	protein quality control for misfolded or incompletely synthesized proteins
7. B	GO:0051560	mitochondrial calcium ion homeostasis
7. B	GO:0007032	endosome organization
7. B	GO:0006734	NADH metabolic process
7. B	GO:0016236	macroautophagy
7. B	GO:0021955	central nervous system neuron axonogenesis
7. B	GO:0034551	mitochondrial respiratory chain complex III assembly
7. B	GO:0044389	ubiquitin-like protein ligase binding
7. B	GO:0062091	Ycf2/FtsHi complex
7. B	GO:0043565	sequence-specific DNA binding
7. B	GO:0009941	chloroplast envelope
7. B	GO:0098527	neuromuscular junction of somatic muscle
7. B	GO:0070842	aggresome assembly
7. B	GO:0042026	protein refolding
7. B	GO:0051260	protein homooligomerization
7. B	GO:0005782	peroxisomal matrix
7. B	GO:0016464	chloroplast protein-transporting ATPase activity
7. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
7. B	GO:0010078	maintenance of root meristem identity
7. B	GO:1990381	ubiquitin-specific protease binding
7. B	GO:0044877	protein-containing complex binding
7. B	GO:0090736	MATH domain binding
7. B	GO:0070682	proteasome regulatory particle assembly
7. B	GO:0000055	ribosomal large subunit export from nucleus
7. B	GO:0010971	positive regulation of G2/M transition of mitotic cell cycle
7. B	GO:0070407	oxidation-dependent protein catabolic process
7. B	GO:0003723	RNA binding
7. B	GO:0098794	postsynapse
7. B	GO:0046034	ATP metabolic process
7. B	GO:0045211	postsynaptic membrane
7. B	GO:1901800	positive regulation of proteasomal protein catabolic process
7. B	GO:0033687	osteoblast proliferation
7. B	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway
7. B	GO:0016320	endoplasmic reticulum membrane fusion
7. B	GO:0043572	plastid fission
7. B	GO:0031942	i-AAA complex
7. B	GO:2001171	positive regulation of ATP biosynthetic process
7. B	GO:0042273	ribosomal large subunit biogenesis
7. B	GO:0065003	protein-containing complex assembly
7. B	GO:1990116	ribosome-associated ubiquitin-dependent protein catabolic process
7. B	GO:0060013	righting reflex
7. B	GO:0042407	cristae formation
7. B	GO:0001824	blastocyst development
7. B	GO:0010918	positive regulation of mitochondrial membrane potential
7. B	GO:0031445	regulation of heterochromatin assembly
7. B	GO:0010569	regulation of double-strand break repair via homologous recombination
7. B	GO:0016561	protein import into peroxisome matrix, translocation
7. B	GO:0000932	P-body
7. B	GO:1903006	positive regulation of protein K63-linked deubiquitination
7. B	GO:0034982	mitochondrial protein processing
7. B	GO:0016234	inclusion body
7. B	GO:1903862	positive regulation of oxidative phosphorylation
7. B	GO:0050804	modulation of chemical synaptic transmission
7. B	GO:0048211	Golgi vesicle docking
7. B	GO:0005838	proteasome regulatory particle
7. B	GO:0048471	perinuclear region of cytoplasm
7. B	GO:0036444	calcium import into the mitochondrion
7. B	GO:0006511	ubiquitin-dependent protein catabolic process
7. B	GO:0050807	regulation of synapse organization
7. B	GO:0007031	peroxisome organization
7. B	GO:0007005	mitochondrion organization
7. B	GO:0033619	membrane protein proteolysis
7. B	GO:0051131	chaperone-mediated protein complex assembly
7. B	GO:0031965	nuclear membrane
7. B	GO:0072389	flavin adenine dinucleotide catabolic process
7. B	GO:0005795	Golgi stack
7. B	GO:0031969	chloroplast membrane
7. B	GO:0000228	nuclear chromosome
7. B	GO:1904749	regulation of protein localization to nucleolus
7. B	GO:0010205	photoinhibition
7. B	GO:0017075	syntaxin-1 binding
7. B	GO:0010206	photosystem II repair
7. B	GO:0043001	Golgi to plasma membrane protein transport
7. B	GO:1903715	regulation of aerobic respiration
7. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
7. B	GO:0010494	cytoplasmic stress granule
7. B	GO:0000262	mitochondrial chromosome
7. B	GO:1901858	regulation of mitochondrial DNA metabolic process
7. B	GO:0009534	chloroplast thylakoid
7. B	GO:0060152	microtubule-based peroxisome localization
7. B	GO:0048232	male gamete generation
7. B	GO:0005768	endosome
7. B	GO:0035494	SNARE complex disassembly
7. B	GO:0016485	protein processing
7. B	GO:0004252	serine-type endopeptidase activity
7. B	GO:1904288	BAT3 complex binding
7. B	GO:0036266	Cdc48p-Npl4p-Vms1p AAA ATPase complex
7. B	GO:0002090	regulation of receptor internalization
7. B	GO:1990275	preribosome binding
7. B	GO:0036435	K48-linked polyubiquitin modification-dependent protein binding
7. B	GO:1904949	ATPase complex
7. B	GO:0045732	positive regulation of protein catabolic process
7. B	GO:1902120	negative regulation of meiotic spindle elongation
7. B	GO:0009524	phragmoplast
7. B	GO:0005694	chromosome
7. B	GO:0032984	protein-containing complex disassembly
7. B	GO:0036513	Derlin-1 retrotranslocation complex
7. B	GO:1903007	positive regulation of Lys63-specific deubiquitinase activity
7. B	GO:0097733	photoreceptor cell cilium
7. B	GO:0048675	axon extension
7. B	GO:0035800	deubiquitinase activator activity
7. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
7. B	GO:0008022	protein C-terminus binding
7. B	GO:0031936	obsolete negative regulation of chromatin silencing
7. B	GO:0043921	modulation by host of viral transcription
7. B	GO:0071479	cellular response to ionizing radiation
7. B	GO:0005745	m-AAA complex

Uniprot GO Annotations

GO	Description
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	D4GUJ7	Proteasome-activating nucleotidase 1	1.47e-06	6.65e-03	1.87e-08	0.6758
1. PBF	C4KIR6	Proteasome-activating nucleotidase	8.58e-07	7.83e-03	6.59e-08	0.6445
1. PBF	A1KKF8	Proteasome-associated ATPase	1.08e-04	4.07e-02	0.009	0.5091
1. PBF	F2Z6D2	Cell division protein C	1.28e-09	3.93e-13	3.24e-07	0.5238
1. PBF	Q980M1	Proteasome-activating nucleotidase	4.24e-06	1.89e-03	1.17e-08	0.6757
1. PBF	Q8SQI9	26S proteasome regulatory subunit 6B homolog	9.93e-07	1.51e-03	3.89e-06	0.7237
1. PBF	F6QV99	Outer mitochondrial transmembrane helix translocase	7.88e-07	1.49e-09	2.82e-06	0.4973
1. PBF	Q47NX7	Proteasome-associated ATPase	2.55e-05	1.01e-03	0.006	0.5231
1. PBF	B1VDV2	AAA ATPase forming ring-shaped complexes	1.97e-05	4.96e-07	1.33e-04	0.5664
1. PBF	C3MRF1	Proteasome-activating nucleotidase	6.29e-07	7.83e-03	6.59e-08	0.648
1. PBF	C3MY47	Proteasome-activating nucleotidase	2.61e-06	7.83e-03	6.59e-08	0.6511
1. PBF	A8QFF6	Probable spastin homolog Bm1_53365	3.26e-08	2.20e-02	6.72e-05	0.4978
1. PBF	O27092	Putative 26S proteasome regulatory subunit homolog MTH_1011	9.50e-07	2.25e-07	9.70e-13	0.6982
1. PBF	A2XUN8	Pachytene checkpoint protein 2 homolog	1.43e-05	8.20e-03	6.13e-08	0.4307
1. PBF	P0DTF4	CD-NTase-associated protein 6	6.09e-07	5.66e-13	3.61e-09	0.6042
1. PBF	Q0VD48	Vacuolar protein sorting-associated protein 4B	5.21e-06	1.97e-04	8.17e-07	0.5366
1. PBF	D2ATX1	Proteasome-associated ATPase	4.83e-05	2.99e-02	0.015	0.526
1. PBF	Q975U2	Proteasome-activating nucleotidase	2.16e-07	2.94e-03	3.62e-05	0.6747
1. PBF	P55530	Uncharacterized AAA family ATPase y4kL	1.00e-12	8.51e-21	1.17e-16	0.646
1. PBF	A4G0S4	Proteasome-activating nucleotidase	1.47e-06	3.52e-02	1.17e-09	0.6913
1. PBF	Q2KIW6	26S proteasome regulatory subunit 10B	2.44e-06	5.35e-03	5.48e-09	0.5904
1. PBF	C3NFW6	Proteasome-activating nucleotidase	5.52e-07	7.56e-03	6.89e-08	0.6477
1. PBF	B6YXR2	Proteasome-activating nucleotidase	2.66e-06	5.81e-03	6.49e-10	0.6728
1. PBF	D2S6D9	Proteasome-associated ATPase	2.98e-05	3.22e-03	0.009	0.5377
1. PBF	C5A6P8	Proteasome-activating nucleotidase	6.63e-06	1.44e-02	2.22e-08	0.6237
1. PBF	P46470	26S proteasome regulatory subunit 8	2.18e-06	1.50e-04	8.38e-05	0.6082
1. PBF	P42811	Putative 26S proteasome regulatory subunit homolog MTBMA_c13930	7.25e-07	5.94e-07	8.84e-12	0.6949
1. PBF	Q5R658	Vacuolar protein sorting-associated protein 4B	8.27e-07	3.94e-04	2.84e-06	0.5058
1. PBF	A8LH57	Proteasome-associated ATPase	6.50e-05	1.88e-02	0.035	0.5169
1. PBF	C7R400	Proteasome-associated ATPase	3.74e-05	6.02e-08	0.005	0.5277
1. PBF	B4F6J6	Outer mitochondrial transmembrane helix translocase	6.24e-07	5.99e-10	5.22e-06	0.5194
1. PBF	D0FH76	Vacuolar protein sorting-associated protein 4	5.09e-06	3.99e-03	1.17e-06	0.4313
1. PBF	Q8SQK0	26S proteasome regulatory subunit 8 homolog	5.44e-07	5.30e-03	1.94e-06	0.6314
1. PBF	Q9V287	Proteasome-activating nucleotidase	1.74e-06	5.25e-03	5.49e-09	0.6767
1. PBF	C3MZI6	Proteasome-activating nucleotidase	6.01e-07	7.83e-03	6.59e-08	0.6742
1. PBF	A1TAQ3	Proteasome-associated ATPase	2.25e-05	3.46e-02	0.007	0.5048
1. PBF	Q6LWR0	Proteasome-activating nucleotidase	1.59e-06	3.34e-02	3.23e-09	0.7234
1. PBF	C7PVU9	Proteasome-associated ATPase	6.61e-06	3.34e-02	0.006	0.5286
1. PBF	B8ZRF0	Proteasome-associated ATPase	1.41e-04	1.62e-02	0.008	0.5097
1. PBF	C7MCZ0	AAA ATPase forming ring-shaped complexes	2.59e-05	3.83e-05	0.020	0.5309
1. PBF	O57940	Proteasome-activating nucleotidase	6.36e-06	3.55e-02	6.75e-09	0.661
1. PBF	A0LU46	Proteasome-associated ATPase	4.78e-05	7.08e-04	0.017	0.52
1. PBF	Q9HRW6	Proteasome-activating nucleotidase 1	2.20e-06	2.00e-02	1.39e-08	0.7104
1. PBF	D1A2S5	Proteasome-associated ATPase	5.42e-05	8.35e-03	0.010	0.5234
1. PBF	Q4JVP5	AAA ATPase forming ring-shaped complexes	1.40e-05	2.89e-06	8.05e-05	0.5891
1. PBF	Q8U4H3	Proteasome-activating nucleotidase	1.80e-06	9.73e-03	3.99e-10	0.6818
1. PBF	B1W303	Proteasome-associated ATPase	4.31e-05	4.41e-03	0.033	0.5205
1. PBF	P62335	26S proteasome regulatory subunit 10B	1.68e-06	6.13e-03	2.30e-09	0.6516
1. PBF	Q5JHS5	Proteasome-activating nucleotidase	6.19e-07	2.08e-03	1.25e-09	0.6524
1. PBF	C3N7K8	Proteasome-activating nucleotidase	5.45e-07	7.83e-03	6.59e-08	0.6744
2. PF	C9Z319	Proteasome-associated ATPase	5.29e-05	3.34e-02	NA	0.5242
2. PF	A6TB30	Holliday junction ATP-dependent DNA helicase RuvB	2.24e-05	3.90e-02	NA	0.5442
2. PF	Q4FTT9	Holliday junction ATP-dependent DNA helicase RuvB	2.43e-05	5.55e-03	NA	0.5334
2. PF	C5CM03	Holliday junction ATP-dependent DNA helicase RuvB	2.56e-05	2.22e-02	NA	0.5388
2. PF	A6TQM5	Holliday junction ATP-dependent DNA helicase RuvB	4.43e-06	4.52e-02	NA	0.5245
2. PF	Q5F8L2	Holliday junction ATP-dependent DNA helicase RuvB	4.38e-06	4.75e-03	NA	0.5163
2. PF	A1TUY9	Holliday junction ATP-dependent DNA helicase RuvB	2.80e-05	2.03e-02	NA	0.5088
2. PF	Q7UZP3	Holliday junction ATP-dependent DNA helicase RuvB	9.00e-07	1.93e-02	NA	0.5252
2. PF	Q839Z5	Chromosomal replication initiator protein DnaA	8.49e-05	2.16e-03	NA	0.4785
2. PF	Q5HNR0	Holliday junction ATP-dependent DNA helicase RuvB	3.73e-06	3.80e-02	NA	0.5147
2. PF	Q48VY1	Holliday junction ATP-dependent DNA helicase RuvB	2.17e-05	4.14e-02	NA	0.523
2. PF	Q9HI16	Gas vesicle protein GvpN 1	1.85e-03	3.17e-02	NA	0.4206
2. PF	Q2JP68	Holliday junction ATP-dependent DNA helicase RuvB	3.96e-06	5.35e-03	NA	0.5194
2. PF	Q7X999	Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic	1.70e-04	1.34e-02	NA	0.4574
2. PF	Q8RE97	Holliday junction ATP-dependent DNA helicase RuvB	2.10e-05	1.86e-02	NA	0.5083
2. PF	Q8E2D9	Holliday junction ATP-dependent DNA helicase RuvB	1.12e-05	3.20e-02	NA	0.5259
2. PF	B8JF05	Holliday junction ATP-dependent DNA helicase RuvB	4.24e-06	1.21e-02	NA	0.5415
2. PF	A1A1K3	Holliday junction ATP-dependent DNA helicase RuvB	6.22e-06	2.11e-02	NA	0.4528
2. PF	Q8DWI4	Holliday junction ATP-dependent DNA helicase RuvB	2.38e-05	1.22e-02	NA	0.4648
2. PF	B5E6T3	Holliday junction ATP-dependent DNA helicase RuvB	1.19e-05	2.28e-02	NA	0.5162
2. PF	B1Y8E2	Holliday junction ATP-dependent DNA helicase RuvB	3.63e-05	1.84e-03	NA	0.5422
2. PF	Q1MSG8	Chromosomal replication initiator protein DnaA	1.31e-04	1.48e-03	NA	0.4488
2. PF	A2C563	Holliday junction ATP-dependent DNA helicase RuvB	1.61e-06	3.94e-02	NA	0.4621
2. PF	C1CC50	Holliday junction ATP-dependent DNA helicase RuvB	1.81e-05	1.43e-02	NA	0.5067
2. PF	A6W3V4	Chromosomal replication initiator protein DnaA	3.61e-04	2.91e-02	NA	0.4543
2. PF	B8DN19	Chromosomal replication initiator protein DnaA	3.44e-04	4.92e-03	NA	0.4519
2. PF	A2C638	Holliday junction ATP-dependent DNA helicase RuvB	1.83e-06	1.66e-02	NA	0.5248
2. PF	D2Q4G5	Proteasome-associated ATPase	3.50e-05	1.70e-02	NA	0.5246
2. PF	A7H910	Holliday junction ATP-dependent DNA helicase RuvB	5.69e-07	4.06e-03	NA	0.5418
2. PF	Q2JTM7	Holliday junction ATP-dependent DNA helicase RuvB 1	1.76e-05	2.03e-02	NA	0.5177
2. PF	Q478E5	Holliday junction ATP-dependent DNA helicase RuvB	3.55e-05	1.51e-02	NA	0.4681
2. PF	Q17WP7	Holliday junction ATP-dependent DNA helicase RuvB	3.83e-08	4.00e-02	NA	0.5698
2. PF	B5ZAF5	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-06	4.55e-02	NA	0.5711
2. PF	Q04GA1	Holliday junction ATP-dependent DNA helicase RuvB	2.55e-06	2.05e-02	NA	0.4973
2. PF	Q40565	Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic	2.47e-04	3.17e-02	NA	0.443
2. PF	Q8YT32	Holliday junction ATP-dependent DNA helicase RuvB	2.54e-06	4.48e-02	NA	0.4711
2. PF	A3PFA5	Holliday junction ATP-dependent DNA helicase RuvB	1.39e-06	3.28e-02	NA	0.4565
2. PF	B5XQ05	Holliday junction ATP-dependent DNA helicase RuvB	2.54e-05	4.25e-02	NA	0.5421
2. PF	Q7V910	Holliday junction ATP-dependent DNA helicase RuvB	1.03e-05	1.13e-02	NA	0.4985
2. PF	P23489	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	3.28e-04	2.09e-05	NA	0.4523
2. PF	A3CK22	Holliday junction ATP-dependent DNA helicase RuvB	1.68e-05	2.58e-02	NA	0.5178
2. PF	P0DA69	Chromosomal replication initiator protein DnaA	1.04e-04	9.42e-06	NA	0.4507
2. PF	A4WBL8	Holliday junction ATP-dependent DNA helicase RuvB	2.13e-06	1.90e-02	NA	0.5163
2. PF	Q49Y79	Holliday junction ATP-dependent DNA helicase RuvB	1.62e-06	4.36e-02	NA	0.5053
2. PF	Q42450	Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic	4.39e-04	2.77e-04	NA	0.4675
2. PF	C4LIL2	AAA ATPase forming ring-shaped complexes	2.03e-05	7.33e-05	NA	0.5551
2. PF	B2ISI4	Holliday junction ATP-dependent DNA helicase RuvB	1.34e-05	1.42e-02	NA	0.5184
2. PF	Q2IPJ5	Holliday junction ATP-dependent DNA helicase RuvB	3.79e-06	9.05e-03	NA	0.5421
2. PF	Q9PKB9	Chromosomal replication initiator protein DnaA 2	7.98e-05	6.16e-05	NA	0.4465
2. PF	C7LYP4	Proteasome-associated ATPase	1.55e-05	2.92e-05	NA	0.5095
2. PF	A1WC30	Holliday junction ATP-dependent DNA helicase RuvB	2.75e-05	2.65e-03	NA	0.5285
2. PF	C1CPD4	Holliday junction ATP-dependent DNA helicase RuvB	1.35e-05	2.69e-02	NA	0.5092
2. PF	A1VJK5	Holliday junction ATP-dependent DNA helicase RuvB	2.50e-05	2.14e-02	NA	0.5477
2. PF	Q5FLX2	Holliday junction ATP-dependent DNA helicase RuvB	5.10e-06	3.47e-03	NA	0.5462
2. PF	Q9JZ86	Holliday junction ATP-dependent DNA helicase RuvB	4.77e-06	2.78e-03	NA	0.5458
2. PF	Q4L6Y6	Holliday junction ATP-dependent DNA helicase RuvB	1.06e-06	9.47e-03	NA	0.5619
2. PF	A5CLT3	Chromosomal replication initiator protein DnaA	2.37e-04	2.66e-04	NA	0.4094
2. PF	C1CB34	Holliday junction ATP-dependent DNA helicase RuvB	1.24e-05	2.69e-02	NA	0.5253
2. PF	B2ITR9	Holliday junction ATP-dependent DNA helicase RuvB	7.77e-06	2.91e-02	NA	0.4953
2. PF	Q3MEF4	Holliday junction ATP-dependent DNA helicase RuvB	2.71e-06	4.55e-02	NA	0.509
2. PF	Q2JTJ1	Holliday junction ATP-dependent DNA helicase RuvB 2	9.33e-05	2.30e-03	NA	0.4546
2. PF	C1CIE0	Holliday junction ATP-dependent DNA helicase RuvB	1.33e-05	2.69e-02	NA	0.5392
2. PF	Q220I3	Holliday junction ATP-dependent DNA helicase RuvB	2.61e-05	2.47e-02	NA	0.5306
2. PF	A1KU52	Holliday junction ATP-dependent DNA helicase RuvB	4.82e-06	2.78e-03	NA	0.5456
2. PF	B3R0J0	Holliday junction ATP-dependent DNA helicase RuvB	1.25e-06	1.23e-02	NA	0.5626
2. PF	A5WFF6	Holliday junction ATP-dependent DNA helicase RuvB	2.66e-05	3.80e-02	NA	0.5183
2. PF	A2BZ00	Holliday junction ATP-dependent DNA helicase RuvB	5.32e-06	4.63e-02	NA	0.5246
2. PF	Q8CWU7	Holliday junction ATP-dependent DNA helicase RuvB	1.47e-05	2.69e-02	NA	0.5079
2. PF	Q97SR6	Holliday junction ATP-dependent DNA helicase RuvB	1.48e-05	3.04e-02	NA	0.51
2. PF	C1D9W9	Holliday junction ATP-dependent DNA helicase RuvB	2.01e-05	1.80e-02	NA	0.5399
2. PF	Q7NQC5	Holliday junction ATP-dependent DNA helicase RuvB	2.70e-05	4.29e-03	NA	0.472
2. PF	A6VQA3	Holliday junction ATP-dependent DNA helicase RuvB	3.79e-06	3.31e-02	NA	0.5632
2. PF	Q1CUB7	Holliday junction ATP-dependent DNA helicase RuvB	4.46e-08	4.52e-02	NA	0.568
2. PF	Q1AWE0	Holliday junction ATP-dependent DNA helicase RuvB	3.69e-06	3.53e-03	NA	0.5026
2. PF	D7Y2H4	CD-NTase-associated protein 6	1.82e-07	5.10e-11	NA	0.6218
2. PF	A8AUH0	Holliday junction ATP-dependent DNA helicase RuvB	1.44e-05	1.88e-02	NA	0.5148
2. PF	P61529	Holliday junction ATP-dependent DNA helicase RuvB	2.88e-06	8.27e-03	NA	0.535
2. PF	B4UFY1	Holliday junction ATP-dependent DNA helicase RuvB	3.82e-06	1.21e-02	NA	0.5222
2. PF	Q483C4	Holliday junction ATP-dependent DNA helicase RuvB	5.81e-06	1.02e-02	NA	0.5612
2. PF	Q8CS91	Holliday junction ATP-dependent DNA helicase RuvB	5.11e-08	3.80e-02	NA	0.5532
2. PF	P0DF50	Holliday junction ATP-dependent DNA helicase RuvB	1.31e-05	4.14e-02	NA	0.5305
2. PF	A8MHI3	Holliday junction ATP-dependent DNA helicase RuvB	5.49e-06	1.40e-02	NA	0.4953
2. PF	Q839T5	Holliday junction ATP-dependent DNA helicase RuvB	1.60e-05	4.79e-02	NA	0.5296
2. PF	Q828J2	Proteasome-associated ATPase	4.97e-05	1.47e-02	NA	0.5464
2. PF	C0R4X2	Holliday junction ATP-dependent DNA helicase RuvB	1.97e-06	4.04e-02	NA	0.561
2. PF	Q7U9W7	Holliday junction ATP-dependent DNA helicase RuvB	2.03e-06	2.96e-02	NA	0.4681
2. PF	B1I8Y6	Holliday junction ATP-dependent DNA helicase RuvB	1.63e-05	2.69e-02	NA	0.4898
2. PF	Q04MI9	Holliday junction ATP-dependent DNA helicase RuvB	1.37e-05	2.69e-02	NA	0.5174
2. PF	C5BVA6	Proteasome-associated ATPase	1.80e-05	1.05e-08	NA	0.4903
2. PF	P0DF51	Holliday junction ATP-dependent DNA helicase RuvB	1.60e-05	4.14e-02	NA	0.4922
2. PF	Q15RN6	Holliday junction ATP-dependent DNA helicase RuvB	2.28e-05	4.18e-02	NA	0.5224
2. PF	Q40073	Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic	3.42e-04	2.29e-04	NA	0.4781
2. PF	A1SSV6	Holliday junction ATP-dependent DNA helicase RuvB	3.83e-06	3.28e-02	NA	0.5543
2. PF	Q115Z7	Holliday junction ATP-dependent DNA helicase RuvB	5.45e-05	4.02e-04	NA	0.5159
2. PF	Q183N8	Holliday junction ATP-dependent DNA helicase RuvB	4.75e-06	1.44e-02	NA	0.5248
2. PF	A9LZC3	Holliday junction ATP-dependent DNA helicase RuvB	4.92e-06	2.78e-03	NA	0.543
2. PF	Q124Q6	Holliday junction ATP-dependent DNA helicase RuvB	2.63e-05	6.84e-03	NA	0.5297
2. PF	B6IYU2	Holliday junction ATP-dependent DNA helicase RuvB	2.95e-06	1.39e-02	NA	0.4857
3. BF	A9BJK3	ATP-dependent zinc metalloprotease FtsH 3	4.42e-05	NA	2.02e-06	0.6381
3. BF	C5J6A7	ATP-dependent zinc metalloprotease FtsH	3.06e-05	NA	7.75e-04	0.6674
3. BF	B4K799	Spastin	1.76e-05	NA	0.003	0.6387
3. BF	D1J722	ATP-dependent zinc metalloprotease FtsH	3.00e-05	NA	0.003	0.6511
3. BF	O05209	VCP-like ATPase	5.15e-04	NA	1.46e-10	0.6314
3. BF	P0AAI4	ATP-dependent zinc metalloprotease FtsH	1.11e-04	NA	2.73e-04	0.6561
3. BF	A9NE17	ATP-dependent zinc metalloprotease FtsH	7.05e-05	NA	1.82e-04	0.5971
3. BF	D3F124	ATP-dependent zinc metalloprotease FtsH 1	1.85e-05	NA	2.16e-05	0.5853
3. BF	Q4A5F0	ATP-dependent zinc metalloprotease FtsH	3.68e-05	NA	3.95e-04	0.6603
3. BF	Q96372	Cell division cycle protein 48 homolog	5.19e-04	NA	4.86e-07	0.5596
3. BF	Q5SI82	ATP-dependent zinc metalloprotease FtsH	5.94e-05	NA	0.004	0.637
3. BF	A9KIG5	ATP-dependent zinc metalloprotease FtsH	2.32e-05	NA	1.92e-05	0.6466
3. BF	Q3A579	ATP-dependent zinc metalloprotease FtsH	8.77e-05	NA	9.86e-05	0.6112
3. BF	P54814	26S proteasome regulatory subunit 8	7.78e-07	NA	1.19e-05	0.5747
3. BF	Q8YMZ8	ATP-dependent zinc metalloprotease FtsH	5.45e-05	NA	5.50e-05	0.7486
3. BF	Q03Z46	ATP-dependent zinc metalloprotease FtsH	6.34e-05	NA	0.011	0.6392
3. BF	P46469	ATP-dependent zinc metalloprotease FtsH	1.00e-04	NA	8.32e-05	0.6179
3. BF	D5D8E3	ATP-dependent zinc metalloprotease FtsH	1.62e-05	NA	1.34e-05	0.6587
3. BF	B3R057	ATP-dependent zinc metalloprotease FtsH 1	2.85e-05	NA	0.005	0.5607
3. BF	P0A4V9	ATP-dependent zinc metalloprotease FtsH	1.23e-04	NA	1.43e-04	0.5775
3. BF	B3PNH3	ATP-dependent zinc metalloprotease FtsH	1.17e-04	NA	1.80e-06	0.6484
3. BF	Q83XX3	ATP-dependent zinc metalloprotease FtsH	3.90e-05	NA	0.002	0.6317
3. BF	P36966	Peroxisomal biogenesis factor 6	2.79e-03	NA	2.88e-13	0.5371
3. BF	Q3JEE4	ATP-dependent zinc metalloprotease FtsH	4.27e-05	NA	0.003	0.6327
3. BF	Q83FV7	ATP-dependent zinc metalloprotease FtsH	5.81e-05	NA	1.87e-04	0.6508
3. BF	Q4UN68	ATP-dependent zinc metalloprotease FtsH	1.93e-05	NA	5.50e-06	0.5988
3. BF	B2JVU2	ATP-dependent zinc metalloprotease FtsH	4.60e-05	NA	2.88e-05	0.7277
3. BF	B4NBP4	Spastin	1.76e-05	NA	0.002	0.6365
3. BF	Q6M2F0	ATP-dependent zinc metalloprotease FtsH	3.61e-04	NA	0.002	0.5819
3. BF	D3FFN2	ATP-dependent zinc metalloprotease FtsH	5.03e-05	NA	1.08e-05	0.6123
3. BF	Q6DDU8	Fidgetin-like protein 1	1.25e-04	NA	5.34e-04	0.5872
3. BF	B2UE66	ATP-dependent zinc metalloprotease FtsH	7.53e-05	NA	4.00e-06	0.738
3. BF	A1URA3	ATP-dependent zinc metalloprotease FtsH	1.48e-04	NA	0.001	0.6629
3. BF	A9RA82	Katanin p60 ATPase-containing subunit A-like 1	1.36e-07	NA	1.33e-05	0.4503
3. BF	Q92JJ9	ATP-dependent zinc metalloprotease FtsH	1.57e-05	NA	4.70e-06	0.5869
3. BF	Q9ZEA2	ATP-dependent zinc metalloprotease FtsH	1.80e-05	NA	1.76e-05	0.5928
3. BF	D0LWB8	ATP-dependent zinc metalloprotease FtsH	2.86e-05	NA	0.002	0.616
3. BF	P78578	26S proteasome regulatory subunit 6B homolog	2.36e-06	NA	1.28e-06	0.6824
3. BF	Q68XR9	ATP-dependent zinc metalloprotease FtsH	1.92e-05	NA	2.38e-05	0.6004
3. BF	Q0VA52	Spermatogenesis-associated protein 5-like protein 1	1.27e-04	NA	2.59e-07	0.6652
3. BF	P46472	26S proteasome regulatory subunit 7	3.51e-05	NA	1.28e-05	0.6045
3. BF	A9FDV9	ATP-dependent zinc metalloprotease FtsH 2	3.03e-05	NA	3.11e-04	0.6275
3. BF	O32617	ATP-dependent zinc metalloprotease FtsH	4.51e-05	NA	7.00e-06	0.6447
3. BF	Q8K9G8	ATP-dependent zinc metalloprotease FtsH	2.60e-05	NA	5.46e-04	0.6516
3. BF	B0K657	ATP-dependent zinc metalloprotease FtsH 2	4.89e-06	NA	2.59e-07	0.5513
3. BF	B2UMY1	ATP-dependent zinc metalloprotease FtsH	3.25e-04	NA	1.02e-05	0.6713
3. BF	Q3JMH0	ATP-dependent zinc metalloprotease FtsH	9.77e-06	NA	8.58e-05	0.6544
3. BF	Q7URM7	ATP-dependent zinc metalloprotease FtsH 2	7.15e-05	NA	3.16e-09	0.6492
3. BF	B7T1V0	ATP-dependent zinc metalloprotease FtsH	3.29e-05	NA	1.29e-05	0.606
3. BF	B0B970	ATP-dependent zinc metalloprotease FtsH	2.15e-04	NA	1.67e-05	0.6594
3. BF	Q2LUQ1	ATP-dependent zinc metalloprotease FtsH	1.83e-04	NA	7.89e-06	0.6412
3. BF	A7YSY2	Spermatogenesis-associated protein 5-like protein 1	1.24e-04	NA	3.89e-09	0.5707
3. BF	Q8TI88	Proteasome-activating nucleotidase	1.27e-06	NA	3.96e-08	0.6468
3. BF	Q25544	26S proteasome regulatory subunit 8 homolog	1.01e-06	NA	3.47e-06	0.5078
3. BF	P49541	Uncharacterized AAA domain-containing protein ycf46	1.56e-05	NA	0.022	0.5673
3. BF	Q0IIR9	Katanin p60 ATPase-containing subunit A1	1.15e-06	NA	2.00e-05	0.5436
3. BF	Q8SR13	26S proteasome regulatory subunit 6A	1.42e-06	NA	5.28e-06	0.6623
3. BF	A9BFL9	ATP-dependent zinc metalloprotease FtsH 1	3.96e-05	NA	1.48e-06	0.5845
3. BF	Q8X9L0	ATP-dependent zinc metalloprotease FtsH	4.80e-05	NA	2.80e-04	0.6578
3. BF	B1AI94	ATP-dependent zinc metalloprotease FtsH	7.51e-05	NA	1.41e-08	0.6606
3. BF	D1C2C6	ATP-dependent zinc metalloprotease FtsH 2	4.79e-05	NA	1.39e-07	0.6084
3. BF	Q3B6R3	ATP-dependent zinc metalloprotease FtsH	1.34e-04	NA	1.01e-04	0.625
3. BF	P71377	ATP-dependent zinc metalloprotease FtsH	5.90e-05	NA	0.006	0.6561
3. BF	Q98PE4	ATP-dependent zinc metalloprotease FtsH	3.28e-04	NA	3.88e-04	0.6534
3. BF	B9KXV3	ATP-dependent zinc metalloprotease FtsH 1	5.49e-05	NA	1.53e-04	0.5917
3. BF	Q07590	Protein SAV	9.35e-04	NA	4.20e-09	0.5193
3. BF	P59652	ATP-dependent zinc metalloprotease FtsH	5.24e-05	NA	1.66e-04	0.635
3. BF	B7PXE3	Spastin	3.83e-07	NA	0.001	0.6082
3. BF	P9WQN2	ATP-dependent zinc metalloprotease FtsH	1.85e-04	NA	1.38e-04	0.593
3. BF	D1BLD0	ATP-dependent zinc metalloprotease FtsH	3.24e-05	NA	0.001	0.628
3. BF	P46507	26S proteasome regulatory subunit 6B	2.36e-06	NA	5.52e-05	0.7064
3. BF	O64982	26S proteasome regulatory subunit 7	1.55e-05	NA	8.49e-07	0.6017
3. BF	Q298L4	Spastin	1.73e-05	NA	0.002	0.655
3. BF	D5H7Z5	ATP-dependent zinc metalloprotease FtsH 1	1.31e-04	NA	0.001	0.6184
3. BF	B8J992	ATP-dependent zinc metalloprotease FtsH	1.01e-04	NA	4.87e-04	0.6882
3. BF	A9EXK6	ATP-dependent zinc metalloprotease FtsH 4	7.98e-05	NA	6.95e-05	0.6566
3. BF	P51189	Uncharacterized AAA domain-containing protein ycf46	5.56e-06	NA	3.95e-04	0.5652
3. BF	C8WEG0	ATP-dependent zinc metalloprotease FtsH	3.51e-05	NA	1.94e-04	0.6518
3. BF	Q9HNP9	Proteasome-activating nucleotidase 2	1.60e-06	NA	9.03e-09	0.6748
3. BF	A6LD25	ATP-dependent zinc metalloprotease FtsH	4.12e-05	NA	3.80e-06	0.6287
3. BF	B7NZ88	Katanin p60 ATPase-containing subunit A-like 1	8.11e-07	NA	4.50e-06	0.4881
3. BF	O28303	Proteasome-activating nucleotidase	9.94e-07	NA	1.21e-08	0.7143
3. BF	O26824	Proteasome-activating nucleotidase	3.44e-06	NA	6.83e-06	0.693
3. BF	C6V4R9	ATP-dependent zinc metalloprotease FtsH	1.62e-05	NA	0.002	0.7413
3. BF	A8ZNZ4	ATP-dependent zinc metalloprotease FtsH	3.10e-05	NA	1.55e-05	0.6974
3. BF	A0JMA9	Katanin p60 ATPase-containing subunit A-like 2	2.39e-05	NA	1.15e-06	0.5366
3. BF	C8W731	ATP-dependent zinc metalloprotease FtsH	4.84e-05	NA	2.59e-07	0.5518
3. BF	O69076	ATP-dependent zinc metalloprotease FtsH	2.21e-05	NA	1.69e-04	0.6053
3. BF	B3DY14	ATP-dependent zinc metalloprotease FtsH 2	1.88e-05	NA	1.88e-04	0.662
3. BF	Q6GL04	Transitional endoplasmic reticulum ATPase	3.80e-04	NA	3.21e-06	0.586
3. BF	Q9BAE0	ATP-dependent zinc metalloprotease FTSH, chloroplastic	6.18e-05	NA	3.92e-04	0.5989
3. BF	Q4R7L3	26S proteasome regulatory subunit 6B	1.65e-06	NA	4.60e-05	0.6962
3. BF	Q55700	ATP-dependent zinc metalloprotease FtsH 2	3.41e-05	NA	1.42e-05	0.6676
3. BF	Q1LLA9	ATP-dependent zinc metalloprotease FtsH	7.68e-05	NA	9.54e-05	0.6382
3. BF	Q9UVU5	Peroxisomal biogenesis factor 6	3.36e-03	NA	1.73e-11	0.579
3. BF	P46463	Peroxisome biosynthesis protein PAS1	5.43e-03	NA	4.51e-06	0.6068
3. BF	Q6LUJ8	ATP-dependent zinc metalloprotease FtsH	8.65e-05	NA	3.27e-04	0.6592
3. BF	Q6BS73	Peroxisomal biogenesis factor 6	6.62e-03	NA	4.25e-09	0.5702
3. BF	Q9HG03	Peroxisomal biogenesis factor 6	7.86e-03	NA	2.61e-10	0.5789
3. BF	Q6KHA4	ATP-dependent zinc metalloprotease FtsH	3.49e-05	NA	3.97e-07	0.6624
3. BF	D2NQQ7	ATP-dependent zinc metalloprotease FtsH	1.39e-04	NA	5.19e-04	0.6563
3. BF	D0MGU8	ATP-dependent zinc metalloprotease FtsH	1.26e-05	NA	6.61e-06	0.6242
3. BF	Q74Z13	Peroxisomal biogenesis factor 6	9.32e-04	NA	1.54e-12	0.5715
3. BF	P85200	26S proteasome regulatory subunit 6B homolog	1.86e-06	NA	1.08e-05	0.6952
3. BF	Q6F0E5	ATP-dependent zinc metalloprotease FtsH	1.27e-04	NA	7.80e-07	0.6896
3. BF	P47695	ATP-dependent zinc metalloprotease FtsH	1.94e-05	NA	9.18e-06	0.6563
3. BF	Q05AS3	Spastin	8.45e-07	NA	4.33e-04	0.6561
3. BF	C0ZPK5	ATP-dependent zinc metalloprotease FtsH	2.37e-04	NA	5.07e-06	0.5815
3. BF	B8G4Q6	ATP-dependent zinc metalloprotease FtsH	5.45e-05	NA	9.16e-05	0.7322
3. BF	A3CV35	Proteasome-activating nucleotidase	1.44e-06	NA	3.48e-09	0.6821
3. BF	B3DV46	ATP-dependent zinc metalloprotease FtsH 1	9.29e-05	NA	3.47e-05	0.741
3. BF	B4JII0	Spastin	1.74e-05	NA	0.002	0.6366
3. BF	A8F7F7	ATP-dependent zinc metalloprotease FtsH	6.33e-05	NA	3.19e-05	0.6586
3. BF	B3M301	Spastin	1.53e-05	NA	0.001	0.6379
3. BF	Q90732	26S proteasome regulatory subunit 4	1.25e-05	NA	4.48e-09	0.6758
3. BF	D4HA34	ATP-dependent zinc metalloprotease FtsH	5.52e-05	NA	5.39e-04	0.7438
3. BF	Q2SF13	ATP-dependent zinc metalloprotease FtsH	8.30e-05	NA	0.001	0.6226
3. BF	Q9TJ83	ATP-dependent zinc metalloprotease FtsH	2.21e-05	NA	7.95e-06	0.6629
3. BF	Q1D491	ATP-dependent zinc metalloprotease FtsH	2.52e-05	NA	1.04e-04	0.6286
3. BF	D1C8C0	ATP-dependent zinc metalloprotease FtsH 4	3.18e-05	NA	7.02e-04	0.6166
3. BF	Q67JH0	ATP-dependent zinc metalloprotease FtsH 3	2.51e-05	NA	1.33e-04	0.6843
3. BF	O67077	ATP-dependent zinc metalloprotease FtsH	2.25e-05	NA	7.85e-04	0.6236
3. BF	P62197	26S proteasome regulatory subunit 8	8.20e-07	NA	3.46e-05	0.578
3. BF	Q6AZT2	Spastin	9.68e-07	NA	6.19e-05	0.6803
3. BF	Q4R4R0	26S proteasome regulatory subunit 7	1.58e-05	NA	1.23e-05	0.6394
3. BF	A1UHT0	Proteasome-associated ATPase	9.96e-05	NA	0.009	0.5095
3. BF	O19922	ATP-dependent zinc metalloprotease FtsH	2.81e-05	NA	4.20e-06	0.622
3. BF	P57462	ATP-dependent zinc metalloprotease FtsH	2.02e-05	NA	6.17e-04	0.6584
3. BF	Q1AV13	ATP-dependent zinc metalloprotease FtsH	3.13e-05	NA	1.96e-05	0.6361
3. BF	Q7UUZ7	ATP-dependent zinc metalloprotease FtsH 1	3.12e-05	NA	3.21e-05	0.619
3. BF	Q0TTK8	ATP-dependent zinc metalloprotease FtsH	7.84e-05	NA	4.00e-06	0.7484
3. BF	B2XTF7	ATP-dependent zinc metalloprotease FtsH	4.67e-05	NA	3.84e-04	0.5786
3. BF	Q6B952	Uncharacterized AAA domain-containing protein ycf46	7.68e-06	NA	1.23e-05	0.6004
3. BF	Q6CPV1	Peroxisomal biogenesis factor 6	6.76e-04	NA	2.23e-12	0.5761
3. BF	P63344	ATP-dependent zinc metalloprotease FtsH	1.21e-04	NA	3.49e-04	0.6582
3. BF	B9L3S8	ATP-dependent zinc metalloprotease FtsH 2	1.80e-04	NA	1.12e-04	0.7451
3. BF	Q2NIN5	ATP-dependent zinc metalloprotease FtsH	8.39e-05	NA	0.013	0.6044
3. BF	Q719N1	Spastin	8.36e-06	NA	6.41e-04	0.6128
3. BF	Q9CD58	ATP-dependent zinc metalloprotease FtsH	1.53e-04	NA	0.001	0.6302
3. BF	P73179	ATP-dependent zinc metalloprotease FtsH 1	4.78e-05	NA	3.20e-04	0.7479
3. BF	Q60QD1	Fidgetin-like protein 1	1.33e-04	NA	0.001	0.6462
3. BF	B7J0N5	ATP-dependent zinc metalloprotease FtsH	1.06e-04	NA	3.02e-04	0.6274
3. BF	C7N914	ATP-dependent zinc metalloprotease FtsH	3.47e-04	NA	2.31e-06	0.5764
3. BF	Q5R8D7	26S proteasome regulatory subunit 7	2.31e-05	NA	1.19e-05	0.5537
3. BF	D2QZ34	ATP-dependent zinc metalloprotease FtsH	7.63e-05	NA	2.24e-06	0.6098
3. BF	Q1HGK7	Katanin p60 ATPase-containing subunit A1	1.51e-06	NA	1.08e-05	0.5782
3. BF	Q8SRH0	26S proteasome regulatory subunit 4 homolog	4.09e-06	NA	1.33e-10	0.6087
3. BF	A0PXM8	ATP-dependent zinc metalloprotease FtsH	6.93e-05	NA	2.11e-04	0.6487
3. BF	P54778	26S proteasome regulatory subunit 6B homolog	5.99e-07	NA	5.08e-06	0.7211
3. BF	Q41365	26S proteasome regulatory subunit 7	1.36e-05	NA	8.28e-07	0.6007
3. BF	Q3T030	26S proteasome regulatory subunit 6B	1.61e-06	NA	4.60e-05	0.6647
3. BF	Q5ZK92	Spastin	6.26e-06	NA	3.71e-04	0.6154
3. BF	B3QZS3	ATP-dependent zinc metalloprotease FtsH 2	3.41e-05	NA	0.011	0.598
3. BF	B0K5A3	ATP-dependent zinc metalloprotease FtsH 1	1.92e-05	NA	5.32e-04	0.6482
3. BF	B8D065	ATP-dependent zinc metalloprotease FtsH	1.61e-05	NA	2.81e-04	0.6061
3. BF	O61577	Katanin p60 ATPase-containing subunit A1	2.11e-06	NA	2.49e-05	0.5865
3. BF	A6TSZ1	ATP-dependent zinc metalloprotease FtsH 1	1.25e-05	NA	4.56e-05	0.6471
3. BF	P62194	26S proteasome regulatory subunit 8	5.55e-07	NA	3.46e-05	0.6548
3. BF	A5U8T5	ATP-dependent zinc metalloprotease FtsH	8.02e-05	NA	1.43e-04	0.5909
3. BF	B1GZK7	ATP-dependent zinc metalloprotease FtsH	2.17e-05	NA	0.007	0.6236
3. BF	C1F8X6	ATP-dependent zinc metalloprotease FtsH	2.58e-05	NA	2.75e-04	0.7406
3. BF	A1TZE0	ATP-dependent zinc metalloprotease FtsH	3.34e-05	NA	2.08e-05	0.6521
3. BF	B4G437	Spastin	2.17e-05	NA	0.002	0.6403
3. BF	A7I8B8	Proteasome-activating nucleotidase	4.36e-06	NA	2.96e-11	0.6839
3. BF	P54776	26S proteasome regulatory subunit 6A homolog	8.93e-07	NA	3.22e-06	0.6588
3. BF	B4USW8	Katanin p60 ATPase-containing subunit A-like 1	3.12e-06	NA	1.52e-05	0.4521
3. BF	D1AXT4	ATP-dependent zinc metalloprotease FtsH	3.94e-05	NA	2.60e-06	0.5662
3. BF	Q2KJI7	AFG3-like protein 2	7.54e-05	NA	0.002	0.6455
3. BF	Q2FQ56	Proteasome-activating nucleotidase	1.18e-06	NA	1.63e-06	0.6824
3. BF	P23787	Transitional endoplasmic reticulum ATPase	3.09e-04	NA	5.59e-06	0.5739
3. BF	Q1RGP0	ATP-dependent zinc metalloprotease FtsH	1.79e-05	NA	1.42e-05	0.6264
3. BF	B4M0H8	Spastin	1.61e-05	NA	0.002	0.6535
3. BF	D1C1U7	ATP-dependent zinc metalloprotease FtsH 1	6.95e-05	NA	1.19e-04	0.6026
3. BF	Q5E9F9	26S proteasome regulatory subunit 7	2.30e-05	NA	1.23e-05	0.6571
3. BF	A6VHR1	Proteasome-activating nucleotidase	1.15e-06	NA	7.97e-10	0.6792
3. BF	Q88Z31	ATP-dependent zinc metalloprotease FtsH	1.00e-04	NA	2.32e-05	0.6177
3. BF	Q6MJV1	ATP-dependent zinc metalloprotease FtsH 2	1.44e-05	NA	6.41e-04	0.7153
3. BF	Q6FW67	Peroxisomal biogenesis factor 6	7.36e-04	NA	5.23e-13	0.5051
3. BF	P37476	ATP-dependent zinc metalloprotease FtsH	5.08e-05	NA	0.001	0.6997
3. BF	B2A3Q4	ATP-dependent zinc metalloprotease FtsH	7.24e-05	NA	5.48e-04	0.6417
3. BF	B9MPK5	ATP-dependent zinc metalloprotease FtsH	5.61e-05	NA	6.53e-05	0.7411
3. BF	O42587	26S proteasome regulatory subunit 6A-A	9.17e-07	NA	0.002	0.6785
3. BF	Q10ZF7	ATP-dependent zinc metalloprotease FtsH	2.91e-05	NA	1.67e-05	0.7376
3. BF	P51327	ATP-dependent zinc metalloprotease FtsH	3.51e-05	NA	2.52e-05	0.6752
3. BF	A0LN68	ATP-dependent zinc metalloprotease FtsH	4.47e-05	NA	1.19e-07	0.6482
3. BF	P72991	ATP-dependent zinc metalloprotease FtsH 3	2.04e-05	NA	9.04e-05	0.6061
3. BF	C6VKW6	ATP-dependent zinc metalloprotease FtsH	1.74e-04	NA	2.32e-05	0.6168
3. BF	Q89AF2	ATP-dependent zinc metalloprotease FtsH	8.20e-05	NA	0.001	0.6514
3. BF	Q8TX03	Proteasome-activating nucleotidase	1.50e-06	NA	3.68e-07	0.6695
3. BF	Q2JNP0	ATP-dependent zinc metalloprotease FtsH	2.73e-05	NA	3.63e-05	0.6108
3. BF	C7N1I1	ATP-dependent zinc metalloprotease FtsH	3.82e-04	NA	4.13e-04	0.6306
3. BF	D5HA94	ATP-dependent zinc metalloprotease FtsH 2	1.68e-04	NA	5.88e-05	0.5788
3. BF	B3R0R7	ATP-dependent zinc metalloprotease FtsH 3	8.74e-06	NA	0.009	0.709
3. BF	O42586	26S proteasome regulatory subunit 6A-B	2.74e-06	NA	0.001	0.6652
3. BF	O23894	26S proteasome regulatory subunit 6A homolog	8.82e-07	NA	3.62e-06	0.5208
3. BF	A9A916	Proteasome-activating nucleotidase	1.50e-06	NA	1.98e-10	0.6906
3. BF	B1ZMG6	ATP-dependent zinc metalloprotease FtsH	2.08e-05	NA	5.48e-09	0.6779
3. BF	B8I4B9	ATP-dependent zinc metalloprotease FtsH	1.57e-05	NA	0.003	0.6579
3. BF	A9WSI4	Proteasome-associated ATPase	1.90e-04	NA	0.005	0.4939
3. BF	O78516	ATP-dependent zinc metalloprotease FtsH	4.34e-05	NA	5.07e-06	0.6383
3. BF	A2VDN5	Spastin	7.25e-06	NA	3.78e-04	0.6466
3. BF	Q9HPF0	Protein CdcH	8.18e-05	NA	1.27e-10	0.654
3. BF	O82150	ATP-dependent zinc metalloprotease FTSH, chloroplastic	2.51e-04	NA	3.69e-04	0.5993
3. BF	A4IHT0	Fidgetin-like protein 1	1.38e-04	NA	6.20e-04	0.5966
3. BF	Q6MDI5	ATP-dependent zinc metalloprotease FtsH	2.98e-04	NA	5.45e-07	0.6347
3. BF	P94304	ATP-dependent zinc metalloprotease FtsH	6.93e-05	NA	1.65e-04	0.619
3. BF	B8H444	ATP-dependent zinc metalloprotease FtsH	1.88e-05	NA	0.003	0.601
3. BF	A6QBN8	ATP-dependent zinc metalloprotease FtsH	4.72e-05	NA	1.01e-07	0.6534
3. BF	A9GRC9	ATP-dependent zinc metalloprotease FtsH 1	9.05e-06	NA	3.18e-06	0.5998
3. BF	Q7SGP2	Peroxisomal biogenesis factor 6	1.03e-02	NA	7.10e-10	0.5613
3. BF	P03974	Transitional endoplasmic reticulum ATPase	5.82e-04	NA	3.36e-06	0.57
3. BF	C7MC16	ATP-dependent zinc metalloprotease FtsH	6.65e-05	NA	0.002	0.6522
3. BF	Q39444	ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment)	3.56e-05	NA	0.009	0.5637
3. BF	P73437	ATP-dependent zinc metalloprotease FtsH 4	3.28e-05	NA	1.14e-06	0.6155
3. BF	A5W382	ATP-dependent zinc metalloprotease FtsH	3.88e-05	NA	8.52e-06	0.7333
3. BF	C5CES8	ATP-dependent zinc metalloprotease FtsH	2.48e-05	NA	1.42e-05	0.6679
3. BF	B3EX35	Katanin p60 ATPase-containing subunit A-like 1	9.52e-07	NA	1.79e-06	0.462
3. BF	Q4L3G8	ATP-dependent zinc metalloprotease FtsH	9.89e-05	NA	0.001	0.654
3. BF	Q8PY58	Proteasome-activating nucleotidase	2.18e-06	NA	3.39e-08	0.6539
3. BF	O83746	ATP-dependent zinc metalloprotease FtsH	7.02e-05	NA	1.20e-04	0.6309
3. BF	Q9MUP8	Protein Ycf2	4.07e-04	NA	0.004	0.5846
3. BF	P75120	ATP-dependent zinc metalloprotease FtsH	2.28e-05	NA	7.66e-06	0.6151
3. BF	Q9C1E9	Peroxisomal biogenesis factor 6	1.85e-02	NA	1.95e-10	0.5345
3. BF	Q7QBW0	Spastin	2.69e-04	NA	0.001	0.5525
3. BF	B5X3X5	Katanin p60 ATPase-containing subunit A1	8.30e-07	NA	8.29e-07	0.5668
3. BF	Q60AK1	ATP-dependent zinc metalloprotease FtsH	1.82e-05	NA	4.41e-05	0.6512
3. BF	Q6MLS7	ATP-dependent zinc metalloprotease FtsH 1	8.54e-05	NA	0.004	0.6955
3. BF	C7M0M0	ATP-dependent zinc metalloprotease FtsH	4.83e-05	NA	5.80e-04	0.7409
3. BF	Q9WZ49	ATP-dependent zinc metalloprotease FtsH	2.97e-05	NA	1.01e-05	0.6482
3. BF	O78439	Uncharacterized AAA domain-containing protein ycf46	1.59e-05	NA	2.51e-04	0.5714
3. BF	Q8EUA6	ATP-dependent zinc metalloprotease FtsH	1.06e-04	NA	6.88e-05	0.6218
3. BF	Q0W257	Proteasome-activating nucleotidase	1.20e-06	NA	5.40e-07	0.6453
3. BF	A0LR74	ATP-dependent zinc metalloprotease FtsH	7.54e-05	NA	0.002	0.657
3. BF	Q9PUL2	Katanin p60 ATPase-containing subunit A1 (Fragment)	1.15e-06	NA	1.63e-05	0.5316
3. BF	Q8SSJ5	Cell division control protein 48	1.01e-03	NA	1.00e-06	0.5904
3. BF	B8GGN4	Proteasome-activating nucleotidase	1.53e-06	NA	7.42e-09	0.6565
3. BF	Q67LC0	ATP-dependent zinc metalloprotease FtsH 1	2.47e-05	NA	0.009	0.6302
3. BF	A6UQT3	Proteasome-activating nucleotidase	9.86e-07	NA	6.78e-10	0.6871
3. BF	A9BHD3	ATP-dependent zinc metalloprotease FtsH 2	3.14e-05	NA	1.29e-05	0.6266
3. BF	A1AT11	ATP-dependent zinc metalloprotease FtsH	3.30e-05	NA	3.94e-05	0.6592
3. BF	D3FA80	ATP-dependent zinc metalloprotease FtsH 2	1.53e-04	NA	0.002	0.6288
3. BF	D3EZK2	ATP-dependent zinc metalloprotease FtsH 3	1.66e-04	NA	0.003	0.61
3. BF	D1CDT8	ATP-dependent zinc metalloprotease FtsH	2.92e-05	NA	1.02e-06	0.5971
3. BF	Q67T82	ATP-dependent zinc metalloprotease FtsH 2	1.19e-05	NA	4.92e-05	0.6883
3. BF	A0L4S0	ATP-dependent zinc metalloprotease FtsH	1.44e-05	NA	0.002	0.6266
3. BF	Q1XDU8	Uncharacterized AAA domain-containing protein ycf46	6.84e-06	NA	8.43e-04	0.5303
3. BF	O28972	Cell division cycle protein 48 homolog AF_1297	5.38e-04	NA	1.26e-12	0.5454
3. BF	B4SCV5	ATP-dependent zinc metalloprotease FtsH	6.27e-05	NA	0.002	0.6572
3. BF	Q9ZM66	ATP-dependent zinc metalloprotease FtsH	4.66e-05	NA	1.06e-06	0.6443
3. BF	Q9YAC7	Proteasome-activating nucleotidase	2.06e-05	NA	5.32e-07	0.6469
3. BF	Q5AWS6	Cell division control protein 48	3.99e-04	NA	7.81e-07	0.6009
3. BF	Q3ZBT1	Transitional endoplasmic reticulum ATPase	7.92e-04	NA	3.48e-06	0.5826
3. BF	P63343	ATP-dependent zinc metalloprotease FtsH	1.26e-04	NA	3.49e-04	0.6527
3. BF	Q04Q03	ATP-dependent zinc metalloprotease FtsH	8.38e-05	NA	4.89e-04	0.6473
3. BF	A8XV40	Probable spastin homolog spas-1	7.21e-06	NA	1.70e-05	0.4538
3. BF	Q4R407	Katanin p60 ATPase-containing subunit A1	2.25e-06	NA	2.55e-06	0.5835
3. BF	B4U7U4	ATP-dependent zinc metalloprotease FtsH	4.87e-05	NA	0.002	0.6322
3. BF	D1C4U5	ATP-dependent zinc metalloprotease FtsH 3	1.39e-06	NA	1.02e-05	0.6447
3. BF	Q1XDF9	ATP-dependent zinc metalloprotease FtsH	9.83e-05	NA	1.62e-05	0.643
3. BF	P49825	ATP-dependent zinc metalloprotease FtsH	3.72e-05	NA	1.54e-04	0.6569
3. BF	A6TWP7	ATP-dependent zinc metalloprotease FtsH 2	1.09e-04	NA	6.30e-04	0.5874
3. BF	Q5UT56	Proteasome-activating nucleotidase 2	2.58e-06	NA	1.98e-08	0.687
3. BF	P71408	ATP-dependent zinc metalloprotease FtsH	4.72e-05	NA	1.12e-06	0.6455
4. PB	Q3UA06	Pachytene checkpoint protein 2 homolog	9.49e-05	2.85e-09	2.04e-06	NA
4. PB	Q9MAK9	26S proteasome regulatory subunit S10B homolog B	1.64e-06	9.55e-03	1.05e-07	NA
4. PB	A0PQT9	Proteasome-associated ATPase	9.10e-05	1.93e-02	0.009	NA
4. PB	Q8Z8V1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.69e-03	2.59e-06	0.022	NA
4. PB	Q5WVJ1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.37e-03	3.11e-07	0.004	NA
4. PB	Q9ZNT0	Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1	9.80e-07	1.97e-04	3.07e-12	NA
4. PB	Q54PJ1	26S proteasome regulatory subunit 10B	1.46e-06	6.02e-03	2.02e-07	NA
4. PB	P63346	Proteasome-associated ATPase	1.05e-04	4.07e-02	0.009	NA
4. PB	P52917	Vacuolar protein sorting-associated protein 4	6.18e-06	2.27e-05	6.55e-09	NA
4. PB	P9WQN4	Proteasome-associated ATPase	1.67e-04	4.07e-02	0.009	NA
4. PB	A6VME2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.15e-03	6.01e-07	0.015	NA
4. PB	Q9P7J5	Uncharacterized AAA domain-containing protein C24B10.10c	2.74e-06	8.12e-10	2.72e-05	NA
4. PB	B2UFQ3	ATP-dependent Clp protease ATP-binding subunit ClpX	7.06e-03	1.26e-06	0.021	NA
4. PB	Q505J9	Outer mitochondrial transmembrane helix translocase	1.12e-06	7.62e-10	2.67e-06	NA
4. PB	C7MWW2	Proteasome-associated ATPase	2.16e-04	2.77e-04	0.032	NA
4. PB	C6AHX0	AAA ATPase forming ring-shaped complexes	1.42e-05	1.94e-03	1.45e-04	NA
4. PB	P62334	26S proteasome regulatory subunit 10B	1.92e-06	6.13e-03	2.30e-09	NA
4. PB	A4FBX6	Proteasome-associated ATPase	3.95e-05	1.22e-03	0.038	NA
4. PB	C6DPU6	Proteasome-associated ATPase	1.16e-04	4.07e-02	0.009	NA
4. PB	P62333	26S proteasome regulatory subunit 10B	1.61e-06	6.13e-03	2.30e-09	NA
4. PB	Q503W7	Outer mitochondrial transmembrane helix translocase	1.13e-06	4.08e-09	2.20e-06	NA
4. PB	Q5X452	ATP-dependent Clp protease ATP-binding subunit ClpX	1.54e-03	3.07e-07	0.004	NA
4. PB	Q9D5T0	Outer mitochondrial transmembrane helix translocase	7.92e-07	1.05e-09	2.55e-06	NA
4. PB	Q0KBK3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.40e-03	4.28e-07	0.015	NA
4. PB	C0ZZV2	Proteasome-associated ATPase	1.32e-04	3.37e-04	0.018	NA
4. PB	C1AQ31	Proteasome-associated ATPase	1.23e-04	4.07e-02	0.009	NA
4. PB	D3K5L7	Pachytene checkpoint protein 2 homolog	7.95e-05	2.50e-08	8.31e-06	NA
4. PB	Q8VEJ9	Vacuolar protein sorting-associated protein 4A	6.31e-07	3.63e-03	6.88e-07	NA
4. PB	D3Q568	Proteasome-associated ATPase	3.32e-05	2.32e-03	0.032	NA
4. PB	A5ID16	ATP-dependent Clp protease ATP-binding subunit ClpX	3.71e-03	3.11e-07	0.004	NA
4. PB	Q8NBU5	Outer mitochondrial transmembrane helix translocase	5.20e-06	1.05e-09	2.55e-06	NA
4. PB	C6A7B2	AAA ATPase forming ring-shaped complexes	1.54e-05	1.94e-03	1.45e-04	NA
4. PB	D0LDS6	Proteasome-associated ATPase	1.58e-04	2.99e-03	0.010	NA
4. PB	Q5ZUE0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.50e-03	3.73e-07	0.004	NA
4. PB	Q793F9	Vacuolar protein sorting-associated protein 4A	6.67e-07	3.63e-03	6.88e-07	NA
4. PB	P54815	Mitochondrial sorting homolog	1.85e-06	2.92e-10	1.93e-06	NA
4. PB	Q9SEI3	26S proteasome regulatory subunit 10B homolog A	2.78e-06	1.14e-02	2.25e-08	NA
4. PB	P44838	ATP-dependent Clp protease ATP-binding subunit ClpX	3.25e-03	1.85e-07	0.005	NA
4. PB	C8XAR0	Proteasome-associated ATPase	7.16e-05	4.45e-03	0.009	NA
4. PB	Q5YUW4	Proteasome-associated ATPase	1.17e-04	5.55e-05	0.023	NA
4. PB	Q09535	Putative pachytene checkpoint protein 2	9.94e-06	9.53e-08	5.27e-06	NA
4. PB	Q54PT2	Vacuolar protein sorting-associated protein 4	3.78e-06	4.44e-04	1.16e-07	NA
4. PB	Q7ZZ25	Outer mitochondrial transmembrane helix translocase	5.04e-06	4.44e-12	2.98e-05	NA
4. PB	Q9SEI4	26S proteasome regulatory subunit 6B homolog	2.33e-06	4.71e-02	6.12e-06	NA
4. PB	Q6P4W8	Pachytene checkpoint protein 2 homolog	9.88e-05	1.17e-08	7.37e-08	NA
4. PB	A4TB65	Proteasome-associated ATPase	7.96e-05	2.44e-02	0.002	NA
4. PB	A1A0U4	AAA ATPase forming ring-shaped complexes	8.95e-06	3.71e-05	0.003	NA
4. PB	C1ASQ2	Proteasome-associated ATPase	1.24e-04	1.28e-04	0.019	NA
4. PB	E2R222	Pachytene checkpoint protein 2 homolog	8.57e-05	2.06e-08	1.75e-06	NA
4. PB	C6WIC8	Proteasome-associated ATPase	3.77e-05	3.53e-03	0.037	NA
4. PB	B2HFW2	Proteasome-associated ATPase	9.30e-05	2.38e-02	0.009	NA
4. PB	Q5XHZ9	Pachytene checkpoint protein 2 homolog	8.06e-05	1.51e-09	1.79e-06	NA
4. PB	Q5AG40	Vacuolar protein sorting-associated protein 4	1.67e-06	3.87e-05	1.63e-08	NA
4. PB	Q7XK25	Pachytene checkpoint protein 2 homolog	1.81e-05	1.13e-02	4.93e-08	NA
4. PB	Q01939	26S proteasome regulatory subunit 8 homolog	6.86e-07	2.20e-02	5.53e-05	NA
4. PB	Q9UN37	Vacuolar protein sorting-associated protein 4A	7.08e-07	2.28e-03	6.58e-07	NA
4. PB	A8M2A0	Proteasome-associated ATPase	3.39e-05	4.14e-02	0.050	NA
4. PB	Q6D826	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	4.37e-07	0.009	NA
4. PB	B2GIP2	AAA ATPase forming ring-shaped complexes	1.76e-04	1.41e-03	0.002	NA
4. PB	B1YJW0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.19e-03	6.94e-08	0.025	NA
4. PB	A0QZ54	Proteasome-associated ATPase	1.25e-04	2.91e-02	0.011	NA
4. PB	Q1LM63	ATP-dependent Clp protease ATP-binding subunit ClpX	4.51e-03	2.55e-07	0.023	NA
4. PB	P9WQN5	Proteasome-associated ATPase	1.44e-04	4.07e-02	0.009	NA
4. PB	E1C6Q1	Pachytene checkpoint protein 2 homolog	9.92e-05	1.14e-08	1.83e-07	NA
4. PB	O75351	Vacuolar protein sorting-associated protein 4B	3.48e-06	3.47e-04	7.14e-07	NA
4. PB	B3R4W2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.54e-03	2.97e-07	0.005	NA
4. PB	B1MAH2	Proteasome-associated ATPase	5.37e-05	1.88e-02	0.013	NA
4. PB	Q8CXB8	ATP-dependent Clp protease ATP-binding subunit ClpX	9.00e-03	1.43e-06	6.69e-05	NA
4. PB	Q09803	Suppressor protein of bem1/bed5 double mutants	9.89e-07	2.02e-03	5.43e-08	NA
4. PB	P46509	Proteasome-associated ATPase	5.96e-05	1.62e-02	0.008	NA
4. PB	D3R4I7	AAA ATPase forming ring-shaped complexes	4.17e-05	1.46e-03	1.49e-04	NA
4. PB	Q8H1F9	Pachytene checkpoint protein 2 homolog	1.87e-04	2.42e-05	5.53e-09	NA
4. PB	P46467	Vacuolar protein sorting-associated protein 4B	1.04e-06	5.50e-04	8.93e-07	NA
4. PB	Q15645	Pachytene checkpoint protein 2 homolog	6.42e-05	1.09e-08	1.25e-06	NA
4. PB	D1BS23	Proteasome-associated ATPase	1.49e-05	1.94e-07	0.032	NA
4. PB	Q6PH52	Pachytene checkpoint protein 2 homolog	5.30e-05	5.99e-10	2.45e-06	NA
4. PB	P46502	Probable 26S proteasome regulatory subunit 6B	2.28e-06	4.63e-02	0.002	NA
4. PB	A7GTF1	ATP-dependent Clp protease ATP-binding subunit ClpX	2.35e-03	2.80e-07	0.050	NA
4. PB	Q472D2	ATP-dependent Clp protease ATP-binding subunit ClpX	6.99e-03	2.50e-07	0.019	NA
4. PB	O74894	26S proteasome regulatory subunit 6B homolog	1.36e-06	5.60e-03	2.13e-07	NA
4. PB	A9IR50	ATP-dependent Clp protease ATP-binding subunit ClpX	4.05e-03	8.34e-07	0.048	NA
4. PB	P28737	Outer mitochondrial transmembrane helix translocase	4.12e-06	1.01e-09	4.68e-05	NA
4. PB	Q9K8F4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.38e-03	3.33e-07	0.001	NA
4. PB	O50202	Proteasome-associated ATPase	1.23e-04	3.37e-04	0.018	NA
4. PB	Q58889	Putative 26S proteasome regulatory subunit homolog MJ1494	4.59e-06	7.04e-07	1.21e-13	NA
4. PB	A5U4E1	Proteasome-associated ATPase	1.42e-04	4.07e-02	0.009	NA
4. PB	B8DTX4	AAA ATPase forming ring-shaped complexes	1.31e-05	1.94e-03	1.45e-04	NA
4. PB	A5WP89	Proteasome-associated ATPase	1.68e-04	4.07e-02	0.009	NA
4. PB	O74445	Probable 26S proteasome subunit rpt4	1.53e-06	2.96e-03	1.55e-06	NA
4. PB	Q0SIF4	Proteasome-associated ATPase	1.00e-04	7.95e-05	0.017	NA
5. P	B1XUS8	ATP-dependent Clp protease ATP-binding subunit ClpX	4.42e-03	3.27e-04	NA	NA
5. P	Q8PRG2	Chromosomal replication initiator protein DnaA	1.41e-04	2.50e-04	NA	NA
5. P	A4QGA7	ATP-dependent Clp protease ATP-binding subunit ClpX	3.01e-03	4.91e-05	NA	NA
5. P	C1C982	Chromosomal replication initiator protein DnaA	1.18e-04	1.88e-04	NA	NA
5. P	Q2G3T4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.28e-03	1.17e-05	NA	NA
5. P	A2SBG4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.67e-03	7.88e-07	NA	NA
5. P	C1FPH3	Chromosomal replication initiator protein DnaA	1.18e-04	1.49e-03	NA	NA
5. P	A8A2Y8	DnaA regulatory inactivator Hda	1.65e-04	5.20e-03	NA	NA
5. P	Q5XEM7	Chromosomal replication initiator protein DnaA	5.95e-05	9.42e-06	NA	NA
5. P	Q4URL5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.59e-03	8.62e-07	NA	NA
5. P	A0Q2L0	ATP-dependent Clp protease ATP-binding subunit ClpX	7.32e-04	1.03e-06	NA	NA
5. P	B0RAS4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.05e-03	1.86e-05	NA	NA
5. P	A6TCA8	DnaA regulatory inactivator Hda	8.98e-04	1.90e-02	NA	NA
5. P	Q1J960	Chromosomal replication initiator protein DnaA	7.89e-05	1.47e-05	NA	NA
5. P	P0DA37	ATP-dependent Clp protease ATP-binding subunit ClpX	2.71e-03	8.92e-07	NA	NA
5. P	B9DNC0	ATP-dependent Clp protease ATP-binding subunit ClpX	1.68e-03	1.47e-07	NA	NA
5. P	A9WAN1	Chromosomal replication initiator protein DnaA	1.33e-04	2.32e-03	NA	NA
5. P	A3DHZ4	Chromosomal replication initiator protein DnaA	8.65e-05	2.06e-03	NA	NA
5. P	B7GSF9	Chromosomal replication initiator protein DnaA	1.45e-04	3.01e-02	NA	NA
5. P	Q7UKU7	ATP-dependent Clp protease ATP-binding subunit ClpX	8.47e-03	6.36e-04	NA	NA
5. P	B7M553	Chromosomal replication initiator protein DnaA	1.11e-04	7.79e-04	NA	NA
5. P	Q08A51	Chromosomal replication initiator protein DnaA	1.00e-04	1.00e-03	NA	NA
5. P	P68867	Chromosomal replication initiator protein DnaA	1.44e-04	3.54e-04	NA	NA
5. P	B0BX22	ATP-dependent protease ATPase subunit HslU	3.04e-02	3.74e-02	NA	NA
5. P	Q1B601	ATP-dependent Clp protease ATP-binding subunit ClpX	4.82e-03	4.48e-06	NA	NA
5. P	A7IB67	Chromosomal replication initiator protein DnaA	6.54e-04	1.83e-02	NA	NA
5. P	Q67SJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.49e-04	2.44e-08	NA	NA
5. P	A1KLF3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.80e-03	5.44e-06	NA	NA
5. P	P70730	ATP-dependent Clp protease ATP-binding subunit ClpX	4.85e-03	2.19e-08	NA	NA
5. P	A5E812	Chromosomal replication initiator protein DnaA	5.99e-05	2.24e-03	NA	NA
5. P	B0RH69	Chromosomal replication initiator protein DnaA	9.24e-05	1.73e-04	NA	NA
5. P	C1AVQ3	ATP-dependent Clp protease ATP-binding subunit ClpX	7.60e-03	2.22e-06	NA	NA
5. P	A3PBT9	Chromosomal replication initiator protein DnaA	4.85e-05	1.26e-03	NA	NA
5. P	Q5HJZ5	Chromosomal replication initiator protein DnaA	1.25e-04	3.54e-04	NA	NA
5. P	B0TAK8	Chromosomal replication initiator protein DnaA	1.07e-04	1.63e-03	NA	NA
5. P	Q6MRS1	Chromosomal replication initiator protein DnaA	9.72e-05	3.47e-04	NA	NA
5. P	B7MYC3	DnaA regulatory inactivator Hda	1.87e-04	5.20e-03	NA	NA
5. P	B8D6H2	ORC1-type DNA replication protein	4.28e-04	3.87e-02	NA	NA
5. P	B2SMI2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.94e-03	8.82e-07	NA	NA
5. P	A0R196	ATP-dependent Clp protease ATP-binding subunit ClpX	3.98e-03	3.52e-06	NA	NA
5. P	A9MM22	ATP-dependent Clp protease ATP-binding subunit ClpX	4.12e-03	2.32e-06	NA	NA
5. P	Q5FN15	Chromosomal replication initiator protein DnaA	1.48e-04	8.10e-04	NA	NA
5. P	Q7UA37	ATP-dependent Clp protease ATP-binding subunit ClpX	1.31e-03	7.28e-06	NA	NA
5. P	Q5NNY7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.31e-03	2.10e-06	NA	NA
5. P	C1CLR8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.72e-03	1.89e-07	NA	NA
5. P	P9WPB9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.22e-03	5.38e-06	NA	NA
5. P	Q68X52	ATP-dependent protease ATPase subunit HslU	2.77e-02	2.60e-02	NA	NA
5. P	Q0TEZ2	DnaA regulatory inactivator Hda	3.66e-05	5.20e-03	NA	NA
5. P	Q30Z80	ATP-dependent Clp protease ATP-binding subunit ClpX	4.46e-04	8.06e-07	NA	NA
5. P	A4YVM3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.67e-03	7.79e-07	NA	NA
5. P	Q73XN1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.12e-03	4.99e-06	NA	NA
5. P	Q7MMG6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.13e-03	9.42e-06	NA	NA
5. P	Q3Z4W5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.79e-03	7.45e-07	NA	NA
5. P	B8D9Q3	ATP-dependent Clp protease ATP-binding subunit ClpX	3.50e-03	4.85e-07	NA	NA
5. P	A8G7Q2	Chromosomal replication initiator protein DnaA	1.07e-04	5.34e-04	NA	NA
5. P	Q9X5N1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.78e-03	2.33e-07	NA	NA
5. P	A7NFB8	Chromosomal replication initiator protein DnaA	2.51e-04	4.22e-04	NA	NA
5. P	Q8D347	ATP-dependent Clp protease ATP-binding subunit ClpX	3.36e-03	1.34e-08	NA	NA
5. P	P29440	Chromosomal replication initiator protein DnaA	9.24e-05	7.35e-03	NA	NA
5. P	Q0VQ89	ATP-dependent Clp protease ATP-binding subunit ClpX	3.90e-03	1.81e-07	NA	NA
5. P	Q4LAL5	Chromosomal replication initiator protein DnaA	3.21e-04	1.58e-03	NA	NA
5. P	B7N678	DnaA regulatory inactivator Hda	3.96e-05	5.20e-03	NA	NA
5. P	A5VQN3	ATP-dependent Clp protease ATP-binding subunit ClpX	5.44e-03	1.49e-06	NA	NA
5. P	Q5F8W5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.54e-03	6.00e-06	NA	NA
5. P	B9L0U6	Chromosomal replication initiator protein DnaA	6.63e-05	1.14e-05	NA	NA
5. P	C3L704	ATP-dependent Clp protease ATP-binding subunit ClpX	2.55e-03	1.47e-07	NA	NA
5. P	Q0I0U8	Chromosomal replication initiator protein DnaA	9.96e-05	3.47e-04	NA	NA
5. P	Q3IY61	Chromosomal replication initiator protein DnaA	8.04e-05	2.88e-02	NA	NA
5. P	C0MC62	Chromosomal replication initiator protein DnaA	1.10e-04	2.07e-05	NA	NA
5. P	Q65PM2	Chromosomal replication initiator protein DnaA	2.19e-04	2.16e-04	NA	NA
5. P	B0TWF7	Chromosomal replication initiator protein DnaA	1.87e-04	3.77e-02	NA	NA
5. P	C1CFF2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.67e-03	1.89e-07	NA	NA
5. P	Q2W3I0	ATP-dependent Clp protease ATP-binding subunit ClpX	5.95e-03	2.97e-07	NA	NA
5. P	Q04WF7	Chromosomal replication initiator protein DnaA	1.36e-04	9.84e-05	NA	NA
5. P	P0A6H1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.27e-03	7.45e-07	NA	NA
5. P	A9QZQ2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.83e-03	4.09e-07	NA	NA
5. P	Q9JTX8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.21e-03	5.94e-07	NA	NA
5. P	B9KJU8	ATP-dependent Clp protease ATP-binding subunit ClpX	6.17e-03	6.88e-07	NA	NA
5. P	C4K2L5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.95e-03	4.53e-07	NA	NA
5. P	B5XT51	Chromosomal replication initiator protein DnaA	1.93e-04	4.57e-04	NA	NA
5. P	B2FQR3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.04e-03	1.35e-06	NA	NA
5. P	Q8UFY5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.97e-03	9.33e-07	NA	NA
5. P	A7GIH1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.84e-04	5.62e-07	NA	NA
5. P	A4XAH9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.41e-04	2.13e-06	NA	NA
5. P	A9N9A3	Holliday junction ATP-dependent DNA helicase RuvB	4.02e-05	1.06e-02	NA	NA
5. P	Q48AS7	Chromosomal replication initiator protein DnaA	1.19e-04	1.82e-04	NA	NA
5. P	B5QTJ7	ATP-dependent Clp protease ATP-binding subunit ClpX	3.92e-03	7.45e-07	NA	NA
5. P	B3PHK5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.61e-03	8.82e-07	NA	NA
5. P	Q602N0	Chromosomal replication initiator protein DnaA	7.74e-05	3.83e-05	NA	NA
5. P	C4Z1T5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.21e-03	2.80e-06	NA	NA
5. P	C1D6I2	Chromosomal replication initiator protein DnaA	2.11e-04	3.16e-03	NA	NA
5. P	Q51858	Protein CbbQ	1.32e-03	1.31e-02	NA	NA
5. P	B5RPV8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.45e-03	1.55e-07	NA	NA
5. P	A8GYE3	Chromosomal replication initiator protein DnaA	9.64e-05	5.15e-03	NA	NA
5. P	Q48U22	ATP-dependent Clp protease ATP-binding subunit ClpX	3.12e-03	8.92e-07	NA	NA
5. P	A5WC69	ATP-dependent Clp protease ATP-binding subunit ClpX	2.52e-03	1.46e-04	NA	NA
5. P	Q3K9X0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.60e-03	5.88e-07	NA	NA
5. P	C5BTX7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.77e-03	3.48e-07	NA	NA
5. P	Q1C4K9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.75e-03	4.09e-07	NA	NA
5. P	B5E568	Chromosomal replication initiator protein DnaA	8.79e-05	1.88e-04	NA	NA
5. P	Q83BE0	Holliday junction ATP-dependent DNA helicase RuvB	4.12e-05	1.06e-02	NA	NA
5. P	Q4UMY8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.97e-03	1.85e-07	NA	NA
5. P	Q9PJB0	Chromosomal replication initiator protein DnaA	3.10e-04	5.44e-05	NA	NA
5. P	Q9Z8B9	Chromosomal replication initiator protein DnaA 2	8.21e-05	1.84e-04	NA	NA
5. P	B1LC08	Chromosomal replication initiator protein DnaA	7.62e-05	4.25e-03	NA	NA
5. P	Q9JUB0	Holliday junction ATP-dependent DNA helicase RuvB	4.73e-06	6.72e-03	NA	NA
5. P	Q8YED5	Chromosomal replication initiator protein DnaA	1.30e-04	5.60e-03	NA	NA
5. P	B0CGR0	ATP-dependent Clp protease ATP-binding subunit ClpX	5.72e-03	1.95e-06	NA	NA
5. P	Q1MMD6	Chromosomal replication initiator protein DnaA	5.67e-05	7.87e-04	NA	NA
5. P	Q5PL41	DnaA regulatory inactivator Hda	3.02e-04	3.01e-02	NA	NA
5. P	Q3BWQ0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	9.22e-07	NA	NA
5. P	Q6AFZ6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.26e-03	1.18e-06	NA	NA
5. P	Q5WEN9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.58e-03	5.01e-07	NA	NA
5. P	B1YRZ4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.24e-03	4.18e-07	NA	NA
5. P	B4TAU9	Chromosomal replication initiator protein DnaA	7.72e-05	1.82e-03	NA	NA
5. P	Q8Y7K9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.17e-03	5.31e-07	NA	NA
5. P	Q0SWX6	Chromosomal replication initiator protein DnaA	2.22e-04	2.38e-04	NA	NA
5. P	B8ZRP1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.82e-03	4.73e-06	NA	NA
5. P	Q89269	Protein Rep40	NA	1.93e-03	NA	NA
5. P	B0BAG0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.21e-03	3.52e-07	NA	NA
5. P	Q9CJJ2	Chromosomal replication initiator protein DnaA	1.25e-04	1.93e-04	NA	NA
5. P	Q1WU81	ATP-dependent Clp protease ATP-binding subunit ClpX	5.21e-03	4.13e-07	NA	NA
5. P	A8GPK1	ATP-dependent Clp protease ATP-binding subunit ClpX	2.28e-03	1.34e-07	NA	NA
5. P	Q57G10	Chromosomal replication initiator protein DnaA	3.93e-04	5.60e-03	NA	NA
5. P	Q1QCY5	Holliday junction ATP-dependent DNA helicase RuvB	2.55e-05	5.70e-03	NA	NA
5. P	A7ZX96	ATP-dependent Clp protease ATP-binding subunit ClpX	4.12e-03	7.45e-07	NA	NA
5. P	Q8NW72	ATP-dependent Clp protease ATP-binding subunit ClpX	1.45e-03	2.68e-07	NA	NA
5. P	Q82Y56	ATP-dependent Clp protease ATP-binding subunit ClpX	3.47e-03	5.94e-07	NA	NA
5. P	Q7N0L4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.88e-03	7.70e-07	NA	NA
5. P	Q1J741	ATP-dependent Clp protease ATP-binding subunit ClpX	3.13e-03	8.92e-07	NA	NA
5. P	Q47FB7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.38e-03	1.61e-06	NA	NA
5. P	Q5ZZK8	Chromosomal replication initiator protein DnaA	1.57e-04	9.84e-05	NA	NA
5. P	Q5PKU6	Chromosomal replication initiator protein DnaA	9.87e-05	1.82e-03	NA	NA
5. P	B1L1K6	Chromosomal replication initiator protein DnaA	1.23e-04	1.38e-03	NA	NA
5. P	B0SEC2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.55e-03	3.33e-07	NA	NA
5. P	B1YGB2	Chromosomal replication initiator protein DnaA	1.87e-04	1.99e-04	NA	NA
5. P	Q5M0S4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.76e-03	2.15e-07	NA	NA
5. P	B7VHZ9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.34e-03	1.49e-05	NA	NA
5. P	B2S1V1	Chromosomal replication initiator protein DnaA	2.16e-04	3.18e-04	NA	NA
5. P	P39261	Uncharacterized 36.7 kDa protein in nrdC-mobD intergenic region	NA	8.12e-10	NA	NA
5. P	C1C8G0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.51e-03	1.89e-07	NA	NA
5. P	C5CJT5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.08e-03	7.12e-07	NA	NA
5. P	B3E1Z3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.08e-03	1.52e-06	NA	NA
5. P	Q823E6	Chromosomal replication initiator protein DnaA 2	1.09e-04	3.08e-04	NA	NA
5. P	P29434	Chromosomal replication initiator protein DnaA	5.84e-05	1.40e-03	NA	NA
5. P	P95648	Protein CbbX	4.84e-05	1.26e-04	NA	NA
5. P	B3ENA3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.92e-03	3.77e-07	NA	NA
5. P	Q2NX49	Chromosomal replication initiator protein DnaA	1.27e-04	4.37e-03	NA	NA
5. P	P69932	DnaA regulatory inactivator Hda	3.69e-05	5.20e-03	NA	NA
5. P	A9W5F6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.02e-03	1.84e-06	NA	NA
5. P	Q57I00	Chromosomal replication initiator protein DnaA	9.79e-05	1.66e-03	NA	NA
5. P	C5CH91	Chromosomal replication initiator protein DnaA	3.25e-04	4.33e-03	NA	NA
5. P	B8I8F6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.68e-03	1.44e-06	NA	NA
5. P	B1WUD2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.46e-03	2.40e-06	NA	NA
5. P	O67356	ATP-dependent Clp protease ATP-binding subunit ClpX	1.92e-03	1.27e-05	NA	NA
5. P	Q15R47	ATP-dependent Clp protease ATP-binding subunit ClpX	4.99e-03	3.00e-07	NA	NA
5. P	A2RH74	Chromosomal replication initiator protein DnaA	1.62e-04	1.40e-04	NA	NA
5. P	B2TUS6	Chromosomal replication initiator protein DnaA	1.70e-04	1.01e-03	NA	NA
5. P	B6HZP5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.82e-03	7.45e-07	NA	NA
5. P	B1XFM6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.12e-03	7.45e-07	NA	NA
5. P	Q38ZS4	Chromosomal replication initiator protein DnaA	8.82e-05	1.54e-03	NA	NA
5. P	B8E291	ATP-dependent Clp protease ATP-binding subunit ClpX	4.98e-04	3.53e-08	NA	NA
5. P	A5GDX1	Chromosomal replication initiator protein DnaA	1.02e-04	1.22e-04	NA	NA
5. P	A1U1Q2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.97e-03	7.62e-07	NA	NA
5. P	Q0HPD4	Chromosomal replication initiator protein DnaA	1.09e-04	4.66e-04	NA	NA
5. P	A4T2N8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.00e-03	3.68e-06	NA	NA
5. P	B8FVI0	ATP-dependent Clp protease ATP-binding subunit ClpX	1.21e-03	1.40e-07	NA	NA
5. P	C5BHC5	Chromosomal replication initiator protein DnaA	1.47e-04	2.53e-04	NA	NA
5. P	Q2IWZ3	ATP-dependent Clp protease ATP-binding subunit ClpX	5.93e-03	7.79e-07	NA	NA
5. P	B1MXT8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.49e-03	6.36e-07	NA	NA
5. P	B5YI39	ATP-dependent Clp protease ATP-binding subunit ClpX	2.81e-03	1.97e-06	NA	NA
5. P	B1JSF7	DnaA regulatory inactivator Hda	2.35e-04	2.03e-02	NA	NA
5. P	Q663T2	Chromosomal replication initiator protein DnaA	1.38e-04	2.38e-04	NA	NA
5. P	Q607D1	ATP-dependent Clp protease ATP-binding subunit ClpX 3	6.90e-04	6.82e-05	NA	NA
5. P	Q9CBY6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.10e-03	4.73e-06	NA	NA
5. P	A5I9F1	Chromosomal replication initiator protein DnaA	1.67e-04	9.84e-05	NA	NA
5. P	Q8DWN9	Chromosomal replication initiator protein DnaA	1.31e-04	1.03e-04	NA	NA
5. P	A8YTI2	Holliday junction ATP-dependent DNA helicase RuvB	7.85e-07	2.93e-02	NA	NA
5. P	B5E6L2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.24e-03	2.05e-07	NA	NA
5. P	Q8XKK2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.46e-03	2.68e-07	NA	NA
5. P	B8EIL3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.19e-03	1.26e-06	NA	NA
5. P	Q0AK27	Chromosomal replication initiator protein DnaA	9.97e-05	1.05e-02	NA	NA
5. P	Q2NKC5	Chromosomal replication initiator protein DnaA	1.27e-04	2.12e-02	NA	NA
5. P	P05648	Chromosomal replication initiator protein DnaA	1.35e-04	2.01e-04	NA	NA
5. P	Q821L9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.49e-03	1.61e-07	NA	NA
5. P	Q1R4N5	Chromosomal replication initiator protein DnaA	1.34e-04	7.79e-04	NA	NA
5. P	B5E7P6	Chromosomal replication initiator protein DnaA	6.81e-05	1.31e-03	NA	NA
5. P	B2S3A2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.55e-03	1.01e-06	NA	NA
5. P	Q97N35	Chromosomal replication initiator protein DnaA	1.93e-04	1.13e-04	NA	NA
5. P	Q1MIM6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.17e-03	4.09e-07	NA	NA
5. P	A6V718	ATP-dependent Clp protease ATP-binding subunit ClpX	5.78e-03	1.54e-06	NA	NA
5. P	Q5GT09	Chromosomal replication initiator protein DnaA	8.82e-05	9.38e-03	NA	NA
5. P	P49826	Protein CfxQ homolog	1.24e-05	7.87e-04	NA	NA
5. P	B8DAQ9	Chromosomal replication initiator protein DnaA	1.32e-04	3.61e-04	NA	NA
5. P	Q5P160	ATP-dependent Clp protease ATP-binding subunit ClpX	3.58e-03	6.65e-07	NA	NA
5. P	B2TXS1	DnaA regulatory inactivator Hda	4.01e-05	5.20e-03	NA	NA
5. P	P0A3A2	Chromosomal replication initiator protein DnaA	8.24e-05	4.06e-04	NA	NA
5. P	Q8E2I7	Chromosomal replication initiator protein DnaA	1.02e-04	4.91e-05	NA	NA
5. P	A0KR35	Chromosomal replication initiator protein DnaA	1.12e-04	4.31e-04	NA	NA
5. P	Q8EKT2	Chromosomal replication initiator protein DnaA	1.07e-04	5.09e-04	NA	NA
5. P	Q1CK37	DnaA regulatory inactivator Hda	3.25e-04	2.03e-02	NA	NA
5. P	Q6LW50	Chromosomal replication initiator protein DnaA	4.96e-04	9.64e-03	NA	NA
5. P	Q8KFC3	ATP-dependent Clp protease ATP-binding subunit ClpX	3.21e-03	1.72e-06	NA	NA
5. P	Q67TK7	Chromosomal replication initiator protein DnaA	2.83e-04	3.63e-05	NA	NA
5. P	A7ZPT9	DnaA regulatory inactivator Hda	1.79e-04	5.20e-03	NA	NA
5. P	Q5NH46	ATP-dependent Clp protease ATP-binding subunit ClpX	4.23e-03	7.88e-07	NA	NA
5. P	Q2JW64	ATP-dependent Clp protease ATP-binding subunit ClpX	4.16e-03	9.42e-06	NA	NA
5. P	C5BXF8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.51e-03	2.56e-06	NA	NA
5. P	A3D306	ATP-dependent Clp protease ATP-binding subunit ClpX	2.69e-03	2.99e-06	NA	NA
5. P	A2C5R5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.21e-03	1.97e-06	NA	NA
5. P	A5VJ94	ATP-dependent Clp protease ATP-binding subunit ClpX	2.75e-03	2.78e-08	NA	NA
5. P	Q9PKE4	Chromosomal replication initiator protein DnaA 1	2.26e-04	4.38e-06	NA	NA
5. P	C1ES08	Chromosomal replication initiator protein DnaA	1.41e-04	2.86e-05	NA	NA
5. P	B0B8T1	ATP-dependent Clp protease ATP-binding subunit ClpX	8.38e-03	3.52e-07	NA	NA
5. P	Q7M8U5	ATP-dependent Clp protease ATP-binding subunit ClpX 2	2.13e-03	4.38e-06	NA	NA
5. P	B0SZ62	ATP-dependent Clp protease ATP-binding subunit ClpX	1.38e-03	2.56e-06	NA	NA
5. P	B4SU11	Chromosomal replication initiator protein DnaA	1.46e-04	5.93e-06	NA	NA
5. P	B6JP23	Chromosomal replication initiator protein DnaA	4.43e-04	4.48e-04	NA	NA
5. P	Q74JU4	ATP-dependent Clp protease ATP-binding subunit ClpX	1.92e-03	6.51e-09	NA	NA
5. P	Q1XDQ9	Protein CfxQ homolog	1.55e-05	6.54e-06	NA	NA
5. P	Q9RYE7	Chromosomal replication initiator protein DnaA	1.81e-04	1.06e-06	NA	NA
5. P	A6TM62	ATP-dependent Clp protease ATP-binding subunit ClpX	3.31e-03	1.34e-07	NA	NA
5. P	B2G4Y5	Chromosomal replication initiator protein DnaA	8.41e-05	1.09e-04	NA	NA
5. P	B5BD82	ATP-dependent Clp protease ATP-binding subunit ClpX	1.71e-03	7.53e-07	NA	NA
5. P	A5HXP7	Chromosomal replication initiator protein DnaA	1.13e-04	5.66e-04	NA	NA
5. P	B9DU73	ATP-dependent Clp protease ATP-binding subunit ClpX	3.31e-03	7.02e-08	NA	NA
5. P	Q60C67	ATP-dependent Clp protease ATP-binding subunit ClpX 1	4.48e-03	9.12e-07	NA	NA
5. P	B7UJR1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.25e-03	7.45e-07	NA	NA
5. P	A3PFE5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.05e-03	1.98e-05	NA	NA
5. P	Q056V2	Chromosomal replication initiator protein DnaA	1.41e-04	9.84e-05	NA	NA
5. P	Q180E8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.65e-03	2.25e-07	NA	NA
5. P	Q3KKG1	Chromosomal replication initiator protein DnaA	2.94e-04	3.26e-02	NA	NA
5. P	C4KZZ3	Chromosomal replication initiator protein DnaA	2.01e-04	2.66e-04	NA	NA
5. P	Q8CNY5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.52e-03	7.81e-08	NA	NA
5. P	Q5TYS0	Lactation elevated protein 1 homolog B	3.25e-01	1.40e-03	NA	NA
5. P	A6QHK8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.47e-03	2.93e-07	NA	NA
5. P	B3W6N4	Chromosomal replication initiator protein DnaA	1.34e-04	8.92e-04	NA	NA
5. P	Q8FTE3	AAA ATPase forming ring-shaped complexes	5.15e-05	6.94e-04	NA	NA
5. P	Q2P6Y9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.66e-03	7.70e-07	NA	NA
5. P	B8CY73	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	1.89e-07	NA	NA
5. P	B2I8K4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.28e-03	8.72e-07	NA	NA
5. P	Q1JHC2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.82e-03	8.92e-07	NA	NA
5. P	A0AI71	ATP-dependent Clp protease ATP-binding subunit ClpX	3.16e-03	4.58e-07	NA	NA
5. P	P34028	Chromosomal replication initiator protein DnaA	1.75e-04	4.20e-05	NA	NA
5. P	Q12BY1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.75e-03	6.15e-07	NA	NA
5. P	Q04N63	Chromosomal replication initiator protein DnaA	1.07e-04	2.16e-04	NA	NA
5. P	P50866	ATP-dependent Clp protease ATP-binding subunit ClpX	2.54e-03	3.07e-07	NA	NA
5. P	Q8G6K0	Chromosomal replication initiator protein DnaA	1.66e-04	4.14e-02	NA	NA
5. P	Q5M6L8	Chromosomal replication initiator protein DnaA	1.05e-04	3.24e-05	NA	NA
5. P	P35890	Chromosomal replication initiator protein DnaA	4.87e-05	9.27e-04	NA	NA
5. P	Q1MQ78	ATP-dependent Clp protease ATP-binding subunit ClpX	3.39e-03	2.27e-06	NA	NA
5. P	Q5WM31	Chromosomal replication initiator protein DnaA	8.90e-05	1.28e-04	NA	NA
5. P	B8ZJH9	Chromosomal replication initiator protein DnaA	9.25e-05	2.16e-04	NA	NA
5. P	Q04JH9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.87e-03	1.89e-07	NA	NA
5. P	Q7VMW1	Chromosomal replication initiator protein DnaA	1.54e-04	1.31e-03	NA	NA
5. P	B6I3T5	Chromosomal replication initiator protein DnaA	1.47e-04	7.79e-04	NA	NA
5. P	B7LME1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.04e-03	8.43e-07	NA	NA
5. P	A7ZTQ8	Chromosomal replication initiator protein DnaA	1.38e-04	7.79e-04	NA	NA
5. P	B0RLI8	Chromosomal replication initiator protein DnaA	1.41e-04	2.43e-04	NA	NA
5. P	Q6MBE8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.40e-03	1.09e-08	NA	NA
5. P	C3PGA0	AAA ATPase forming ring-shaped complexes	3.78e-05	1.49e-04	NA	NA
5. P	Q68W45	ATP-dependent Clp protease ATP-binding subunit ClpX	3.76e-03	1.59e-07	NA	NA
5. P	A0KJU2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.47e-03	2.30e-06	NA	NA
5. P	Q661I4	Chromosomal replication initiator protein DnaA	1.24e-04	1.50e-04	NA	NA
5. P	A8GRL8	ATP-dependent protease ATPase subunit HslU	2.83e-02	3.74e-02	NA	NA
5. P	Q9X9D5	Chromosomal replication initiator protein DnaA	1.11e-04	9.84e-05	NA	NA
5. P	A5ITJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.11e-03	2.93e-07	NA	NA
5. P	Q0I8T6	Chromosomal replication initiator protein DnaA	1.52e-04	9.22e-03	NA	NA
5. P	A0KEC3	Chromosomal replication initiator protein DnaA	6.16e-05	8.74e-06	NA	NA
5. P	Q62JK8	ATP-dependent Clp protease ATP-binding subunit ClpX	6.00e-03	7.88e-07	NA	NA
5. P	Q89KG2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.83e-03	3.69e-07	NA	NA
5. P	Q11J59	ATP-dependent Clp protease ATP-binding subunit ClpX	5.73e-03	1.02e-06	NA	NA
5. P	Q6GG31	ATP-dependent Clp protease ATP-binding subunit ClpX	1.52e-03	3.48e-07	NA	NA
5. P	Q1GGF7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.28e-03	1.07e-06	NA	NA
5. P	Q8PEH5	Chromosomal replication initiator protein DnaA	1.42e-04	2.43e-04	NA	NA
5. P	B6J507	Holliday junction ATP-dependent DNA helicase RuvB	2.38e-06	1.06e-02	NA	NA
5. P	A1TCB3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.12e-03	3.16e-06	NA	NA
5. P	A7H194	Chromosomal replication initiator protein DnaA	4.09e-05	3.63e-05	NA	NA
5. P	A2SCK0	Holliday junction ATP-dependent DNA helicase RuvB	2.96e-05	3.71e-02	NA	NA
5. P	A0K846	ATP-dependent Clp protease ATP-binding subunit ClpX	4.00e-03	4.37e-07	NA	NA
5. P	Q04CX5	Chromosomal replication initiator protein DnaA	1.50e-04	3.54e-04	NA	NA
5. P	B6J8W3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.83e-03	9.98e-07	NA	NA
5. P	Q4A180	Chromosomal replication initiator protein DnaA	1.16e-04	1.14e-03	NA	NA
5. P	B7NQN5	DnaA regulatory inactivator Hda	3.78e-05	5.20e-03	NA	NA
5. P	P68866	Chromosomal replication initiator protein DnaA	7.91e-05	3.54e-04	NA	NA
5. P	Q7W2K5	Chromosomal replication initiator protein DnaA	9.38e-05	4.10e-03	NA	NA
5. P	B2UVS4	Chromosomal replication initiator protein DnaA	3.43e-04	3.65e-04	NA	NA
5. P	B1KCX3	Chromosomal replication initiator protein DnaA	1.14e-04	4.88e-03	NA	NA
5. P	Q74M34	Chromosomal replication initiator protein DnaA	6.99e-05	2.30e-03	NA	NA
5. P	A4W7A9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.75e-03	4.58e-07	NA	NA
5. P	D2Q9C6	AAA ATPase forming ring-shaped complexes	9.47e-05	2.20e-03	NA	NA
5. P	B7NJ56	ATP-dependent Clp protease ATP-binding subunit ClpX	3.90e-03	7.45e-07	NA	NA
5. P	B5Z033	DnaA regulatory inactivator Hda	3.88e-05	5.20e-03	NA	NA
5. P	A6GYW8	Chromosomal replication initiator protein DnaA	2.43e-04	3.02e-03	NA	NA
5. P	Q058F9	Chromosomal replication initiator protein DnaA	4.23e-05	9.45e-04	NA	NA
5. P	B1JHS0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.55e-03	4.09e-07	NA	NA
5. P	A9C1U9	ATP-dependent Clp protease ATP-binding subunit ClpX	6.08e-03	4.18e-07	NA	NA
5. P	A4SDM4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.45e-03	8.20e-06	NA	NA
5. P	Q042T7	ATP-dependent Clp protease ATP-binding subunit ClpX	1.34e-03	6.43e-09	NA	NA
5. P	B7GFK8	Chromosomal replication initiator protein DnaA	1.72e-04	1.14e-05	NA	NA
5. P	A9KEU8	Chromosomal replication initiator protein DnaA	1.73e-04	8.11e-06	NA	NA
5. P	Q1JM77	ATP-dependent Clp protease ATP-binding subunit ClpX	2.69e-03	1.43e-06	NA	NA
5. P	B7UMG9	Chromosomal replication initiator protein DnaA	1.50e-04	7.79e-04	NA	NA
5. P	A0QDF5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.27e-03	4.99e-06	NA	NA
5. P	Q6MEG8	Chromosomal replication initiator protein DnaA 2	1.67e-04	1.64e-03	NA	NA
5. P	Q49YA6	ATP-dependent Clp protease ATP-binding subunit ClpX	1.62e-03	2.38e-07	NA	NA
5. P	Q8F353	ATP-dependent Clp protease ATP-binding subunit ClpX	6.65e-03	9.76e-07	NA	NA
5. P	Q74GG6	Chromosomal replication initiator protein DnaA	8.52e-05	1.13e-04	NA	NA
5. P	B2RL24	ATP-dependent Clp protease ATP-binding subunit ClpX	6.46e-04	2.22e-08	NA	NA
5. P	A6LPB1	Chromosomal replication initiator protein DnaA	1.40e-04	2.32e-05	NA	NA
5. P	B9IZ47	ATP-dependent Clp protease ATP-binding subunit ClpX	2.26e-03	1.47e-07	NA	NA
5. P	P69931	DnaA regulatory inactivator Hda	1.67e-04	5.20e-03	NA	NA
5. P	Q0ST54	ATP-dependent Clp protease ATP-binding subunit ClpX	2.64e-03	2.90e-07	NA	NA
5. P	Q3JF39	Chromosomal replication initiator protein DnaA	6.68e-05	2.16e-04	NA	NA
5. P	B0UD19	ATP-dependent Clp protease ATP-binding subunit ClpX	4.16e-03	1.26e-06	NA	NA
5. P	Q6GKU4	Chromosomal replication initiator protein DnaA	2.21e-04	5.29e-04	NA	NA
5. P	B3DP22	Chromosomal replication initiator protein DnaA	2.67e-04	4.14e-02	NA	NA
5. P	Q256C3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.39e-03	1.47e-07	NA	NA
5. P	B0BYF7	Chromosomal replication initiator protein DnaA	1.31e-04	9.30e-03	NA	NA
5. P	Q83NZ5	Chromosomal replication initiator protein DnaA	1.30e-04	2.83e-03	NA	NA
5. P	A8LJA7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.11e-03	6.96e-07	NA	NA
5. P	C4ZGF5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.66e-03	3.18e-07	NA	NA
5. P	B0KJG7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.77e-03	4.37e-07	NA	NA
5. P	Q97FT7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.50e-03	1.80e-06	NA	NA
5. P	B7LCN6	DnaA regulatory inactivator Hda	3.53e-05	5.20e-03	NA	NA
5. P	B3DRN4	AAA ATPase forming ring-shaped complexes	1.39e-05	2.46e-04	NA	NA
5. P	B8GX14	ATP-dependent Clp protease ATP-binding subunit ClpX	4.67e-03	3.37e-06	NA	NA
5. P	Q0HHA2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.20e-03	3.48e-06	NA	NA
5. P	A7HY53	ATP-dependent Clp protease ATP-binding subunit ClpX	6.52e-03	2.74e-06	NA	NA
5. P	A5IIK7	Chromosomal replication initiator protein DnaA	9.73e-05	9.47e-03	NA	NA
5. P	A8FP46	Chromosomal replication initiator protein DnaA	1.15e-04	1.28e-03	NA	NA
5. P	Q5UNY2	Putative cfxQ-like protein R730	NA	3.49e-02	NA	NA
5. P	Q8Z2N6	Chromosomal replication initiator protein DnaA	9.29e-05	1.45e-03	NA	NA
5. P	A9KWH8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.47e-03	2.99e-06	NA	NA
5. P	Q6N5L4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.59e-03	6.22e-07	NA	NA
5. P	Q03LN0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.46e-03	1.92e-07	NA	NA
5. P	C3PI25	ATP-dependent Clp protease ATP-binding subunit ClpX	3.85e-03	5.01e-05	NA	NA
5. P	Q9Z760	ATP-dependent Clp protease ATP-binding subunit ClpX	2.31e-03	2.14e-08	NA	NA
5. P	B7N2E7	Chromosomal replication initiator protein DnaA	1.46e-04	7.79e-04	NA	NA
5. P	A3CYH5	Chromosomal replication initiator protein DnaA	1.07e-04	6.87e-04	NA	NA
5. P	A8Z2J5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.46e-03	2.93e-07	NA	NA
5. P	Q7MAS4	ATP-dependent Clp protease ATP-binding subunit ClpX 1	1.08e-03	1.29e-07	NA	NA
5. P	Q8EU88	Chromosomal replication initiator protein DnaA	1.24e-04	6.06e-04	NA	NA
5. P	A1S4X6	ATP-dependent Clp protease ATP-binding subunit ClpX	3.69e-03	3.48e-06	NA	NA
5. P	Q8G3E7	Chromosomal replication initiator protein DnaA	1.75e-04	6.02e-03	NA	NA
5. P	A5GHS5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.88e-03	1.28e-06	NA	NA
5. P	B4U5G8	Chromosomal replication initiator protein DnaA	7.64e-05	2.30e-05	NA	NA
5. P	A1JL00	DnaA regulatory inactivator Hda	7.41e-04	3.74e-02	NA	NA
5. P	Q6G526	Chromosomal replication initiator protein DnaA	1.84e-04	1.03e-03	NA	NA
5. P	B7MQF4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.11e-03	7.45e-07	NA	NA
5. P	A4SH46	Chromosomal replication initiator protein DnaA	8.11e-05	4.20e-05	NA	NA
5. P	Q720F3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.67e-03	5.31e-07	NA	NA
5. P	Q5L9D0	Chromosomal replication initiator protein DnaA	1.43e-04	2.37e-05	NA	NA
5. P	B8D8H7	Chromosomal replication initiator protein DnaA	8.77e-05	4.06e-04	NA	NA
5. P	Q135W8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.91e-03	7.12e-07	NA	NA
5. P	Q73IZ0	Chromosomal replication initiator protein DnaA	4.39e-05	6.48e-03	NA	NA
5. P	Q31JS5	Chromosomal replication initiator protein DnaA	1.49e-04	2.00e-03	NA	NA
5. P	A5U5F3	ATP-dependent Clp protease ATP-binding subunit ClpX	1.80e-03	5.38e-06	NA	NA
5. P	Q7VH57	Chromosomal replication initiator protein DnaA	1.95e-04	3.83e-04	NA	NA
5. P	A4IJ84	Chromosomal replication initiator protein DnaA	1.10e-04	8.38e-06	NA	NA
5. P	B4RCN8	ATP-dependent Clp protease ATP-binding subunit ClpX	6.40e-03	6.33e-06	NA	NA
5. P	B7IS20	Chromosomal replication initiator protein DnaA	1.39e-04	3.75e-05	NA	NA
5. P	Q5X990	Chromosomal replication initiator protein DnaA	1.84e-04	9.84e-05	NA	NA
5. P	Q5KWJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.89e-03	1.39e-06	NA	NA
5. P	Q6F2A9	Chromosomal replication initiator protein DnaA	5.82e-05	2.91e-02	NA	NA
5. P	A2BZ43	ATP-dependent Clp protease ATP-binding subunit ClpX	8.84e-04	1.43e-05	NA	NA
5. P	C1A1N6	ATP-dependent Clp protease ATP-binding subunit ClpX	6.66e-03	5.27e-06	NA	NA
5. P	P0DA68	Chromosomal replication initiator protein DnaA	1.46e-04	9.42e-06	NA	NA
5. P	B2JJ97	Chromosomal replication initiator protein DnaA	3.56e-04	2.46e-03	NA	NA
5. P	B0BUW3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.19e-03	5.74e-07	NA	NA
5. P	B7MHX7	DnaA regulatory inactivator Hda	1.94e-04	5.20e-03	NA	NA
5. P	A1W5B7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.06e-03	2.80e-06	NA	NA
5. P	P63791	ATP-dependent Clp protease ATP-binding subunit ClpX	3.98e-04	1.89e-07	NA	NA
5. P	A9KPP1	Chromosomal replication initiator protein DnaA	1.20e-04	4.31e-04	NA	NA
5. P	A9KDS7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.81e-03	6.65e-07	NA	NA
5. P	Q7NDN9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.05e-03	6.96e-07	NA	NA
5. P	Q3AYH5	Chromosomal replication initiator protein DnaA	1.31e-04	1.05e-04	NA	NA
5. P	Q07VS2	Chromosomal replication initiator protein DnaA	1.23e-04	2.46e-03	NA	NA
5. P	A9B496	Chromosomal replication initiator protein DnaA	1.39e-04	1.88e-05	NA	NA
5. P	Q47XL9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.70e-03	4.63e-07	NA	NA
5. P	A2C7X1	Chromosomal replication initiator protein DnaA	2.33e-04	1.11e-03	NA	NA
5. P	A3PFL5	Chromosomal replication initiator protein DnaA	3.88e-05	2.88e-02	NA	NA
5. P	Q3YSQ2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.69e-03	1.32e-07	NA	NA
5. P	Q9PE40	ATP-dependent Clp protease ATP-binding subunit ClpX	2.41e-03	3.99e-07	NA	NA
5. P	Q5HJZ9	Chromosomal replication initiator protein DnaA	8.32e-05	6.74e-04	NA	NA
5. P	B5Y0U1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.06e-03	9.54e-07	NA	NA
5. P	Q8RHJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.92e-03	1.21e-06	NA	NA
5. P	C6E2S9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.82e-03	1.98e-05	NA	NA
5. P	Q6MH12	ATP-dependent Clp protease ATP-binding subunit ClpX	1.14e-03	3.21e-08	NA	NA
5. P	C4ZYX9	Chromosomal replication initiator protein DnaA	1.72e-04	7.79e-04	NA	NA
5. P	Q9MS99	Protein CfxQ homolog	2.08e-06	7.85e-06	NA	NA
5. P	Q28NI8	ATP-dependent Clp protease ATP-binding subunit ClpX	7.76e-03	1.07e-06	NA	NA
5. P	A5GFA1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.51e-04	9.52e-06	NA	NA
5. P	Q03UE4	Chromosomal replication initiator protein DnaA	4.52e-05	1.45e-04	NA	NA
5. P	O83521	ATP-dependent Clp protease ATP-binding subunit ClpX	4.29e-03	1.01e-06	NA	NA
5. P	B2IQY9	Chromosomal replication initiator protein DnaA	1.25e-04	2.16e-04	NA	NA
5. P	B4SWU2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.13e-03	7.53e-07	NA	NA
5. P	Q1QVW2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.61e-03	7.04e-07	NA	NA
5. P	O84277	Chromosomal replication initiator protein DnaA 2	7.42e-05	6.41e-05	NA	NA
5. P	A6LT28	ATP-dependent Clp protease ATP-binding subunit ClpX	1.95e-03	9.65e-07	NA	NA
5. P	A5CDP2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.63e-04	2.47e-07	NA	NA
5. P	Q5T2N8	ATPase family AAA domain-containing protein 3C	1.32e-06	1.02e-06	NA	NA
5. P	B7VB75	ATP-dependent Clp protease ATP-binding subunit ClpX	5.25e-03	1.54e-06	NA	NA
5. P	Q8FA34	Chromosomal replication initiator protein DnaA	1.52e-04	3.71e-05	NA	NA
5. P	Q59549	Chromosomal replication initiator protein DnaA	8.87e-05	2.70e-03	NA	NA
5. P	Q16DK6	Chromosomal replication initiator protein DnaA	3.75e-05	4.11e-02	NA	NA
5. P	A6TXF1	Chromosomal replication initiator protein DnaA	1.62e-04	3.54e-04	NA	NA
5. P	B1IDU3	Chromosomal replication initiator protein DnaA	1.10e-04	1.49e-03	NA	NA
5. P	Q8DG27	ATP-dependent Clp protease ATP-binding subunit ClpX	4.14e-03	9.42e-06	NA	NA
5. P	B0S907	Chromosomal replication initiator protein DnaA	5.44e-05	4.61e-05	NA	NA
5. P	B3PVY5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.97e-03	5.07e-07	NA	NA
5. P	B1IWG4	DnaA regulatory inactivator Hda	1.76e-04	5.20e-03	NA	NA
5. P	B4SLN2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.54e-03	1.74e-06	NA	NA
5. P	Q73FK5	Chromosomal replication initiator protein DnaA	1.44e-04	3.24e-05	NA	NA
5. P	C0Q7X4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.87e-03	7.53e-07	NA	NA
5. P	A2SFB6	ATP-dependent Clp protease ATP-binding subunit ClpX	6.07e-03	1.02e-06	NA	NA
5. P	Q2G2H5	Chromosomal replication initiator protein DnaA	1.75e-04	3.54e-04	NA	NA
5. P	B2K6V8	ATP-dependent Clp protease ATP-binding subunit ClpX	4.53e-03	4.09e-07	NA	NA
5. P	Q8ZRC0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.11e-03	7.53e-07	NA	NA
5. P	B9JVD6	ATP-dependent Clp protease ATP-binding subunit ClpX	5.95e-03	6.96e-07	NA	NA
5. P	Q6FG21	Chromosomal replication initiator protein DnaA	2.59e-04	4.88e-02	NA	NA
5. P	A0PU31	ATP-dependent Clp protease ATP-binding subunit ClpX	3.78e-03	6.33e-06	NA	NA
5. P	B0UW19	ATP-dependent Clp protease ATP-binding subunit ClpX	4.47e-03	5.81e-07	NA	NA
5. P	Q8YAW2	Chromosomal replication initiator protein DnaA	1.92e-04	3.61e-04	NA	NA
5. P	Q8YVG9	Chromosomal replication initiator protein DnaA	8.46e-05	2.43e-06	NA	NA
5. P	B2HNG2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.54e-03	6.26e-06	NA	NA
5. P	A4SXD7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.52e-03	5.61e-04	NA	NA
5. P	Q21Y66	ATP-dependent Clp protease ATP-binding subunit ClpX	6.25e-03	2.36e-07	NA	NA
5. P	A5INP2	Chromosomal replication initiator protein DnaA	4.52e-04	3.54e-04	NA	NA
5. P	A1AN84	ATP-dependent Clp protease ATP-binding subunit ClpX	2.08e-03	1.74e-06	NA	NA
5. P	Q5QY39	Chromosomal replication initiator protein DnaA	9.94e-05	1.08e-04	NA	NA
5. P	B8ZLT1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.45e-03	9.53e-08	NA	NA
5. P	A5GQ09	ATP-dependent Clp protease ATP-binding subunit ClpX	1.27e-03	1.04e-05	NA	NA
5. P	P33683	ATP-dependent Clp protease ATP-binding subunit ClpX	9.93e-04	2.92e-06	NA	NA
5. P	P27643	Stage V sporulation protein K	3.97e-05	5.81e-07	NA	NA
5. P	C0ZAG3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.12e-03	7.45e-07	NA	NA
5. P	B7HEA4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.41e-03	2.55e-07	NA	NA
5. P	Q04TR3	ATP-dependent Clp protease ATP-binding subunit ClpX	1.78e-03	7.70e-07	NA	NA
5. P	C5CAX2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.80e-03	2.74e-04	NA	NA
5. P	Q48KY9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.24e-03	8.24e-07	NA	NA
5. P	B7IIY3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.56e-03	2.55e-07	NA	NA
5. P	B4EU54	ATP-dependent Clp protease ATP-binding subunit ClpX	4.51e-03	1.86e-06	NA	NA
5. P	Q3YWB2	Chromosomal replication initiator protein DnaA	1.70e-04	7.79e-04	NA	NA
5. P	P63795	ATP-dependent Clp protease ATP-binding subunit ClpX	3.26e-03	8.92e-07	NA	NA
5. P	A1WWE0	Chromosomal replication initiator protein DnaA	1.48e-04	1.96e-05	NA	NA
5. P	P24116	Chromosomal replication initiator protein DnaA	6.79e-05	1.33e-04	NA	NA
5. P	B2UX12	ATP-dependent Clp protease ATP-binding subunit ClpX	1.56e-03	1.12e-06	NA	NA
5. P	P49996	Chromosomal replication initiator protein DnaA	2.05e-04	1.15e-03	NA	NA
5. P	A6VW21	ATP-dependent Clp protease ATP-binding subunit ClpX	2.46e-03	4.09e-07	NA	NA
5. P	A2BQ46	Chromosomal replication initiator protein DnaA	2.07e-04	1.74e-03	NA	NA
5. P	B2IGP2	ATP-dependent Clp protease ATP-binding subunit ClpX	6.61e-03	1.23e-06	NA	NA
5. P	B8FA63	ATP-dependent Clp protease ATP-binding subunit ClpX	3.76e-03	9.64e-08	NA	NA
5. P	A1VRH7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.59e-03	1.29e-06	NA	NA
5. P	P59567	Chromosomal replication initiator protein DnaA	8.40e-05	1.73e-04	NA	NA
5. P	A4Y1A4	Chromosomal replication initiator protein DnaA	9.25e-05	1.91e-04	NA	NA
5. P	B7N8Z2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.07e-03	7.45e-07	NA	NA
5. P	B1XN45	ATP-dependent Clp protease ATP-binding subunit ClpX	1.53e-03	2.32e-06	NA	NA
5. P	Q633X2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.74e-03	1.47e-07	NA	NA
5. P	Q8NQD8	AAA ATPase forming ring-shaped complexes	8.09e-06	4.35e-04	NA	NA
5. P	A5GJL3	Chromosomal replication initiator protein DnaA	6.47e-05	2.64e-02	NA	NA
5. P	Q13F98	Chromosomal replication initiator protein DnaA	3.08e-04	3.34e-03	NA	NA
5. P	Q5FHH8	Chromosomal replication initiator protein DnaA	1.71e-04	1.21e-03	NA	NA
5. P	A8AD95	DnaA regulatory inactivator Hda	5.69e-05	4.44e-02	NA	NA
5. P	Q325G3	ATP-dependent Clp protease ATP-binding subunit ClpX	1.68e-03	2.77e-07	NA	NA
5. P	A7ML17	DnaA regulatory inactivator Hda	2.60e-04	2.79e-02	NA	NA
5. P	B2FUW1	Chromosomal replication initiator protein DnaA	1.37e-04	1.15e-05	NA	NA
5. P	A5I6W0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.12e-03	5.62e-07	NA	NA
5. P	Q3K425	Chromosomal replication initiator protein DnaA	1.30e-04	4.91e-05	NA	NA
5. P	A1B1H7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.42e-03	8.72e-07	NA	NA
5. P	Q5PBC9	ATP-dependent Clp protease ATP-binding subunit ClpX	1.60e-03	5.43e-07	NA	NA
5. P	C3KXQ7	Chromosomal replication initiator protein DnaA	1.11e-04	1.01e-03	NA	NA
5. P	Q6MC93	Chromosomal replication initiator protein DnaA 1	1.48e-04	1.17e-04	NA	NA
5. P	B4S620	ATP-dependent Clp protease ATP-binding subunit ClpX	3.59e-03	3.30e-06	NA	NA
5. P	A9HRV3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.60e-03	4.96e-07	NA	NA
5. P	Q01357	ATP-dependent protease ATP-binding subunit-like protein	9.59e-05	7.35e-03	NA	NA
5. P	Q0BEF7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.58e-03	4.18e-07	NA	NA
5. P	B7KNT1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.06e-03	1.84e-06	NA	NA
5. P	Q31UV5	Chromosomal replication initiator protein DnaA	1.43e-04	1.25e-03	NA	NA
5. P	Q7MX10	ATP-dependent Clp protease ATP-binding subunit ClpX	7.39e-04	2.22e-08	NA	NA
5. P	Q1JEA5	Chromosomal replication initiator protein DnaA	5.23e-05	9.42e-06	NA	NA
5. P	A8YUS4	ATP-dependent Clp protease ATP-binding subunit ClpX	1.72e-03	3.26e-09	NA	NA
5. P	B1MMV6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.75e-03	4.62e-06	NA	NA
5. P	Q7UZK6	ATP-dependent Clp protease ATP-binding subunit ClpX	9.70e-04	1.80e-05	NA	NA
5. P	Q2P9M1	Chromosomal replication initiator protein DnaA	1.46e-04	2.79e-04	NA	NA
5. P	A5EKA7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.72e-03	7.62e-07	NA	NA
5. P	A8GP75	Chromosomal replication initiator protein DnaA	9.62e-05	7.76e-03	NA	NA
5. P	P63793	ATP-dependent Clp protease ATP-binding subunit ClpX	2.70e-03	8.92e-07	NA	NA
5. P	A4TMP0	DnaA regulatory inactivator Hda	3.24e-04	2.03e-02	NA	NA
5. P	A9KSX1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.45e-03	2.08e-06	NA	NA
5. P	A1JT80	Chromosomal replication initiator protein DnaA	8.56e-05	1.17e-03	NA	NA
5. P	A6WH85	Chromosomal replication initiator protein DnaA	9.96e-05	6.87e-04	NA	NA
5. P	Q5P4P0	Chromosomal replication initiator protein DnaA	2.53e-04	4.55e-02	NA	NA
5. P	Q57SB4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	7.53e-07	NA	NA
5. P	A1TM61	ATP-dependent Clp protease ATP-binding subunit ClpX	4.00e-03	3.77e-07	NA	NA
5. P	Q02441	Denitrification regulatory protein NirQ	1.01e-03	2.80e-03	NA	NA
5. P	Q8DLI1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.73e-03	1.96e-05	NA	NA
5. P	C1ETR8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.45e-03	1.47e-07	NA	NA
5. P	A8EY77	Chromosomal replication initiator protein DnaA	9.87e-05	1.01e-02	NA	NA
5. P	Q052U5	ATP-dependent Clp protease ATP-binding subunit ClpX	9.69e-03	7.70e-07	NA	NA
5. P	Q30UP9	Chromosomal replication initiator protein DnaA	5.92e-05	5.50e-05	NA	NA
5. P	P0DA36	ATP-dependent Clp protease ATP-binding subunit ClpX	3.56e-03	8.92e-07	NA	NA
5. P	Q2SQZ9	Chromosomal replication initiator protein DnaA	2.37e-04	6.35e-05	NA	NA
5. P	C3JYJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.57e-03	5.31e-07	NA	NA
5. P	A8GVN1	Chromosomal replication initiator protein DnaA	1.20e-04	1.80e-02	NA	NA
5. P	B0TFI7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.70e-03	3.25e-07	NA	NA
5. P	Q83N52	Chromosomal replication initiator protein DnaA	1.50e-04	2.83e-03	NA	NA
5. P	Q2FG62	ATP-dependent Clp protease ATP-binding subunit ClpX	1.49e-03	2.93e-07	NA	NA
5. P	Q1GPH4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.37e-03	1.32e-06	NA	NA
5. P	B1X0X6	Chromosomal replication initiator protein DnaA	2.23e-04	1.61e-04	NA	NA
5. P	A5V3U4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.60e-03	6.54e-06	NA	NA
5. P	A7FG40	DnaA regulatory inactivator Hda	2.02e-04	4.71e-02	NA	NA
5. P	B7L846	Chromosomal replication initiator protein DnaA	1.38e-04	7.79e-04	NA	NA
5. P	P57981	ATP-dependent Clp protease ATP-binding subunit ClpX	4.15e-03	5.93e-06	NA	NA
5. P	A5F6Z1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.81e-03	5.94e-07	NA	NA
5. P	Q7NUZ0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.26e-03	3.93e-06	NA	NA
5. P	B8CH71	Chromosomal replication initiator protein DnaA	1.14e-04	1.55e-02	NA	NA
5. P	A0LSV2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.38e-04	3.48e-07	NA	NA
5. P	Q7W8X1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.07e-03	1.28e-06	NA	NA
5. P	Q1GC43	Chromosomal replication initiator protein DnaA	1.68e-04	3.54e-04	NA	NA
5. P	P0A3A3	Chromosomal replication initiator protein DnaA	8.77e-05	4.06e-04	NA	NA
5. P	Q0TV64	Chromosomal replication initiator protein DnaA	2.43e-04	1.80e-04	NA	NA
5. P	B2SUW3	Chromosomal replication initiator protein DnaA	1.44e-04	2.79e-04	NA	NA
5. P	Q9CGE6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.82e-03	4.58e-07	NA	NA
5. P	Q9CLQ4	Chromosomal replication initiator protein DnaA	1.56e-04	5.09e-04	NA	NA
5. P	B9DXS7	Chromosomal replication initiator protein DnaA	7.96e-05	2.71e-04	NA	NA
5. P	B1LW29	ATP-dependent Clp protease ATP-binding subunit ClpX	4.34e-03	2.06e-06	NA	NA
5. P	Q9I2U0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.87e-03	1.54e-06	NA	NA
5. P	B9E684	ATP-dependent Clp protease ATP-binding subunit ClpX	2.90e-04	1.89e-07	NA	NA
5. P	C3PLG9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.78e-03	3.36e-07	NA	NA
5. P	Q60BE7	ATP-dependent Clp protease ATP-binding subunit ClpX 2	3.84e-03	2.68e-07	NA	NA
5. P	Q6G177	ATP-dependent Clp protease ATP-binding subunit ClpX	5.87e-03	1.03e-06	NA	NA
5. P	Q07NN5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.80e-03	7.88e-07	NA	NA
5. P	Q8ZCC1	DnaA regulatory inactivator Hda	1.80e-04	4.71e-02	NA	NA
5. P	Q66DT3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.70e-03	6.15e-07	NA	NA
5. P	Q83G50	ATP-dependent Clp protease ATP-binding subunit ClpX	9.14e-04	1.95e-06	NA	NA
5. P	Q1IWD8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.61e-04	1.88e-06	NA	NA
5. P	Q2FXQ7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.06e-03	2.93e-07	NA	NA
5. P	Q8DDI9	Chromosomal replication initiator protein DnaA	1.74e-04	9.09e-04	NA	NA
5. P	B9M7S1	Chromosomal replication initiator protein DnaA	7.27e-05	1.52e-04	NA	NA
5. P	A0KYL8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.67e-03	5.81e-06	NA	NA
5. P	B0K0W8	Chromosomal replication initiator protein DnaA	8.78e-05	1.85e-07	NA	NA
5. P	Q6MUM7	Chromosomal replication initiator protein DnaA	1.02e-04	3.72e-04	NA	NA
5. P	Q0IE20	ATP-dependent Clp protease ATP-binding subunit ClpX	1.13e-03	2.89e-06	NA	NA
5. P	Q2J497	Chromosomal replication initiator protein DnaA	3.13e-05	7.43e-04	NA	NA
5. P	B7GUP3	AAA ATPase forming ring-shaped complexes	1.63e-05	1.22e-03	NA	NA
5. P	B5EQ29	ATP-dependent Clp protease ATP-binding subunit ClpX	4.14e-03	2.10e-07	NA	NA
5. P	Q8UIH1	Chromosomal replication initiator protein DnaA	5.84e-05	1.02e-02	NA	NA
5. P	P49995	Chromosomal replication initiator protein DnaA	9.32e-05	3.79e-04	NA	NA
5. P	B7NF19	Chromosomal replication initiator protein DnaA	1.63e-04	7.79e-04	NA	NA
5. P	Q81JD5	Chromosomal replication initiator protein DnaA	1.39e-04	3.34e-05	NA	NA
5. P	B0TLU8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.75e-03	1.89e-07	NA	NA
5. P	Q5L4W6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.94e-03	2.53e-07	NA	NA
5. P	B7MD97	ATP-dependent Clp protease ATP-binding subunit ClpX	4.67e-03	7.45e-07	NA	NA
5. P	B5EYX2	Chromosomal replication initiator protein DnaA	9.24e-05	1.82e-03	NA	NA
5. P	A6U2E2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.47e-03	2.93e-07	NA	NA
5. P	Q13Z14	ATP-dependent Clp protease ATP-binding subunit ClpX	6.15e-03	1.85e-07	NA	NA
5. P	O08397	Chromosomal replication initiator protein DnaA	9.15e-05	1.88e-04	NA	NA
5. P	Q1QS94	Chromosomal replication initiator protein DnaA	3.97e-05	1.57e-03	NA	NA
5. P	Q2YPX2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.62e-03	6.73e-07	NA	NA
5. P	Q8FN57	ATP-dependent Clp protease ATP-binding subunit ClpX	4.20e-03	1.22e-05	NA	NA
5. P	Q5L8L7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.24e-04	1.46e-06	NA	NA
5. P	B5XL03	ATP-dependent Clp protease ATP-binding subunit ClpX	3.31e-03	1.32e-06	NA	NA
5. P	Q0ACS7	Chromosomal replication initiator protein DnaA	1.11e-04	1.71e-05	NA	NA
5. P	Q8G3G6	AAA ATPase forming ring-shaped complexes	4.44e-05	2.07e-04	NA	NA
5. P	A5N457	Chromosomal replication initiator protein DnaA	2.31e-04	2.71e-04	NA	NA
5. P	Q12TC8	Chromosomal replication initiator protein DnaA	8.89e-05	2.50e-04	NA	NA
5. P	Q8Z9U7	Chromosomal replication initiator protein DnaA	1.44e-04	2.38e-04	NA	NA
5. P	B9E8Z7	Chromosomal replication initiator protein DnaA	2.16e-04	1.42e-04	NA	NA
5. P	Q51896	Chromosomal replication initiator protein DnaA	1.33e-04	3.60e-05	NA	NA
5. P	B7J203	Chromosomal replication initiator protein DnaA	9.87e-05	6.48e-05	NA	NA
5. P	A5W634	ATP-dependent Clp protease ATP-binding subunit ClpX	3.77e-03	5.88e-07	NA	NA
5. P	A7Z7B2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.74e-03	1.92e-07	NA	NA
5. P	A1KUJ4	ATP-dependent Clp protease ATP-binding subunit ClpX	5.51e-03	5.01e-07	NA	NA
5. P	B2JGL6	ATP-dependent Clp protease ATP-binding subunit ClpX	6.04e-03	2.93e-07	NA	NA
5. P	Q87TQ7	Chromosomal replication initiator protein DnaA	2.79e-04	1.27e-03	NA	NA
5. P	Q1BH84	ATP-dependent Clp protease ATP-binding subunit ClpX	5.25e-03	4.37e-07	NA	NA
5. P	Q74C83	ATP-dependent Clp protease ATP-binding subunit ClpX	3.60e-03	3.97e-06	NA	NA
5. P	Q83DJ1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.22e-03	9.98e-07	NA	NA
5. P	C1AES4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.41e-03	5.44e-06	NA	NA
5. P	Q1RF97	ATP-dependent Clp protease ATP-binding subunit ClpX	4.75e-03	7.45e-07	NA	NA
5. P	Q1CCJ8	Chromosomal replication initiator protein DnaA	1.58e-04	2.38e-04	NA	NA
5. P	Q6AHN6	Chromosomal replication initiator protein DnaA	2.38e-04	3.50e-04	NA	NA
5. P	P10576	DNA-binding transcriptional regulator NtrC	4.73e-04	4.48e-02	NA	NA
5. P	A7FYI1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.72e-04	5.62e-07	NA	NA
5. P	Q118P6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.17e-03	6.20e-06	NA	NA
5. P	A7Z0C3	Chromosomal replication initiator protein DnaA	1.34e-04	1.61e-04	NA	NA
5. P	B4RLV8	Holliday junction ATP-dependent DNA helicase RuvB	4.34e-06	4.75e-03	NA	NA
5. P	B7JJB7	Chromosomal replication initiator protein DnaA	1.94e-04	3.17e-05	NA	NA
5. P	Q02Z22	ATP-dependent Clp protease ATP-binding subunit ClpX	4.77e-03	3.21e-07	NA	NA
5. P	Q0BSJ8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.53e-03	1.26e-06	NA	NA
5. P	Q02KU5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.97e-03	1.54e-06	NA	NA
5. P	Q73I60	ATP-dependent Clp protease ATP-binding subunit ClpX	3.05e-03	2.28e-07	NA	NA
5. P	O25926	ATP-dependent Clp protease ATP-binding subunit ClpX	3.19e-03	3.52e-07	NA	NA
5. P	Q81LB9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.52e-03	1.47e-07	NA	NA
5. P	Q2RL30	ATP-dependent Clp protease ATP-binding subunit ClpX	3.50e-03	5.68e-07	NA	NA
5. P	A1SK07	Proteasome-associated ATPase	3.75e-05	9.90e-03	NA	NA
5. P	C4LJV6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.70e-03	2.20e-06	NA	NA
5. P	B6J0V9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.95e-03	9.98e-07	NA	NA
5. P	B9M0Y2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.26e-03	1.67e-05	NA	NA
5. P	P0A6H4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.02e-03	7.45e-07	NA	NA
5. P	Q3MHA9	Chromosomal replication initiator protein DnaA	7.79e-05	7.94e-06	NA	NA
5. P	A9VM90	Chromosomal replication initiator protein DnaA	9.47e-05	6.82e-05	NA	NA
5. P	Q2SWQ5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.54e-03	6.08e-07	NA	NA
5. P	B1L1D6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.36e-03	1.17e-06	NA	NA
5. P	Q382V8	ATP-dependent protease ATPase subunit HslU2	7.56e-03	2.74e-02	NA	NA
5. P	P68865	Chromosomal replication initiator protein DnaA	1.88e-04	3.54e-04	NA	NA
5. P	Q7V993	ATP-dependent Clp protease ATP-binding subunit ClpX	2.20e-03	2.08e-06	NA	NA
5. P	Q5N1P7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.18e-03	2.66e-05	NA	NA
5. P	O83047	Chromosomal replication initiator protein DnaA	1.37e-04	3.18e-04	NA	NA
5. P	A1USA8	ATP-dependent Clp protease ATP-binding subunit ClpX	6.39e-03	5.13e-07	NA	NA
5. P	B5FBZ9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.86e-03	1.97e-06	NA	NA
5. P	Q5SKM7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.61e-04	3.10e-08	NA	NA
5. P	B7KBH7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.22e-03	1.07e-05	NA	NA
5. P	Q8VVE4	Putative chaperone BssE	1.82e-04	4.04e-02	NA	NA
5. P	Q7V9L5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.92e-03	8.93e-06	NA	NA
5. P	Q65RF7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.67e-03	2.65e-06	NA	NA
5. P	B6J287	Chromosomal replication initiator protein DnaA	1.84e-04	8.11e-06	NA	NA
5. P	Q03W09	ATP-dependent Clp protease ATP-binding subunit ClpX	1.91e-03	1.96e-07	NA	NA
5. P	B7L675	ATP-dependent Clp protease ATP-binding subunit ClpX	4.06e-03	7.45e-07	NA	NA
5. P	B0KAG0	Chromosomal replication initiator protein DnaA	8.97e-05	1.85e-07	NA	NA
5. P	B9L735	Chromosomal replication initiator protein DnaA	1.92e-04	1.18e-03	NA	NA
5. P	Q31XZ6	DnaA regulatory inactivator Hda	1.81e-04	5.20e-03	NA	NA
5. P	B0KBA3	ATP-dependent Clp protease ATP-binding subunit ClpX	1.91e-03	1.71e-07	NA	NA
5. P	O84711	ATP-dependent Clp protease ATP-binding subunit ClpX	2.44e-03	3.64e-07	NA	NA
5. P	C0M9R7	ATP-dependent Clp protease ATP-binding subunit ClpX	3.45e-03	2.41e-07	NA	NA
5. P	Q7U605	Chromosomal replication initiator protein DnaA	1.18e-04	6.42e-03	NA	NA
5. P	B4EY85	DnaA regulatory inactivator Hda	2.70e-04	1.75e-02	NA	NA
5. P	B4T9E4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.06e-03	7.53e-07	NA	NA
5. P	Q3SMV0	Chromosomal replication initiator protein DnaA	1.43e-04	8.10e-04	NA	NA
5. P	Q4ZVM6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.00e-03	6.58e-07	NA	NA
5. P	A8GVR9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.68e-03	3.40e-07	NA	NA
5. P	B1IYP2	Chromosomal replication initiator protein DnaA	1.59e-04	6.24e-04	NA	NA
5. P	B8FFL8	Chromosomal replication initiator protein DnaA	7.38e-05	1.32e-04	NA	NA
5. P	Q24SJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.22e-03	1.40e-07	NA	NA
5. P	A8F2I3	ATP-dependent Clp protease ATP-binding subunit ClpX	5.29e-03	2.90e-07	NA	NA
5. P	P35891	Chromosomal replication initiator protein DnaA	9.25e-05	1.82e-03	NA	NA
5. P	B8DHN7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.47e-03	5.31e-07	NA	NA
5. P	A8GSY1	Chromosomal replication initiator protein DnaA	7.86e-05	9.30e-03	NA	NA
5. P	Q1C5P5	DnaA regulatory inactivator Hda	2.46e-04	2.03e-02	NA	NA
5. P	B2THB4	Chromosomal replication initiator protein DnaA	2.12e-04	1.03e-03	NA	NA
5. P	A8M1K7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.96e-04	1.46e-06	NA	NA
5. P	Q72L14	ATP-dependent Clp protease ATP-binding subunit ClpX	6.83e-04	2.38e-08	NA	NA
5. P	Q8P302	Holliday junction ATP-dependent DNA helicase RuvB	1.54e-05	4.84e-02	NA	NA
5. P	Q9RSZ6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.51e-04	7.20e-07	NA	NA
5. P	C6DB56	ATP-dependent Clp protease ATP-binding subunit ClpX	4.26e-03	5.81e-07	NA	NA
5. P	Q0I0Y7	Chromosomal replication initiator protein DnaA	9.28e-05	7.18e-05	NA	NA
5. P	B8D6T1	Chromosomal replication initiator protein DnaA	1.92e-04	4.06e-04	NA	NA
5. P	Q02239	Gas vesicle protein GvpN	4.33e-04	5.70e-03	NA	NA
5. P	A8ZXB8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.28e-03	1.55e-07	NA	NA
5. P	Q6LNW1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.71e-03	4.42e-07	NA	NA
5. P	Q9ZJL8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.78e-03	4.08e-08	NA	NA
5. P	A8H613	ATP-dependent Clp protease ATP-binding subunit ClpX	4.56e-03	2.74e-07	NA	NA
5. P	A4YJ98	Chromosomal replication initiator protein DnaA	3.67e-05	2.26e-03	NA	NA
5. P	Q0SGZ3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.20e-03	2.22e-06	NA	NA
5. P	Q3A3X6	ATP-dependent Clp protease ATP-binding subunit ClpX	3.06e-03	3.90e-07	NA	NA
5. P	B3QWK0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.32e-03	9.31e-08	NA	NA
5. P	Q9SCC7	Protein cbbX homolog, chloroplastic	2.11e-04	7.43e-04	NA	NA
5. P	A4TGL5	Chromosomal replication initiator protein DnaA	1.24e-04	2.38e-04	NA	NA
5. P	B7H092	ATP-dependent Clp protease ATP-binding subunit ClpX	5.19e-03	3.11e-07	NA	NA
5. P	Q1GXK1	Chromosomal replication initiator protein DnaA	2.08e-04	3.17e-02	NA	NA
5. P	P26239	Magnesium-chelatase 38 kDa subunit	2.14e-03	3.97e-02	NA	NA
5. P	A3NAI4	ATP-dependent Clp protease ATP-binding subunit ClpX	5.77e-03	5.19e-07	NA	NA
5. P	Q81W35	Chromosomal replication initiator protein DnaA	1.05e-04	3.17e-05	NA	NA
5. P	Q6AK60	ATP-dependent Clp protease ATP-binding subunit ClpX	3.79e-03	9.76e-07	NA	NA
5. P	A7FLC3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.64e-03	4.09e-07	NA	NA
5. P	B6J8S3	Chromosomal replication initiator protein DnaA	1.97e-04	8.11e-06	NA	NA
5. P	Q2FKQ5	Chromosomal replication initiator protein DnaA	8.46e-05	3.54e-04	NA	NA
5. P	Q9RCA2	Chromosomal replication initiator protein DnaA	1.23e-04	8.98e-05	NA	NA
5. P	A4QE83	AAA ATPase forming ring-shaped complexes	7.89e-06	4.35e-04	NA	NA
5. P	Q9PIM0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.10e-03	1.30e-08	NA	NA
5. P	B3CQC6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.11e-04	1.43e-07	NA	NA
5. P	B1J010	ATP-dependent Clp protease ATP-binding subunit ClpX	4.02e-03	7.45e-07	NA	NA
5. P	A3QFX5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.78e-03	1.56e-06	NA	NA
5. P	Q03F27	ATP-dependent Clp protease ATP-binding subunit ClpX	2.64e-03	1.63e-07	NA	NA
5. P	Q5FFG6	ATP-dependent Clp protease ATP-binding subunit ClpX	7.40e-04	5.19e-07	NA	NA
5. P	Q89W63	Chromosomal replication initiator protein DnaA	4.46e-05	5.55e-03	NA	NA
5. P	Q6FEP7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.88e-03	1.32e-07	NA	NA
5. P	Q0I4F0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.14e-03	4.47e-07	NA	NA
5. P	P69933	DnaA regulatory inactivator Hda	3.83e-05	5.20e-03	NA	NA
5. P	A8MIS7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.37e-03	1.21e-06	NA	NA
5. P	B8D805	ATP-dependent Clp protease ATP-binding subunit ClpX	3.06e-03	6.81e-07	NA	NA
5. P	Q9KQS7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.57e-03	5.94e-07	NA	NA
5. P	Q92FV2	Chromosomal replication initiator protein DnaA	1.28e-04	2.93e-04	NA	NA
5. P	Q9RJ58	Proteasome-associated ATPase	4.73e-05	2.20e-02	NA	NA
5. P	B2S0D9	Chromosomal replication initiator protein DnaA	6.29e-05	4.25e-05	NA	NA
5. P	A6T5I1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.87e-03	7.28e-07	NA	NA
5. P	B1XKQ0	Chromosomal replication initiator protein DnaA	1.58e-04	1.75e-04	NA	NA
5. P	A9ISA8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.86e-03	1.07e-06	NA	NA
5. P	Q817Q2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.42e-03	2.55e-07	NA	NA
5. P	B7I5E4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.15e-03	3.11e-07	NA	NA
5. P	Q64NW3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.04e-04	1.46e-06	NA	NA
5. P	A0Q3U6	Chromosomal replication initiator protein DnaA	6.49e-05	9.65e-05	NA	NA
5. P	Q72SG5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.09e-02	9.76e-07	NA	NA
5. P	Q87E50	ATP-dependent Clp protease ATP-binding subunit ClpX	2.18e-03	8.72e-07	NA	NA
5. P	A2BVM7	Chromosomal replication initiator protein DnaA	7.25e-05	4.35e-04	NA	NA
5. P	Q03N26	Chromosomal replication initiator protein DnaA	1.15e-04	3.24e-05	NA	NA
5. P	O66659	Chromosomal replication initiator protein DnaA	3.98e-05	1.23e-03	NA	NA
5. P	B0V4T7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.74e-03	3.11e-07	NA	NA
5. P	Q9F316	ATP-dependent Clp protease ATP-binding subunit ClpX	2.24e-03	4.57e-06	NA	NA
5. P	B4U6S1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.86e-03	3.03e-07	NA	NA
5. P	A4J0F0	Chromosomal replication initiator protein DnaA	6.02e-05	7.94e-04	NA	NA
5. P	Q9PHE3	Chromosomal replication initiator protein DnaA	1.34e-04	4.94e-04	NA	NA
5. P	A4IRH2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.14e-03	1.25e-06	NA	NA
5. P	Q1Q8J1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.30e-03	4.03e-05	NA	NA
5. P	Q9ZDK8	ATP-dependent protease ATPase subunit HslU	2.92e-02	1.12e-02	NA	NA
5. P	Q6NFU7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.80e-03	2.35e-06	NA	NA
5. P	Q5XCM0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.46e-03	8.24e-07	NA	NA
5. P	Q1CL64	ATP-dependent Clp protease ATP-binding subunit ClpX	4.08e-03	4.09e-07	NA	NA
5. P	A2SBM4	Chromosomal replication initiator protein DnaA	2.02e-04	4.66e-05	NA	NA
5. P	B5YGT9	Chromosomal replication initiator protein DnaA	1.72e-04	2.30e-03	NA	NA
5. P	Q2GFT9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.27e-03	6.24e-08	NA	NA
5. P	B5Z3U5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.50e-03	7.45e-07	NA	NA
5. P	Q6HD54	ATP-dependent Clp protease ATP-binding subunit ClpX	2.46e-03	1.47e-07	NA	NA
5. P	B5Z9E3	Chromosomal replication initiator protein DnaA	4.68e-04	4.48e-04	NA	NA
5. P	Q3K0K0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.11e-03	1.25e-07	NA	NA
5. P	Q7WDJ9	Chromosomal replication initiator protein DnaA	6.68e-05	2.69e-02	NA	NA
5. P	Q8XBZ3	Chromosomal replication initiator protein DnaA	2.01e-04	7.43e-04	NA	NA
5. P	B0TLA4	Chromosomal replication initiator protein DnaA	8.90e-05	2.11e-04	NA	NA
5. P	B6I568	DnaA regulatory inactivator Hda	1.88e-04	5.20e-03	NA	NA
5. P	A1BE59	ATP-dependent Clp protease ATP-binding subunit ClpX	2.84e-03	3.45e-06	NA	NA
5. P	A7ZAW7	Chromosomal replication initiator protein DnaA	5.69e-05	6.96e-05	NA	NA
5. P	B5EI28	ATP-dependent Clp protease ATP-binding subunit ClpX	3.32e-03	1.98e-05	NA	NA
5. P	C3KU76	ATP-dependent Clp protease ATP-binding subunit ClpX	4.17e-04	5.62e-07	NA	NA
5. P	B5QUQ0	Chromosomal replication initiator protein DnaA	8.33e-05	1.45e-03	NA	NA
5. P	P40118	Protein CbxX, chromosomal	2.93e-06	1.55e-03	NA	NA
5. P	Q8G0I5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.62e-03	1.95e-06	NA	NA
5. P	A6VR65	Chromosomal replication initiator protein DnaA	2.78e-04	6.13e-03	NA	NA
5. P	Q7VP79	ATP-dependent Clp protease ATP-binding subunit ClpX	1.06e-03	3.58e-08	NA	NA
5. P	A3CMV1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.84e-03	1.85e-07	NA	NA
5. P	A9WUW1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.14e-03	2.16e-04	NA	NA
5. P	C1DFU2	Chromosomal replication initiator protein DnaA	4.96e-04	2.67e-03	NA	NA
5. P	Q2J9Q0	Proteasome-associated ATPase	5.95e-05	4.71e-02	NA	NA
5. P	Q6G3Z2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.88e-03	5.37e-07	NA	NA
5. P	A0LE53	Chromosomal replication initiator protein DnaA	2.85e-05	3.77e-07	NA	NA
5. P	A4XTZ6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.40e-03	2.27e-06	NA	NA
5. P	B3QJZ9	Chromosomal replication initiator protein DnaA	1.32e-04	1.38e-03	NA	NA
5. P	A1SME0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.96e-03	4.78e-06	NA	NA
5. P	B5FN10	Chromosomal replication initiator protein DnaA	8.21e-05	2.18e-03	NA	NA
5. P	A4Y5I3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.59e-03	2.51e-06	NA	NA
5. P	Q3SI99	ATP-dependent Clp protease ATP-binding subunit ClpX	3.73e-03	4.90e-07	NA	NA
5. P	A9N900	Chromosomal replication initiator protein DnaA	3.97e-05	8.11e-06	NA	NA
5. P	B2GGB7	ATP-dependent Clp protease ATP-binding subunit ClpX	7.91e-04	6.68e-05	NA	NA
5. P	B0K532	ATP-dependent Clp protease ATP-binding subunit ClpX	9.64e-04	1.73e-07	NA	NA
5. P	B7HPR7	Chromosomal replication initiator protein DnaA	1.44e-04	3.24e-05	NA	NA
5. P	A9BUG8	Holliday junction ATP-dependent DNA helicase RuvB	3.10e-05	3.20e-02	NA	NA
5. P	A0AEI7	Chromosomal replication initiator protein DnaA	1.34e-04	2.93e-04	NA	NA
5. P	Q2JDQ7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.24e-03	5.88e-07	NA	NA
5. P	B8E5E8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.68e-03	2.99e-06	NA	NA
5. P	P46798	Chromosomal replication initiator protein DnaA	2.24e-04	7.83e-03	NA	NA
5. P	Q04540	Protein CbxX, plasmid	1.26e-04	1.08e-03	NA	NA
5. P	Q0VT30	Chromosomal replication initiator protein DnaA	1.55e-04	1.00e-03	NA	NA
5. P	A8G7G2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.88e-03	2.89e-05	NA	NA
5. P	A1JNN1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.07e-03	9.43e-07	NA	NA
5. P	Q1GN68	Chromosomal replication initiator protein DnaA	1.17e-04	8.98e-05	NA	NA
5. P	B7UGN4	DnaA regulatory inactivator Hda	1.96e-04	5.20e-03	NA	NA
5. P	Q6G8Q1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.77e-03	2.68e-07	NA	NA
5. P	Q8EG18	ATP-dependent Clp protease ATP-binding subunit ClpX	2.92e-03	4.57e-06	NA	NA
5. P	A6VK86	Chromosomal replication initiator protein DnaA	1.25e-04	1.91e-04	NA	NA
5. P	Q9KVX6	Chromosomal replication initiator protein DnaA	1.72e-04	3.67e-03	NA	NA
5. P	P0A529	ATP-dependent Clp protease ATP-binding subunit ClpX	3.78e-03	5.38e-06	NA	NA
5. P	Q87R79	ATP-dependent Clp protease ATP-binding subunit ClpX	4.30e-03	3.84e-06	NA	NA
5. P	Q8DRQ4	Chromosomal replication initiator protein DnaA	1.17e-04	2.16e-04	NA	NA
5. P	B2A2Y6	Chromosomal replication initiator protein DnaA	2.26e-04	2.66e-04	NA	NA
5. P	B0SK31	Chromosomal replication initiator protein DnaA	7.85e-05	4.61e-05	NA	NA
5. P	Q8A128	ATP-dependent Clp protease ATP-binding subunit ClpX	1.06e-03	3.00e-07	NA	NA
5. P	B7GH25	ATP-dependent Clp protease ATP-binding subunit ClpX	2.77e-03	1.14e-07	NA	NA
5. P	Q8E4L8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.26e-03	1.25e-07	NA	NA
5. P	A5VHF3	Chromosomal replication initiator protein DnaA	8.18e-05	1.09e-04	NA	NA
5. P	Q9MUT3	Magnesium-chelatase subunit ChlI	4.29e-03	4.18e-02	NA	NA
5. P	B2A159	ATP-dependent Clp protease ATP-binding subunit ClpX	2.69e-03	3.49e-08	NA	NA
5. P	A3MKJ7	ATP-dependent Clp protease ATP-binding subunit ClpX	6.38e-03	7.88e-07	NA	NA
5. P	P0A6H2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.00e-03	7.45e-07	NA	NA
5. P	B1AHY7	Chromosomal replication initiator protein DnaA	1.16e-04	7.25e-05	NA	NA
5. P	Q51416	ATP-dependent protease ATP-binding subunit-like protein AmiB	4.28e-03	4.73e-06	NA	NA
5. P	C0MEW5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.68e-03	2.15e-07	NA	NA
5. P	Q1RIB7	ATP-dependent protease ATPase subunit HslU	3.80e-02	4.52e-02	NA	NA
5. P	A2C5C2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.94e-03	4.99e-06	NA	NA
5. P	Q5M5B0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.92e-03	2.15e-07	NA	NA
5. P	Q9KHU8	Chromosomal replication initiator protein DnaA	1.06e-04	3.34e-05	NA	NA
5. P	Q8DL93	Chromosomal replication initiator protein DnaA	1.29e-04	3.72e-06	NA	NA
5. P	O34126	ATP-dependent Clp protease ATP-binding subunit ClpX	3.71e-03	2.66e-05	NA	NA
5. P	C0M7C0	Chromosomal replication initiator protein DnaA	1.01e-04	1.84e-05	NA	NA
5. P	A8MEA0	Chromosomal replication initiator protein DnaA	1.98e-04	1.91e-03	NA	NA
5. P	Q7NKK4	Chromosomal replication initiator protein DnaA	1.19e-04	8.37e-05	NA	NA
5. P	Q2JLU2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.86e-04	8.84e-06	NA	NA
5. P	Q2GG27	Chromosomal replication initiator protein DnaA	3.55e-05	7.94e-04	NA	NA
5. P	A3NWA5	ATP-dependent Clp protease ATP-binding subunit ClpX	6.07e-03	5.19e-07	NA	NA
5. P	P57548	ATP-dependent Clp protease ATP-binding subunit ClpX	4.14e-03	4.85e-07	NA	NA
5. P	B7K7Y7	Chromosomal replication initiator protein DnaA	8.63e-05	6.22e-05	NA	NA
5. P	Q0RLU1	Proteasome-associated ATPase	6.80e-05	2.83e-02	NA	NA
5. P	B3QPN4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.43e-03	8.38e-06	NA	NA
5. P	Q982V5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.47e-03	4.47e-07	NA	NA
5. P	Q8RDL6	Chromosomal replication initiator protein DnaA	7.70e-05	5.43e-07	NA	NA
5. P	B2RGM5	Chromosomal replication initiator protein DnaA	1.32e-04	3.61e-02	NA	NA
5. P	A1T0X4	Chromosomal replication initiator protein DnaA	1.40e-04	1.27e-04	NA	NA
5. P	O31850	Uncharacterized protein YojN	1.49e-04	8.53e-07	NA	NA
5. P	O78450	Protein CfxQ homolog	1.50e-05	2.82e-04	NA	NA
5. P	Q92C84	ATP-dependent Clp protease ATP-binding subunit ClpX	2.48e-03	6.01e-07	NA	NA
5. P	A8YW41	Chromosomal replication initiator protein DnaA	7.97e-05	1.44e-03	NA	NA
5. P	A7G9B0	Chromosomal replication initiator protein DnaA	1.17e-04	1.49e-03	NA	NA
5. P	Q2YUP1	Chromosomal replication initiator protein DnaA	1.11e-04	3.30e-04	NA	NA
5. P	C0RJ80	ATP-dependent Clp protease ATP-binding subunit ClpX	5.91e-03	6.73e-07	NA	NA
5. P	Q8YHC7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.50e-03	6.73e-07	NA	NA
5. P	B0CDM2	Chromosomal replication initiator protein DnaA	2.01e-04	5.38e-06	NA	NA
5. P	Q46ID3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.36e-04	4.99e-06	NA	NA
5. P	A9KU72	Chromosomal replication initiator protein DnaA	1.22e-04	6.87e-04	NA	NA
5. P	Q4V0S8	Chromosomal replication initiator protein DnaA	1.32e-04	1.49e-03	NA	NA
5. P	Q72ZV4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.49e-03	1.47e-07	NA	NA
5. P	Q51664	Protein NorQ	1.34e-03	9.30e-03	NA	NA
5. P	A1S1G9	Chromosomal replication initiator protein DnaA	1.04e-04	3.81e-03	NA	NA
5. P	C5D5L4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.76e-03	8.53e-07	NA	NA
5. P	P68868	Chromosomal replication initiator protein DnaA	1.61e-04	3.54e-04	NA	NA
5. P	B2KAM4	Chromosomal replication initiator protein DnaA	2.97e-05	2.74e-07	NA	NA
5. P	A2BTN8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.48e-03	4.71e-05	NA	NA
5. P	C1L2Z8	Chromosomal replication initiator protein DnaA	1.97e-04	3.02e-04	NA	NA
5. P	Q8PBY5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.92e-03	8.62e-07	NA	NA
5. P	A1SUW8	ATP-dependent Clp protease ATP-binding subunit ClpX	4.03e-03	6.58e-07	NA	NA
5. P	Q1R8P2	DnaA regulatory inactivator Hda	1.98e-04	5.20e-03	NA	NA
5. P	P09432	DNA-binding transcriptional regulator NtrC	1.63e-04	3.94e-02	NA	NA
5. P	B6JGU8	ATP-dependent Clp protease ATP-binding subunit ClpX	6.49e-03	1.06e-06	NA	NA
5. P	P0A3A4	Chromosomal replication initiator protein DnaA	1.88e-04	9.42e-06	NA	NA
5. P	A2RF17	ATP-dependent Clp protease ATP-binding subunit ClpX	3.25e-03	7.62e-07	NA	NA
5. P	B5BB08	DnaA regulatory inactivator Hda	5.91e-05	3.01e-02	NA	NA
5. P	Q6HQ03	Chromosomal replication initiator protein DnaA	1.27e-04	3.17e-05	NA	NA
5. P	A8FJG5	Chromosomal replication initiator protein DnaA	9.94e-05	9.42e-06	NA	NA
5. P	Q57VB1	ATP-dependent protease ATPase subunit HslU1	1.07e-02	3.67e-02	NA	NA
5. P	A0JXL2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.10e-03	2.98e-05	NA	NA
5. P	A8GTC4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.61e-03	5.74e-07	NA	NA
5. P	C0QHJ8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.82e-04	3.36e-07	NA	NA
5. P	Q8YQX7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.29e-03	3.56e-05	NA	NA
5. P	A3PKS0	ATP-dependent Clp protease ATP-binding subunit ClpX	6.00e-03	6.88e-07	NA	NA
5. P	Q5HF98	ATP-dependent Clp protease ATP-binding subunit ClpX	1.39e-03	2.93e-07	NA	NA
5. P	B5RRN9	Chromosomal replication initiator protein DnaA	5.64e-05	1.27e-03	NA	NA
5. P	A8L1X0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.34e-03	7.97e-07	NA	NA
5. P	A9R5R5	Chromosomal replication initiator protein DnaA	1.42e-04	2.38e-04	NA	NA
5. P	Q8NN26	ATP-dependent Clp protease ATP-binding subunit ClpX	3.78e-03	5.28e-05	NA	NA
5. P	D1BHU2	Proteasome-associated ATPase	2.84e-05	3.64e-07	NA	NA
5. P	C6E7Q5	Chromosomal replication initiator protein DnaA	1.20e-04	2.60e-03	NA	NA
5. P	Q07ZX9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.39e-03	5.68e-06	NA	NA
5. P	B9IYG8	Chromosomal replication initiator protein DnaA	1.58e-04	3.24e-05	NA	NA
5. P	Q55510	ATP-dependent Clp protease ATP-binding subunit ClpX	1.95e-03	7.10e-05	NA	NA
5. P	Q9Z8M9	Chromosomal replication initiator protein DnaA 1	9.84e-05	1.00e-04	NA	NA
5. P	P0CAU2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.05e-03	3.37e-06	NA	NA
5. P	Q39FE9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.35e-03	4.37e-07	NA	NA
5. P	Q5E8Z2	Chromosomal replication initiator protein DnaA	1.31e-04	5.94e-04	NA	NA
5. P	A4JF04	ATP-dependent Clp protease ATP-binding subunit ClpX	5.60e-03	4.42e-07	NA	NA
5. P	B9MG15	ATP-dependent Clp protease ATP-binding subunit ClpX	6.13e-03	2.80e-06	NA	NA
5. P	Q1RJ84	ATP-dependent Clp protease ATP-binding subunit ClpX	2.61e-03	7.37e-07	NA	NA
5. P	B2S5W0	ATP-dependent Clp protease ATP-binding subunit ClpX	5.66e-03	6.36e-07	NA	NA
5. P	Q4UMJ3	Chromosomal replication initiator protein DnaA	8.06e-05	3.84e-03	NA	NA
5. P	Q83FD8	Chromosomal replication initiator protein DnaA	1.65e-04	8.11e-06	NA	NA
5. P	Q5PFN5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.88e-03	7.53e-07	NA	NA
5. P	P63790	ATP-dependent Clp protease ATP-binding subunit ClpX	1.47e-03	2.93e-07	NA	NA
5. P	Q11AE3	Chromosomal replication initiator protein DnaA	8.29e-05	2.86e-05	NA	NA
5. P	Q1R1P2	Chromosomal replication initiator protein DnaA	1.65e-04	9.38e-03	NA	NA
5. P	Q0RPH1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.52e-03	5.62e-07	NA	NA
5. P	C4ZX71	DnaA regulatory inactivator Hda	1.89e-04	5.20e-03	NA	NA
5. P	P0A3A6	Chromosomal replication initiator protein DnaA	7.25e-05	9.42e-06	NA	NA
5. P	Q73M37	ATP-dependent Clp protease ATP-binding subunit ClpX	2.23e-03	5.31e-07	NA	NA
5. P	A1UJ35	ATP-dependent Clp protease ATP-binding subunit ClpX	1.73e-03	4.48e-06	NA	NA
5. P	B3DWG6	Chromosomal replication initiator protein DnaA	6.63e-05	2.34e-05	NA	NA
5. P	A5N2K7	ATP-dependent Clp protease ATP-binding subunit ClpX	3.30e-03	3.00e-07	NA	NA
5. P	C3P9F7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.44e-03	1.47e-07	NA	NA
5. P	Q8PNI4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.70e-03	9.22e-07	NA	NA
5. P	M1UXG8	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	4.78e-05	1.80e-03	NA	NA
5. P	A3M1Y8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.12e-03	3.11e-07	NA	NA
5. P	Q5Z061	ATP-dependent Clp protease ATP-binding subunit ClpX	5.23e-03	1.22e-05	NA	NA
5. P	P9WPB8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.72e-03	2.37e-06	NA	NA
5. P	A7MFI7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.53e-03	1.47e-06	NA	NA
5. P	A8EZD2	ATP-dependent protease ATPase subunit HslU	1.31e-02	4.36e-02	NA	NA
5. P	A9MX77	Chromosomal replication initiator protein DnaA	8.29e-05	1.82e-03	NA	NA
5. P	B7JYF1	Chromosomal replication initiator protein DnaA	6.39e-05	5.38e-06	NA	NA
5. P	A9NDF9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.84e-03	1.22e-06	NA	NA
5. P	A3Q8S6	Chromosomal replication initiator protein DnaA	1.00e-04	1.25e-02	NA	NA
5. P	B2IR87	ATP-dependent Clp protease ATP-binding subunit ClpX	1.78e-03	9.53e-08	NA	NA
5. P	Q1GKT2	Chromosomal replication initiator protein DnaA	2.63e-05	2.60e-03	NA	NA
5. P	B1Y547	Chromosomal replication initiator protein DnaA	1.82e-04	3.55e-02	NA	NA
5. P	B1Z9C8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.82e-03	1.65e-06	NA	NA
5. P	B5RMG2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.94e-03	1.55e-07	NA	NA
5. P	P46388	Chromosomal replication initiator protein DnaA	5.78e-04	1.56e-02	NA	NA
5. P	Q3M727	ATP-dependent Clp protease ATP-binding subunit ClpX	4.10e-03	4.66e-05	NA	NA
5. P	A1K782	ATP-dependent Clp protease ATP-binding subunit ClpX	2.31e-03	2.15e-06	NA	NA
5. P	A4SM43	ATP-dependent Clp protease ATP-binding subunit ClpX	4.67e-03	9.12e-07	NA	NA
5. P	B1IND6	ATP-dependent Clp protease ATP-binding subunit ClpX	3.12e-03	5.62e-07	NA	NA
5. P	P23013	Protein CfxQ	1.22e-05	8.81e-03	NA	NA
5. P	B5RFY7	Chromosomal replication initiator protein DnaA	7.62e-05	1.84e-03	NA	NA
5. P	B5RLZ3	Chromosomal replication initiator protein DnaA	7.50e-05	1.17e-03	NA	NA
5. P	A5CR08	ATP-dependent Clp protease ATP-binding subunit ClpX	2.16e-03	3.38e-05	NA	NA
5. P	Q04HR6	Chromosomal replication initiator protein DnaA	3.84e-05	1.52e-04	NA	NA
5. P	C1CXJ1	Chromosomal replication initiator protein DnaA	1.11e-04	1.38e-05	NA	NA
5. P	Q5HBP0	Chromosomal replication initiator protein DnaA	1.50e-04	1.21e-03	NA	NA
5. P	A6QD41	Chromosomal replication initiator protein DnaA	1.71e-04	3.54e-04	NA	NA
5. P	P35888	Chromosomal replication initiator protein DnaA	1.96e-04	2.93e-04	NA	NA
5. P	Q2NV78	ATP-dependent Clp protease ATP-binding subunit ClpX	3.87e-03	1.10e-06	NA	NA
5. P	B7J791	ATP-dependent Clp protease ATP-binding subunit ClpX	4.07e-03	2.10e-07	NA	NA
5. P	A2C122	Chromosomal replication initiator protein DnaA	9.71e-05	1.80e-03	NA	NA
5. P	P22837	Chromosomal replication initiator protein DnaA	1.44e-04	2.04e-03	NA	NA
5. P	C1CH81	Chromosomal replication initiator protein DnaA	1.25e-04	2.16e-04	NA	NA
5. P	P63792	ATP-dependent Clp protease ATP-binding subunit ClpX	3.24e-03	1.89e-07	NA	NA
5. P	B1LNE6	DnaA regulatory inactivator Hda	3.46e-05	5.20e-03	NA	NA
5. P	C3PP41	Chromosomal replication initiator protein DnaA	1.35e-04	7.98e-03	NA	NA
5. P	Q7MXZ1	Chromosomal replication initiator protein DnaA	1.33e-04	3.61e-02	NA	NA
5. P	Q89AA0	ATP-dependent Clp protease ATP-binding subunit ClpX	1.61e-03	2.32e-06	NA	NA
5. P	A8FTI0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.05e-03	3.90e-07	NA	NA
5. P	A8AXB9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.14e-03	7.27e-08	NA	NA
5. P	A1RDX7	Chromosomal replication initiator protein DnaA	9.17e-05	1.91e-04	NA	NA
5. P	Q6NDV3	Chromosomal replication initiator protein DnaA	3.03e-05	1.33e-03	NA	NA
5. P	A6LIY2	Chromosomal replication initiator protein DnaA	2.21e-04	9.36e-04	NA	NA
5. P	A0L3I7	Chromosomal replication initiator protein DnaA	1.87e-04	2.20e-04	NA	NA
5. P	Q0TQK3	ATP-dependent Clp protease ATP-binding subunit ClpX	2.87e-03	2.68e-07	NA	NA
5. P	Q0AQ06	ATP-dependent Clp protease ATP-binding subunit ClpX	6.26e-03	9.02e-07	NA	NA
5. P	A8F346	Chromosomal replication initiator protein DnaA	4.85e-05	1.91e-04	NA	NA
5. P	Q8A5U5	Chromosomal replication initiator protein DnaA	2.23e-04	2.36e-04	NA	NA
5. P	P57128	Chromosomal replication initiator protein DnaA	7.98e-05	4.06e-04	NA	NA
5. P	Q668E8	DnaA regulatory inactivator Hda	2.39e-04	2.03e-02	NA	NA
5. P	A6U7U8	ATP-dependent Clp protease ATP-binding subunit ClpX	4.06e-03	1.32e-06	NA	NA
5. P	Q9L7X5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.65e-03	6.73e-07	NA	NA
5. P	C1FLA5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.13e-03	5.62e-07	NA	NA
5. P	A8G3T0	Chromosomal replication initiator protein DnaA	6.58e-05	2.20e-04	NA	NA
5. P	Q3JAJ9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.66e-03	1.32e-07	NA	NA
5. P	A8YYS4	Chromosomal replication initiator protein DnaA	7.08e-05	3.54e-04	NA	NA
5. P	C3P8P5	Chromosomal replication initiator protein DnaA	1.84e-04	3.17e-05	NA	NA
5. P	A7FPR6	Chromosomal replication initiator protein DnaA	1.51e-04	5.66e-04	NA	NA
5. P	B9DSN7	Chromosomal replication initiator protein DnaA	8.52e-05	2.11e-05	NA	NA
5. P	Q5H433	ATP-dependent Clp protease ATP-binding subunit ClpX	3.65e-03	7.70e-07	NA	NA
5. P	Q3SRD3	ATP-dependent Clp protease ATP-binding subunit ClpX	6.31e-03	1.28e-06	NA	NA
5. P	P51228	Protein CfxQ homolog	1.87e-05	1.72e-06	NA	NA
5. P	Q32D72	DnaA regulatory inactivator Hda	2.01e-04	5.20e-03	NA	NA
5. P	A9M5C1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.54e-03	9.65e-07	NA	NA
5. P	Q725H0	Chromosomal replication initiator protein DnaA	1.29e-04	3.61e-04	NA	NA
5. P	Q2Y6J1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.58e-03	1.55e-07	NA	NA
5. P	Q5LUP9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.38e-03	6.73e-07	NA	NA
5. P	O22025	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	1.59e-05	1.95e-04	NA	NA
5. P	B7M3T1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.11e-03	7.45e-07	NA	NA
5. P	Q5LWV4	Chromosomal replication initiator protein DnaA	8.00e-05	9.22e-03	NA	NA
5. P	Q1JJA7	Chromosomal replication initiator protein DnaA	1.05e-04	9.42e-06	NA	NA
5. P	Q6A7F1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.61e-03	2.83e-05	NA	NA
5. P	Q0A6A8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.30e-03	4.85e-07	NA	NA
5. P	C3LNM5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.66e-03	5.94e-07	NA	NA
5. P	Q5X0L8	Chromosomal replication initiator protein DnaA	1.66e-04	9.84e-05	NA	NA
5. P	B0SMF0	ATP-dependent Clp protease ATP-binding subunit ClpX	1.77e-03	3.33e-07	NA	NA
5. P	Q1I2G4	Chromosomal replication initiator protein DnaA	1.05e-04	1.05e-02	NA	NA
5. P	O51557	ATP-dependent Clp protease ATP-binding subunit ClpX	1.88e-03	1.39e-06	NA	NA
5. P	Q2RU44	ATP-dependent Clp protease ATP-binding subunit ClpX	5.26e-03	2.64e-07	NA	NA
5. P	B1LJJ5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.53e-03	7.45e-07	NA	NA
5. P	Q48VX2	Chromosomal replication initiator protein DnaA	9.09e-05	9.42e-06	NA	NA
5. P	Q65VB8	Chromosomal replication initiator protein DnaA	1.37e-04	2.30e-03	NA	NA
5. P	Q9TLY2	Protein CfxQ homolog	1.95e-05	1.04e-06	NA	NA
5. P	B1Y6H2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.51e-03	1.67e-06	NA	NA
5. P	B7M7K0	DnaA regulatory inactivator Hda	4.40e-05	5.20e-03	NA	NA
5. P	B4SYA8	Chromosomal replication initiator protein DnaA	7.26e-05	1.82e-03	NA	NA
5. P	Q0SN72	Chromosomal replication initiator protein DnaA	1.83e-04	1.71e-04	NA	NA
5. P	Q3YZ56	DnaA regulatory inactivator Hda	1.97e-04	5.20e-03	NA	NA
5. P	Q5HNM9	ATP-dependent Clp protease ATP-binding subunit ClpX	1.52e-03	7.81e-08	NA	NA
5. P	B5YE53	ATP-dependent Clp protease ATP-binding subunit ClpX	5.93e-04	3.77e-07	NA	NA
5. P	Q72H87	Chromosomal replication initiator protein DnaA	1.02e-04	9.26e-05	NA	NA
5. P	B7HIH4	Chromosomal replication initiator protein DnaA	1.87e-04	3.34e-05	NA	NA
5. P	P03004	Chromosomal replication initiator protein DnaA	1.48e-04	7.79e-04	NA	NA
5. P	Q9ZT00	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	5.25e-04	1.75e-03	NA	NA
5. P	P33768	Chromosomal replication initiator protein DnaA	1.14e-04	1.31e-04	NA	NA
5. P	A1QZM2	Chromosomal replication initiator protein DnaA	6.26e-05	6.82e-05	NA	NA
5. P	B8HRT5	Chromosomal replication initiator protein DnaA	2.22e-04	3.08e-05	NA	NA
5. P	O22034	Protein CfxQ homolog	1.62e-05	1.15e-03	NA	NA
5. P	Q7VGY5	ATP-dependent Clp protease ATP-binding subunit ClpX	2.87e-03	6.90e-06	NA	NA
5. P	Q9PLM1	ATP-dependent Clp protease ATP-binding subunit ClpX	1.05e-02	7.72e-08	NA	NA
5. P	Q3BZT1	Chromosomal replication initiator protein DnaA	1.44e-04	1.97e-04	NA	NA
5. P	B2GEU8	Chromosomal replication initiator protein DnaA	1.30e-04	1.34e-03	NA	NA
5. P	A1AJX2	Chromosomal replication initiator protein DnaA	1.22e-04	2.07e-05	NA	NA
5. P	B1HVE5	ATP-dependent Clp protease ATP-binding subunit ClpX	2.83e-03	1.33e-06	NA	NA
5. P	Q72WD6	Chromosomal replication initiator protein DnaA	1.42e-04	3.71e-05	NA	NA
5. P	A7ZIJ6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.01e-03	7.45e-07	NA	NA
5. P	Q823P0	Chromosomal replication initiator protein DnaA 1	7.62e-05	6.96e-05	NA	NA
5. P	P63789	ATP-dependent Clp protease ATP-binding subunit ClpX	1.65e-03	2.93e-07	NA	NA
5. P	C3MA45	ATP-dependent Clp protease ATP-binding subunit ClpX	5.67e-03	1.06e-06	NA	NA
5. P	A8EQT0	Chromosomal replication initiator protein DnaA	1.67e-04	1.00e-03	NA	NA
5. P	Q6ARL8	Chromosomal replication initiator protein DnaA	1.04e-04	1.26e-04	NA	NA
5. P	Q3B0U2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.80e-03	1.15e-05	NA	NA
5. P	G3XCV0	Transcriptional regulator FleQ	4.33e-04	2.60e-02	NA	NA
5. P	Q8ZC66	ATP-dependent Clp protease ATP-binding subunit ClpX	4.68e-03	4.09e-07	NA	NA
5. P	B2K9J7	DnaA regulatory inactivator Hda	5.15e-05	2.03e-02	NA	NA
5. P	B9DPX4	Chromosomal replication initiator protein DnaA	1.01e-04	9.94e-05	NA	NA
5. P	B7NR04	Chromosomal replication initiator protein DnaA	1.34e-04	7.79e-04	NA	NA
5. P	A8GAR0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.75e-03	1.19e-06	NA	NA
5. P	Q9ZJ96	Chromosomal replication initiator protein DnaA	5.12e-04	2.48e-04	NA	NA
5. P	A4WSH9	ATP-dependent Clp protease ATP-binding subunit ClpX	6.95e-03	4.90e-07	NA	NA
5. P	Q1QL77	ATP-dependent Clp protease ATP-binding subunit ClpX	5.71e-03	1.41e-06	NA	NA
5. P	Q28WI0	Chromosomal replication initiator protein DnaA	4.40e-05	2.96e-02	NA	NA
5. P	Q8XPG2	Chromosomal replication initiator protein DnaA	2.31e-04	1.80e-04	NA	NA
5. P	B4EBM2	ATP-dependent Clp protease ATP-binding subunit ClpX	5.85e-03	4.37e-07	NA	NA
5. P	A7X396	ATP-dependent Clp protease ATP-binding subunit ClpX	1.83e-03	2.93e-07	NA	NA
5. P	C1L2H6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.54e-03	5.31e-07	NA	NA
5. P	B2U4P3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.13e-03	7.45e-07	NA	NA
5. P	A1ADY9	DnaA regulatory inactivator Hda	3.89e-05	5.20e-03	NA	NA
5. P	B7IF65	Chromosomal replication initiator protein DnaA	2.40e-04	2.82e-04	NA	NA
5. P	A6X117	ATP-dependent Clp protease ATP-binding subunit ClpX	6.14e-03	4.28e-07	NA	NA
5. P	Q1LTK0	ATP-dependent Clp protease ATP-binding subunit ClpX	1.71e-02	5.82e-08	NA	NA
5. P	Q03I60	Chromosomal replication initiator protein DnaA	1.29e-04	6.55e-04	NA	NA
5. P	B1J693	ATP-dependent Clp protease ATP-binding subunit ClpX	2.81e-03	6.65e-07	NA	NA
5. P	B5XIP2	Chromosomal replication initiator protein DnaA	1.01e-04	1.69e-05	NA	NA
5. P	A9MWX5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.09e-03	7.53e-07	NA	NA
5. P	A5FX05	ATP-dependent Clp protease ATP-binding subunit ClpX	3.85e-03	2.17e-06	NA	NA
5. P	A0LDT3	ATP-dependent Clp protease ATP-binding subunit ClpX	3.54e-03	1.82e-05	NA	NA
5. P	C4LDB4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.89e-03	3.52e-06	NA	NA
5. P	B5FKV4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.15e-03	7.53e-07	NA	NA
5. P	Q7V6H4	Chromosomal replication initiator protein DnaA	8.85e-05	1.32e-03	NA	NA
5. P	Q8G5R1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.19e-03	1.51e-05	NA	NA
5. P	A7ILC7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.99e-03	3.26e-06	NA	NA
5. P	Q2L255	ATP-dependent Clp protease ATP-binding subunit ClpX	5.92e-04	9.65e-07	NA	NA
5. P	B9LFG0	Chromosomal replication initiator protein DnaA	2.86e-04	2.32e-03	NA	NA
5. P	Q820F8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.21e-03	4.43e-06	NA	NA
5. P	B2I3C2	ATP-dependent Clp protease ATP-binding subunit ClpX	6.25e-03	3.11e-07	NA	NA
5. P	Q7MQJ7	Chromosomal replication initiator protein DnaA	1.72e-04	1.20e-03	NA	NA
5. P	A9AJR1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.08e-03	3.56e-07	NA	NA
5. P	Q2NDC1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.60e-03	4.85e-07	NA	NA
5. P	Q25BH9	Uncharacterized protein ORF16	NA	1.32e-03	NA	NA
5. P	B4U360	ATP-dependent Clp protease ATP-binding subunit ClpX	3.21e-03	1.61e-07	NA	NA
5. P	Q1CRG8	Chromosomal replication initiator protein DnaA	7.89e-04	2.74e-04	NA	NA
5. P	O14657	Torsin-1B	2.74e-03	3.34e-02	NA	NA
5. P	Q88VE2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.68e-03	5.87e-06	NA	NA
5. P	Q6CYR4	Chromosomal replication initiator protein DnaA	7.77e-05	7.21e-04	NA	NA
5. P	Q7VSE0	Chromosomal replication initiator protein DnaA	1.21e-04	4.10e-03	NA	NA
5. P	A4XHW1	ATP-dependent Clp protease ATP-binding subunit ClpX	5.92e-03	9.76e-07	NA	NA
5. P	C4L4J1	ATP-dependent Clp protease ATP-binding subunit ClpX	2.54e-03	4.03e-08	NA	NA
5. P	P69934	DnaA regulatory inactivator Hda	3.68e-05	5.20e-03	NA	NA
5. P	Q63HG7	Chromosomal replication initiator protein DnaA	1.75e-04	3.17e-05	NA	NA
5. P	Q0T7E5	ATP-dependent Clp protease ATP-binding subunit ClpX	5.08e-03	7.45e-07	NA	NA
5. P	A7N1E9	Chromosomal replication initiator protein DnaA	1.69e-04	9.45e-04	NA	NA
5. P	Q2GJB5	ATP-dependent Clp protease ATP-binding subunit ClpX	1.23e-03	1.19e-07	NA	NA
5. P	C4L755	Chromosomal replication initiator protein DnaA	2.03e-04	6.82e-05	NA	NA
5. P	B2IT91	ATP-dependent Clp protease ATP-binding subunit ClpX	5.23e-03	8.93e-06	NA	NA
5. P	A6TJ76	Chromosomal replication initiator protein DnaA	1.78e-04	2.36e-04	NA	NA
5. P	B0TSA7	Holliday junction ATP-dependent DNA helicase RuvB	8.02e-07	4.67e-02	NA	NA
5. P	B6ISY6	ATP-dependent Clp protease ATP-binding subunit ClpX	5.67e-03	1.73e-07	NA	NA
5. P	C4K1R9	Chromosomal replication initiator protein DnaA	4.38e-05	6.08e-03	NA	NA
5. P	Q59758	Chromosomal replication initiator protein DnaA	2.37e-04	2.32e-03	NA	NA
5. P	A8FFV9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.59e-03	1.69e-07	NA	NA
5. P	Q7WK82	ATP-dependent Clp protease ATP-binding subunit ClpX	4.09e-03	1.28e-06	NA	NA
5. P	Q2SK35	ATP-dependent Clp protease ATP-binding subunit ClpX	2.20e-03	4.79e-07	NA	NA
5. P	B8GNT9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.94e-03	7.97e-07	NA	NA
5. P	Q0T224	DnaA regulatory inactivator Hda	1.82e-04	5.20e-03	NA	NA
5. P	A6STW2	Chromosomal replication initiator protein DnaA	1.78e-04	3.24e-04	NA	NA
5. P	O33873	ATP-dependent Clp protease ATP-binding subunit ClpX	3.89e-03	9.43e-07	NA	NA
5. P	Q2KTI9	Chromosomal replication initiator protein DnaA	7.89e-05	2.26e-02	NA	NA
5. P	A2RBX3	Chromosomal replication initiator protein DnaA	9.85e-05	9.42e-06	NA	NA
5. P	Q5GS84	ATP-dependent Clp protease ATP-binding subunit ClpX	2.67e-03	4.48e-06	NA	NA
5. P	B5EXI9	ATP-dependent Clp protease ATP-binding subunit ClpX	3.84e-03	7.53e-07	NA	NA
5. P	Q4L715	ATP-dependent Clp protease ATP-binding subunit ClpX	1.60e-03	2.80e-07	NA	NA
5. P	Q1H1F9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.31e-03	3.33e-08	NA	NA
5. P	P43742	Chromosomal replication initiator protein DnaA	1.64e-04	2.35e-03	NA	NA
5. P	Q12LA2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.73e-03	5.15e-06	NA	NA
5. P	A1A8A7	ATP-dependent Clp protease ATP-binding subunit ClpX	4.07e-03	7.45e-07	NA	NA
5. P	Q65UP0	Holliday junction ATP-dependent DNA helicase RuvB	3.71e-06	4.44e-02	NA	NA
5. P	B4SEI4	ATP-dependent Clp protease ATP-binding subunit ClpX	7.26e-03	3.06e-06	NA	NA
5. P	P0A6H3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.77e-03	7.45e-07	NA	NA
5. P	Q6G0V6	Chromosomal replication initiator protein DnaA	1.03e-04	4.94e-04	NA	NA
5. P	Q2GD18	ATP-dependent Clp protease ATP-binding subunit ClpX	2.20e-04	1.47e-07	NA	NA
5. P	Q8RC24	ATP-dependent Clp protease ATP-binding subunit ClpX	2.50e-03	6.32e-08	NA	NA
5. P	A1V4X0	ATP-dependent Clp protease ATP-binding subunit ClpX	4.45e-03	7.88e-07	NA	NA
5. P	Q1RI85	Chromosomal replication initiator protein DnaA	4.75e-05	1.85e-02	NA	NA
5. P	B1I6X3	Chromosomal replication initiator protein DnaA	1.17e-04	2.16e-04	NA	NA
5. P	Q87YR7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.55e-03	6.01e-07	NA	NA
5. P	Q4FQB8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.27e-03	2.44e-05	NA	NA
5. P	A7GVR3	Chromosomal replication initiator protein DnaA	1.70e-04	3.50e-04	NA	NA
5. P	B2UX43	Chromosomal replication initiator protein DnaA	1.28e-04	2.79e-04	NA	NA
5. P	Q93SW1	Magnesium-chelatase 38 kDa subunit	8.96e-02	4.84e-02	NA	NA
5. P	Q1JP60	Chromosomal replication initiator protein DnaA	8.92e-05	9.42e-06	NA	NA
5. P	B3Q7P4	ATP-dependent Clp protease ATP-binding subunit ClpX	5.90e-03	6.22e-07	NA	NA
5. P	Q329B6	Chromosomal replication initiator protein DnaA	1.59e-04	1.11e-03	NA	NA
5. P	Q39ZS3	Chromosomal replication initiator protein DnaA	1.42e-04	2.02e-05	NA	NA
5. P	P17899	Transcriptional regulatory protein FlbD	6.99e-04	1.04e-03	NA	NA
5. P	C1CU44	Chromosomal replication initiator protein DnaA	4.92e-05	3.75e-04	NA	NA
5. P	Q92QQ2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.48e-03	1.23e-06	NA	NA
5. P	Q2JQW9	Chromosomal replication initiator protein DnaA	1.14e-04	4.34e-05	NA	NA
5. P	B2J2B2	Chromosomal replication initiator protein DnaA	8.91e-05	5.38e-05	NA	NA
5. P	Q8CQK7	Chromosomal replication initiator protein DnaA	8.46e-05	6.61e-04	NA	NA
5. P	Q3J1G7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.93e-03	8.62e-07	NA	NA
5. P	A5UP91	Chromosomal replication initiator protein DnaA	3.53e-04	8.50e-04	NA	NA
5. P	Q5PB48	Chromosomal replication initiator protein DnaA	1.38e-04	2.08e-03	NA	NA
5. P	A8HYF4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.95e-03	9.03e-06	NA	NA
5. P	Q7VRH0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.17e-03	1.49e-06	NA	NA
5. P	Q63V40	ATP-dependent Clp protease ATP-binding subunit ClpX	2.22e-03	5.19e-07	NA	NA
5. P	Q0HTK8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.26e-03	3.48e-06	NA	NA
5. P	Q9ZCN1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.69e-03	7.90e-08	NA	NA
5. P	Q660R1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.18e-03	4.58e-07	NA	NA
5. P	B8GBK7	Chromosomal replication initiator protein DnaA	1.32e-04	1.00e-04	NA	NA
5. P	A8A6G3	Chromosomal replication initiator protein DnaA	1.65e-04	7.79e-04	NA	NA
5. P	Q0C0G0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.04e-03	2.45e-06	NA	NA
5. P	A9BDA1	ATP-dependent Clp protease ATP-binding subunit ClpX	3.67e-03	6.96e-07	NA	NA
5. P	B8E3P4	Chromosomal replication initiator protein DnaA	1.23e-04	6.87e-04	NA	NA
5. P	Q5H715	Chromosomal replication initiator protein DnaA	1.49e-04	2.88e-04	NA	NA
5. P	Q9WXZ3	ATP-dependent Clp protease ATP-binding subunit ClpX	5.40e-03	1.07e-06	NA	NA
5. P	Q88KI9	ATP-dependent Clp protease ATP-binding subunit ClpX	6.84e-03	7.99e-08	NA	NA
5. P	Q7NAD3	Chromosomal replication initiator protein DnaA	1.68e-04	9.72e-04	NA	NA
5. P	A7MV82	ATP-dependent Clp protease ATP-binding subunit ClpX	4.31e-03	3.02e-06	NA	NA
5. P	Q47K71	Chromosomal replication initiator protein DnaA	1.09e-04	6.48e-05	NA	NA
5. P	Q5E6Q4	ATP-dependent Clp protease ATP-binding subunit ClpX	3.96e-03	1.99e-06	NA	NA
5. P	B5BIL4	Chromosomal replication initiator protein DnaA	8.65e-05	1.82e-03	NA	NA
5. P	B6EP46	Chromosomal replication initiator protein DnaA	1.27e-04	2.91e-03	NA	NA
5. P	Q0AJI3	ATP-dependent Clp protease ATP-binding subunit ClpX	9.49e-04	3.56e-07	NA	NA
5. P	A6WLQ2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.69e-03	2.59e-06	NA	NA
5. P	C6DGH7	Chromosomal replication initiator protein DnaA	1.74e-04	3.22e-03	NA	NA
5. P	Q317Y5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.67e-04	2.37e-05	NA	NA
5. P	A4G5X0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.78e-03	3.29e-07	NA	NA
5. P	Q0TKK3	ATP-dependent Clp protease ATP-binding subunit ClpX	4.98e-03	7.45e-07	NA	NA
5. P	B0RTF5	ATP-dependent Clp protease ATP-binding subunit ClpX	3.62e-03	8.62e-07	NA	NA
5. P	A9M020	ATP-dependent Clp protease ATP-binding subunit ClpX	5.46e-03	5.81e-07	NA	NA
5. P	A6W963	Proteasome-associated ATPase	3.57e-05	2.63e-03	NA	NA
5. P	Q8W032	Cell division control protein 6 homolog B	5.00e-04	4.88e-03	NA	NA
5. P	B8I3R2	Chromosomal replication initiator protein DnaA	1.76e-04	9.27e-04	NA	NA
5. P	Q8K989	ATP-dependent Clp protease ATP-binding subunit ClpX	3.11e-03	2.55e-07	NA	NA
5. P	A1VE84	ATP-dependent Clp protease ATP-binding subunit ClpX	1.03e-04	1.82e-06	NA	NA
5. P	Q92GQ4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.60e-03	3.00e-07	NA	NA
5. P	Q5M226	Chromosomal replication initiator protein DnaA	1.18e-04	3.24e-05	NA	NA
5. P	A9KF39	Holliday junction ATP-dependent DNA helicase RuvB	2.95e-06	1.06e-02	NA	NA
5. P	A4G154	Chromosomal replication initiator protein DnaA	1.50e-04	1.00e-03	NA	NA
5. P	Q8XYP6	ATP-dependent Clp protease ATP-binding subunit ClpX	6.68e-03	8.06e-07	NA	NA
5. P	Q8GJP6	ATP-dependent Clp protease ATP-binding subunit ClpX	5.13e-03	3.36e-07	NA	NA
5. P	Q5L3Z2	Chromosomal replication initiator protein DnaA	9.14e-05	2.37e-05	NA	NA
5. P	Q72CE7	ATP-dependent Clp protease ATP-binding subunit ClpX	1.82e-03	1.82e-06	NA	NA
5. P	B4TN07	Chromosomal replication initiator protein DnaA	1.00e-04	1.82e-03	NA	NA
5. P	Q7P259	Chromosomal replication initiator protein DnaA	1.98e-04	4.92e-03	NA	NA
5. P	Q6NH92	AAA ATPase forming ring-shaped complexes	7.53e-06	2.10e-03	NA	NA
5. P	B1VXA8	ATP-dependent Clp protease ATP-binding subunit ClpX	3.70e-03	2.99e-06	NA	NA
5. P	B3R0L6	Chromosomal replication initiator protein DnaA	1.75e-04	2.32e-03	NA	NA
5. P	B1LL27	Chromosomal replication initiator protein DnaA	1.67e-04	7.79e-04	NA	NA
5. P	B9MQ33	ATP-dependent Clp protease ATP-binding subunit ClpX	4.17e-03	6.88e-07	NA	NA
5. P	Q9JYY3	ATP-dependent Clp protease ATP-binding subunit ClpX	5.14e-03	1.23e-06	NA	NA
5. P	Q68WD8	Chromosomal replication initiator protein DnaA	7.80e-05	2.41e-03	NA	NA
5. P	Q3B5I8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.68e-03	9.65e-07	NA	NA
5. P	B0VKU4	ATP-dependent Clp protease ATP-binding subunit ClpX	5.19e-03	3.11e-07	NA	NA
5. P	A7GJR9	Chromosomal replication initiator protein DnaA	7.35e-05	4.80e-04	NA	NA
5. P	A1RL88	ATP-dependent Clp protease ATP-binding subunit ClpX	2.74e-03	2.51e-06	NA	NA
5. P	Q5FUR4	ATP-dependent Clp protease ATP-binding subunit ClpX	6.50e-03	2.08e-06	NA	NA
5. P	A3Q2I1	ATP-dependent Clp protease ATP-binding subunit ClpX	4.95e-03	4.48e-06	NA	NA
5. P	A9B8B2	ATP-dependent Clp protease ATP-binding subunit ClpX	1.33e-03	2.65e-06	NA	NA
5. P	Q8E7Z4	Chromosomal replication initiator protein DnaA	1.85e-04	4.91e-05	NA	NA
5. P	A0RLX8	Chromosomal replication initiator protein DnaA	2.29e-05	6.96e-03	NA	NA
5. P	Q92H56	Chromosomal replication initiator protein DnaA	1.37e-04	9.30e-03	NA	NA
5. P	C5D327	Chromosomal replication initiator protein DnaA	1.65e-04	1.40e-05	NA	NA
5. P	Q5HXF5	Chromosomal replication initiator protein DnaA	2.54e-04	1.76e-05	NA	NA
5. P	B8HA33	ATP-dependent Clp protease ATP-binding subunit ClpX	4.00e-03	2.61e-04	NA	NA
5. P	Q64PL4	Chromosomal replication initiator protein DnaA	5.20e-05	2.37e-05	NA	NA
5. P	B1JTU9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.41e-03	4.37e-07	NA	NA
5. P	Q3KKY9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.62e-02	4.74e-07	NA	NA
5. P	Q87FC6	Chromosomal replication initiator protein DnaA	1.31e-04	2.63e-04	NA	NA
5. P	Q833M7	ATP-dependent Clp protease ATP-binding subunit ClpX	5.59e-03	2.55e-07	NA	NA
5. P	Q9PRE2	Chromosomal replication initiator protein DnaA	1.08e-04	7.25e-05	NA	NA
5. P	B7LKE6	DnaA regulatory inactivator Hda	3.47e-05	3.99e-03	NA	NA
5. P	Q8DUI0	ATP-dependent Clp protease ATP-binding subunit ClpX	2.96e-03	8.06e-07	NA	NA
5. P	Q17ZQ6	Chromosomal replication initiator protein DnaA	2.67e-04	2.70e-03	NA	NA
5. P	A6WDT9	ATP-dependent Clp protease ATP-binding subunit ClpX	4.81e-03	3.30e-06	NA	NA
5. P	Q1JC93	ATP-dependent Clp protease ATP-binding subunit ClpX	3.03e-03	1.43e-06	NA	NA
5. P	B7MGC3	Chromosomal replication initiator protein DnaA	1.48e-04	7.79e-04	NA	NA
5. P	Q1C0B8	Chromosomal replication initiator protein DnaA	1.52e-04	2.38e-04	NA	NA
5. P	A3DJ11	ATP-dependent Clp protease ATP-binding subunit ClpX	6.36e-03	3.76e-06	NA	NA
5. P	Q5HBX4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.37e-03	5.19e-07	NA	NA
5. P	Q5QXN9	ATP-dependent Clp protease ATP-binding subunit ClpX	2.81e-03	1.32e-06	NA	NA
5. P	Q65GJ4	ATP-dependent Clp protease ATP-binding subunit ClpX	2.09e-03	1.16e-07	NA	NA
5. P	B0C146	ATP-dependent Clp protease ATP-binding subunit ClpX	3.42e-03	1.57e-04	NA	NA
5. P	A0KWL9	Holliday junction ATP-dependent DNA helicase RuvB	3.80e-06	4.96e-02	NA	NA
5. P	Q31BW9	Chromosomal replication initiator protein DnaA	7.07e-05	4.02e-03	NA	NA
5. P	Q165G0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.56e-03	1.39e-06	NA	NA
5. P	B7HQN2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.38e-03	1.47e-07	NA	NA
5. P	Q890K8	Chromosomal replication initiator protein DnaA	1.92e-04	2.63e-04	NA	NA
5. P	C3LIC2	Chromosomal replication initiator protein DnaA	8.64e-05	3.17e-05	NA	NA
5. P	A9NE65	Chromosomal replication initiator protein DnaA	1.67e-04	4.03e-05	NA	NA
5. P	Q21DF6	Chromosomal replication initiator protein DnaA	1.33e-04	1.34e-03	NA	NA
5. P	B5FCQ2	Holliday junction ATP-dependent DNA helicase RuvB	2.73e-05	3.87e-02	NA	NA
5. P	Q2YTB5	ATP-dependent Clp protease ATP-binding subunit ClpX	2.19e-03	2.53e-07	NA	NA
5. P	B4F0U5	Chromosomal replication initiator protein DnaA	1.54e-04	2.04e-03	NA	NA
5. P	Q2JHS1	Chromosomal replication initiator protein DnaA	3.16e-04	5.01e-05	NA	NA
5. P	O87546	Chromosomal replication initiator protein DnaA	1.91e-04	1.90e-02	NA	NA
5. P	A4TPE2	ATP-dependent Clp protease ATP-binding subunit ClpX	4.78e-03	4.09e-07	NA	NA
5. P	O84252	Chromosomal replication initiator protein DnaA 1	2.24e-04	3.41e-06	NA	NA
5. P	O26057	Chromosomal replication initiator protein DnaA	4.78e-04	1.04e-04	NA	NA
5. P	A7FPB7	Chromosomal replication initiator protein DnaA	1.41e-04	2.38e-04	NA	NA
5. P	Q83MI6	ATP-dependent Clp protease ATP-binding subunit ClpX	8.78e-04	1.76e-06	NA	NA
5. P	Q03QN7	ATP-dependent Clp protease ATP-binding subunit ClpX	2.18e-03	9.98e-07	NA	NA
5. P	Q21KA8	ATP-dependent Clp protease ATP-binding subunit ClpX	5.03e-03	8.24e-07	NA	NA
5. P	B4TMC7	ATP-dependent Clp protease ATP-binding subunit ClpX	3.72e-03	7.53e-07	NA	NA
5. P	B2TPB8	ATP-dependent Clp protease ATP-binding subunit ClpX	1.85e-03	1.15e-06	NA	NA
5. P	B5YXA4	Chromosomal replication initiator protein DnaA	1.19e-04	7.43e-04	NA	NA
5. P	B7JQ65	ATP-dependent Clp protease ATP-binding subunit ClpX	2.17e-03	1.47e-07	NA	NA
5. P	A9QZX0	DnaA regulatory inactivator Hda	2.64e-04	4.71e-02	NA	NA
5. P	A9BEI9	Chromosomal replication initiator protein DnaA	8.21e-05	4.22e-04	NA	NA
5. P	B0JGA6	Chromosomal replication initiator protein DnaA	8.28e-05	3.08e-04	NA	NA
5. P	B7VGI4	Chromosomal replication initiator protein DnaA	4.13e-04	2.18e-03	NA	NA
5. P	Q3ANI9	ATP-dependent Clp protease ATP-binding subunit ClpX	5.62e-04	8.02e-06	NA	NA
5. P	C1CN66	Chromosomal replication initiator protein DnaA	9.82e-05	1.13e-04	NA	NA
5. P	B2VCE3	Chromosomal replication initiator protein DnaA	1.49e-04	9.65e-05	NA	NA
5. P	A8EZR2	ATP-dependent Clp protease ATP-binding subunit ClpX	3.67e-03	3.07e-07	NA	NA
5. P	Q033I4	Chromosomal replication initiator protein DnaA	1.77e-04	1.40e-04	NA	NA
5. P	B2T404	ATP-dependent Clp protease ATP-binding subunit ClpX	4.33e-03	1.94e-07	NA	NA
5. P	Q03D55	Chromosomal replication initiator protein DnaA	1.56e-04	8.50e-04	NA	NA
5. P	Q7MSY2	Chromosomal replication initiator protein DnaA	7.18e-05	3.34e-05	NA	NA
5. P	B1KLT6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.51e-03	1.51e-06	NA	NA
5. P	A8AK15	ATP-dependent Clp protease ATP-binding subunit ClpX	4.17e-03	5.74e-07	NA	NA
5. P	A1WUM6	ATP-dependent Clp protease ATP-binding subunit ClpX	4.16e-03	2.36e-07	NA	NA
5. P	A1VX79	Chromosomal replication initiator protein DnaA	9.66e-05	4.52e-05	NA	NA
5. P	Q32JJ4	ATP-dependent Clp protease ATP-binding subunit ClpX	4.05e-03	7.45e-07	NA	NA
5. P	A7WWM4	Chromosomal replication initiator protein DnaA	7.98e-05	3.54e-04	NA	NA
5. P	Q7VXI6	ATP-dependent Clp protease ATP-binding subunit ClpX	3.73e-03	6.51e-07	NA	NA
5. P	B9KHZ5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.72e-04	5.43e-07	NA	NA
5. P	B0U5N2	ATP-dependent Clp protease ATP-binding subunit ClpX	2.20e-03	4.68e-07	NA	NA
5. P	A8F8Y4	Chromosomal replication initiator protein DnaA	8.51e-05	2.82e-04	NA	NA
5. P	B5R6V0	ATP-dependent Clp protease ATP-binding subunit ClpX	3.86e-03	7.53e-07	NA	NA
5. P	C4ZTJ5	ATP-dependent Clp protease ATP-binding subunit ClpX	4.89e-03	7.45e-07	NA	NA
5. P	B5XNQ6	DnaA regulatory inactivator Hda	3.91e-05	1.90e-02	NA	NA
5. P	Q215J1	ATP-dependent Clp protease ATP-binding subunit ClpX	6.04e-03	7.88e-07	NA	NA
5. P	Q2K9U6	ATP-dependent Clp protease ATP-binding subunit ClpX	6.01e-03	5.07e-07	NA	NA
5. P	Q3V4R0	Uncharacterized protein ORF286	NA	5.28e-05	NA	NA
5. P	B1XAX1	DnaA regulatory inactivator Hda	4.43e-05	5.20e-03	NA	NA
5. P	B8IN27	ATP-dependent Clp protease ATP-binding subunit ClpX	4.10e-03	9.87e-07	NA	NA
5. P	Q6GD89	Chromosomal replication initiator protein DnaA	7.90e-05	3.54e-04	NA	NA
5. P	B5ZY09	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	5.01e-07	NA	NA
5. P	Q8DZ10	ATP-dependent Clp protease ATP-binding subunit ClpX	3.19e-03	1.14e-07	NA	NA
5. P	A6SY75	ATP-dependent Clp protease ATP-binding subunit ClpX	5.48e-03	3.95e-07	NA	NA
5. P	Q891J8	ATP-dependent Clp protease ATP-binding subunit ClpX	2.94e-03	1.59e-07	NA	NA
5. P	B7JW74	ATP-dependent Clp protease ATP-binding subunit ClpX	2.87e-03	5.22e-05	NA	NA
5. P	B0JL96	ATP-dependent Clp protease ATP-binding subunit ClpX	3.93e-03	4.78e-06	NA	NA
5. P	Q39UH3	ATP-dependent Clp protease ATP-binding subunit ClpX	3.51e-03	2.25e-06	NA	NA
5. P	Q82Y84	Chromosomal replication initiator protein DnaA	4.38e-05	6.72e-03	NA	NA
5. P	A8F284	Chromosomal replication initiator protein DnaA	6.69e-05	5.11e-03	NA	NA
5. P	B8CRF6	ATP-dependent Clp protease ATP-binding subunit ClpX	2.25e-03	2.87e-07	NA	NA
5. P	Q30YX9	Chromosomal replication initiator protein DnaA	7.56e-05	3.79e-05	NA	NA
6. F	B4T7Z2	Holliday junction ATP-dependent DNA helicase RuvB	2.21e-05	NA	NA	0.5301
6. F	C1KVH9	Holliday junction ATP-dependent DNA helicase RuvB	4.08e-06	NA	NA	0.5359
6. F	Q475R8	Holliday junction ATP-dependent DNA helicase RuvB	2.95e-05	NA	NA	0.5058
6. F	Q6FYP6	Holliday junction ATP-dependent DNA helicase RuvB	1.54e-06	NA	NA	0.4797
6. F	Q47N43	Holliday junction ATP-dependent DNA helicase RuvB	7.06e-07	NA	NA	0.4878
6. F	Q5KWR0	Holliday junction ATP-dependent DNA helicase RuvB	4.80e-06	NA	NA	0.5486
6. F	C3LNE8	Holliday junction ATP-dependent DNA helicase RuvB	2.51e-05	NA	NA	0.5248
6. F	Q82XP4	Holliday junction ATP-dependent DNA helicase RuvB	2.58e-05	NA	NA	0.5362
6. F	Q1CJG5	Holliday junction ATP-dependent DNA helicase RuvB	4.27e-06	NA	NA	0.5335
6. F	Q3A230	Holliday junction ATP-dependent DNA helicase RuvB	5.89e-06	NA	NA	0.5382
6. F	A7ZMY4	Holliday junction ATP-dependent DNA helicase RuvB	2.61e-05	NA	NA	0.4825
6. F	Q823K4	Holliday junction ATP-dependent DNA helicase RuvB	9.39e-07	NA	NA	0.5494
6. F	Q46IJ6	Holliday junction ATP-dependent DNA helicase RuvB	1.81e-06	NA	NA	0.5254
6. F	A0K4L4	Holliday junction ATP-dependent DNA helicase RuvB	3.09e-05	NA	NA	0.522
6. F	B5BH61	Holliday junction ATP-dependent DNA helicase RuvB	2.41e-05	NA	NA	0.5337
6. F	A6U2A9	Holliday junction ATP-dependent DNA helicase RuvB	4.29e-07	NA	NA	0.5149
6. F	A4J537	Holliday junction ATP-dependent DNA helicase RuvB	6.18e-06	NA	NA	0.5091
6. F	Q2NTI8	Holliday junction ATP-dependent DNA helicase RuvB	3.99e-06	NA	NA	0.522
6. F	B7USN7	Holliday junction ATP-dependent DNA helicase RuvB	2.53e-05	NA	NA	0.546
6. F	Q1GYS6	Holliday junction ATP-dependent DNA helicase RuvB	2.98e-05	NA	NA	0.5341
6. F	Q2JD94	Holliday junction ATP-dependent DNA helicase RuvB	7.06e-07	NA	NA	0.5452
6. F	C4ZQE4	Holliday junction ATP-dependent DNA helicase RuvB	2.17e-05	NA	NA	0.5267
6. F	P61534	Holliday junction ATP-dependent DNA helicase RuvB	1.02e-06	NA	NA	0.5567
6. F	Q8P6E7	Holliday junction ATP-dependent DNA helicase RuvB	1.88e-05	NA	NA	0.5315
6. F	Q2P575	Holliday junction ATP-dependent DNA helicase RuvB	2.15e-05	NA	NA	0.5308
6. F	Q7N547	Holliday junction ATP-dependent DNA helicase RuvB	3.84e-06	NA	NA	0.4979
6. F	A9GAW6	ATP-dependent zinc metalloprotease FtsH 3	3.71e-05	NA	NA	0.6389
6. F	A8A160	Holliday junction ATP-dependent DNA helicase RuvB	1.87e-06	NA	NA	0.4811
6. F	Q5HT48	Holliday junction ATP-dependent DNA helicase RuvB	5.19e-08	NA	NA	0.5334
6. F	C1ESW4	Holliday junction ATP-dependent DNA helicase RuvB	4.96e-06	NA	NA	0.4857
6. F	P66756	Holliday junction ATP-dependent DNA helicase RuvB	2.60e-05	NA	NA	0.5319
6. F	Q891Z8	Holliday junction ATP-dependent DNA helicase RuvB	5.22e-06	NA	NA	0.4902
6. F	Q0VRJ7	Holliday junction ATP-dependent DNA helicase RuvB	1.17e-06	NA	NA	0.5207
6. F	Q3ZWZ9	Holliday junction ATP-dependent DNA helicase RuvB	1.80e-05	NA	NA	0.5341
6. F	B1IP47	HTH-type transcriptional regulator MalT	5.49e-02	NA	NA	0.3907
6. F	A0PPD3	Holliday junction ATP-dependent DNA helicase RuvB	6.90e-07	NA	NA	0.5475
6. F	A8G7C1	Holliday junction ATP-dependent DNA helicase RuvB	5.84e-06	NA	NA	0.4546
6. F	A7N1I0	Holliday junction ATP-dependent DNA helicase RuvB	2.28e-05	NA	NA	0.5189
6. F	Q4ULW6	Holliday junction ATP-dependent DNA helicase RuvB	6.12e-06	NA	NA	0.5474
6. F	B9DSU1	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-05	NA	NA	0.5226
6. F	C4K7I4	Holliday junction ATP-dependent DNA helicase RuvB	4.30e-06	NA	NA	0.5518
6. F	O32055	Holliday junction ATP-dependent DNA helicase RuvB	1.34e-06	NA	NA	0.5419
6. F	A8AFI1	Holliday junction ATP-dependent DNA helicase RuvB	2.61e-05	NA	NA	0.5257
6. F	Q20EZ8	ATP-dependent zinc metalloprotease FtsH homolog	2.24e-01	NA	NA	0.4872
6. F	B3P8A3	Spastin	1.21e-05	NA	NA	0.6495
6. F	Q045Q2	Holliday junction ATP-dependent DNA helicase RuvB	7.50e-07	NA	NA	0.5146
6. F	P61539	Holliday junction ATP-dependent DNA helicase RuvB	3.24e-07	NA	NA	0.5725
6. F	A5VS58	Holliday junction ATP-dependent DNA helicase RuvB	2.50e-05	NA	NA	0.5251
6. F	A1W0X9	Holliday junction ATP-dependent DNA helicase RuvB	4.95e-08	NA	NA	0.5323
6. F	B6IBT9	Holliday junction ATP-dependent DNA helicase RuvB	2.49e-05	NA	NA	0.5461
6. F	Q6PAX2	ATPase family AAA domain-containing protein 3-B	1.87e-05	NA	NA	0.5658
6. F	A6VIW1	Replication factor C large subunit	1.10e-04	NA	NA	0.5491
6. F	B8H8L3	Proteasome-associated ATPase	1.16e-04	NA	NA	0.5264
6. F	Q9HHS9	Gas vesicle protein GvpN 2	1.40e-03	NA	NA	0.3912
6. F	Q1RAS4	Holliday junction ATP-dependent DNA helicase RuvB	2.34e-05	NA	NA	0.5235
6. F	A8ZUH7	Holliday junction ATP-dependent DNA helicase RuvB	2.09e-06	NA	NA	0.5305
6. F	A8GRW7	Holliday junction ATP-dependent DNA helicase RuvB	5.79e-06	NA	NA	0.533
6. F	A4XJS3	Holliday junction ATP-dependent DNA helicase RuvB	5.51e-06	NA	NA	0.5372
6. F	Q65GP6	Holliday junction DNA helicase RuvB	1.56e-06	NA	NA	0.4984
6. F	A9IYK5	Holliday junction ATP-dependent DNA helicase RuvB	1.44e-06	NA	NA	0.4761
6. F	B4HGG6	Spastin	1.24e-05	NA	NA	0.6366
6. F	Q83KR5	Holliday junction ATP-dependent DNA helicase RuvB	2.53e-05	NA	NA	0.5474
6. F	Q58E76	ATPase family AAA domain-containing protein 3-A	1.84e-05	NA	NA	0.7206
6. F	P61531	Holliday junction ATP-dependent DNA helicase RuvB	9.86e-07	NA	NA	0.5322
6. F	Q0SRN3	Holliday junction ATP-dependent DNA helicase RuvB	1.04e-05	NA	NA	0.5042
6. F	A5D3G1	Holliday junction ATP-dependent DNA helicase RuvB	5.04e-06	NA	NA	0.5189
6. F	Q89U80	Holliday junction ATP-dependent DNA helicase RuvB	3.05e-05	NA	NA	0.5428
6. F	B9DNE4	Holliday junction ATP-dependent DNA helicase RuvB	5.38e-08	NA	NA	0.51
6. F	A3PYW5	Holliday junction ATP-dependent DNA helicase RuvB	9.32e-07	NA	NA	0.5297
6. F	A0KPA2	Holliday junction ATP-dependent DNA helicase RuvB	2.43e-05	NA	NA	0.5561
6. F	B5F3J7	Holliday junction ATP-dependent DNA helicase RuvB	2.57e-05	NA	NA	0.533
6. F	Q8Y236	Holliday junction ATP-dependent DNA helicase RuvB	3.15e-05	NA	NA	0.5238
6. F	Q0ALX9	Holliday junction ATP-dependent DNA helicase RuvB	1.97e-06	NA	NA	0.5079
6. F	A0L4V5	Holliday junction ATP-dependent DNA helicase RuvB	3.14e-05	NA	NA	0.5461
6. F	B4QSF0	Spastin	1.30e-05	NA	NA	0.6495
6. F	B0UVK4	Holliday junction ATP-dependent DNA helicase RuvB	3.74e-06	NA	NA	0.5656
6. F	A2S594	Holliday junction ATP-dependent DNA helicase RuvB	3.08e-05	NA	NA	0.5312
6. F	A9WHF8	Holliday junction ATP-dependent DNA helicase RuvB	2.04e-05	NA	NA	0.5201
6. F	A6SUQ4	Holliday junction ATP-dependent DNA helicase RuvB	2.75e-05	NA	NA	0.5108
6. F	B9LBR4	Holliday junction ATP-dependent DNA helicase RuvB	2.06e-05	NA	NA	0.5002
6. F	B5YKE9	Holliday junction ATP-dependent DNA helicase RuvB	5.52e-07	NA	NA	0.5553
6. F	P46508	ATP-dependent zinc metalloprotease YME1 homolog	2.67e-05	NA	NA	0.546
6. F	A2RC05	Holliday junction ATP-dependent DNA helicase RuvB	1.96e-05	NA	NA	0.4932
6. F	Q87Y35	Holliday junction ATP-dependent DNA helicase RuvB	3.21e-05	NA	NA	0.5191
6. F	Q8FPK5	Holliday junction ATP-dependent DNA helicase RuvB	6.84e-06	NA	NA	0.5504
6. F	P44631	Holliday junction ATP-dependent DNA helicase RuvB	3.60e-06	NA	NA	0.5376
6. F	B2V338	Holliday junction ATP-dependent DNA helicase RuvB	1.60e-05	NA	NA	0.5609
6. F	Q6M0E9	Replication factor C large subunit	1.43e-04	NA	NA	0.6135
6. F	Q9A3G8	Holliday junction ATP-dependent DNA helicase RuvB	2.10e-06	NA	NA	0.5275
6. F	A9MND7	Holliday junction ATP-dependent DNA helicase RuvB	3.01e-05	NA	NA	0.5291
6. F	A8IMA7	Holliday junction ATP-dependent DNA helicase RuvB	3.31e-05	NA	NA	0.5412
6. F	B8GUJ4	Holliday junction ATP-dependent DNA helicase RuvB	3.13e-05	NA	NA	0.5368
6. F	B2FRN4	Holliday junction ATP-dependent DNA helicase RuvB	2.35e-05	NA	NA	0.5283
6. F	A2BTJ7	Holliday junction ATP-dependent DNA helicase RuvB	3.36e-05	NA	NA	0.5397
6. F	A7YWC4	ATPase family AAA domain-containing protein 3	1.78e-05	NA	NA	0.6969
6. F	Q20X11	Holliday junction ATP-dependent DNA helicase RuvB	3.05e-05	NA	NA	0.5431
6. F	P96115	Holliday junction ATP-dependent DNA helicase RuvB	2.87e-06	NA	NA	0.5102
6. F	B4S5I1	Holliday junction ATP-dependent DNA helicase RuvB	4.07e-06	NA	NA	0.5179
6. F	B2SGL0	Holliday junction ATP-dependent DNA helicase RuvB	2.57e-05	NA	NA	0.5347
6. F	Q1JP25	Holliday junction ATP-dependent DNA helicase RuvB	5.04e-06	NA	NA	0.5172
6. F	A4TBQ5	Holliday junction ATP-dependent DNA helicase RuvB	7.03e-07	NA	NA	0.5391
6. F	Q67Q97	Holliday junction ATP-dependent DNA helicase RuvB	3.32e-05	NA	NA	0.5351
6. F	Q03IE9	Holliday junction ATP-dependent DNA helicase RuvB	3.35e-06	NA	NA	0.5318
6. F	Q3K3X8	Holliday junction ATP-dependent DNA helicase RuvB	1.09e-05	NA	NA	0.5092
6. F	B7K9M6	Holliday junction ATP-dependent DNA helicase RuvB	4.17e-05	NA	NA	0.5283
6. F	A1ARF8	Holliday junction ATP-dependent DNA helicase RuvB	3.89e-06	NA	NA	0.5214
6. F	Q9PKZ8	Holliday junction ATP-dependent DNA helicase RuvB	9.83e-07	NA	NA	0.5268
6. F	Q5L686	Holliday junction ATP-dependent DNA helicase RuvB	9.17e-07	NA	NA	0.5381
6. F	B3WC56	Holliday junction ATP-dependent DNA helicase RuvB	5.46e-05	NA	NA	0.5663
6. F	A7NNH1	Holliday junction ATP-dependent DNA helicase RuvB	8.54e-06	NA	NA	0.5304
6. F	Q6G5R1	Holliday junction ATP-dependent DNA helicase RuvB	1.54e-06	NA	NA	0.4996
6. F	Q2A3C8	Holliday junction ATP-dependent DNA helicase RuvB	2.81e-05	NA	NA	0.5348
6. F	Q66AT9	Holliday junction ATP-dependent DNA helicase RuvB	4.14e-06	NA	NA	0.5451
6. F	Q31Q03	Holliday junction ATP-dependent DNA helicase RuvB	1.33e-05	NA	NA	0.53
6. F	A4VNA3	Holliday junction ATP-dependent DNA helicase RuvB	3.94e-05	NA	NA	0.5214
6. F	Q21HN6	Holliday junction ATP-dependent DNA helicase RuvB	2.41e-05	NA	NA	0.5362
6. F	A7Z768	Holliday junction ATP-dependent DNA helicase RuvB	1.20e-06	NA	NA	0.5504
6. F	B3QM27	Holliday junction ATP-dependent DNA helicase RuvB	7.77e-07	NA	NA	0.5263
6. F	Q5WHR5	Holliday junction ATP-dependent DNA helicase RuvB	1.21e-06	NA	NA	0.5252
6. F	P61532	Holliday junction ATP-dependent DNA helicase RuvB	1.56e-06	NA	NA	0.5221
6. F	B3EH23	Holliday junction ATP-dependent DNA helicase RuvB	1.16e-06	NA	NA	0.5567
6. F	A1U1B9	Holliday junction ATP-dependent DNA helicase RuvB	2.41e-05	NA	NA	0.5545
6. F	Q3B2F8	Holliday junction ATP-dependent DNA helicase RuvB	1.08e-06	NA	NA	0.5593
6. F	A4YMC8	Holliday junction ATP-dependent DNA helicase RuvB	2.66e-05	NA	NA	0.5388
6. F	Q3IIJ2	Holliday junction ATP-dependent DNA helicase RuvB	4.07e-06	NA	NA	0.5093
6. F	Q1QHP7	Holliday junction ATP-dependent DNA helicase RuvB	2.81e-05	NA	NA	0.549
6. F	B2AH72	Holliday junction ATP-dependent DNA helicase RuvB	2.96e-05	NA	NA	0.5211
6. F	Q3J0F8	Holliday junction ATP-dependent DNA helicase RuvB	3.55e-06	NA	NA	0.5607
6. F	A4SJ26	Holliday junction ATP-dependent DNA helicase RuvB	2.25e-05	NA	NA	0.5403
6. F	B6JKW4	Holliday junction ATP-dependent DNA helicase RuvB	5.47e-08	NA	NA	0.5677
6. F	Q6L0P4	Replication factor C large subunit	9.39e-06	NA	NA	0.5201
6. F	Q57BH8	Holliday junction ATP-dependent DNA helicase RuvB	4.95e-06	NA	NA	0.5175
6. F	Q5LXQ9	Holliday junction ATP-dependent DNA helicase RuvB	2.42e-05	NA	NA	0.5158
6. F	A6WNQ2	Holliday junction ATP-dependent DNA helicase RuvB	3.79e-06	NA	NA	0.4902
6. F	Q0IDW1	Holliday junction ATP-dependent DNA helicase RuvB	8.98e-07	NA	NA	0.521
6. F	B1JLL0	Holliday junction ATP-dependent DNA helicase RuvB	4.27e-06	NA	NA	0.5335
6. F	Q2GDJ0	Holliday junction ATP-dependent DNA helicase RuvB	6.45e-08	NA	NA	0.5039
6. F	A5V881	Holliday junction ATP-dependent DNA helicase RuvB	1.23e-06	NA	NA	0.5361
6. F	C0ZZ48	Holliday junction ATP-dependent DNA helicase RuvB	6.36e-06	NA	NA	0.4999
6. F	B7MDP4	HTH-type transcriptional regulator MalT	1.85e-02	NA	NA	0.3473
6. F	Q322E6	Holliday junction ATP-dependent DNA helicase RuvB	2.30e-05	NA	NA	0.4911
6. F	Q1I6E9	Holliday junction ATP-dependent DNA helicase RuvB	3.16e-05	NA	NA	0.5244
6. F	Q92BI2	Holliday junction ATP-dependent DNA helicase RuvB	2.16e-05	NA	NA	0.534
6. F	A8GN97	Holliday junction ATP-dependent DNA helicase RuvB	6.43e-06	NA	NA	0.5506
6. F	Q0BI83	Holliday junction ATP-dependent DNA helicase RuvB	3.11e-05	NA	NA	0.5347
6. F	A7GHT8	Holliday junction ATP-dependent DNA helicase RuvB	3.20e-06	NA	NA	0.4741
6. F	A8EVP9	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-06	NA	NA	0.5589
6. F	P61538	Holliday junction ATP-dependent DNA helicase RuvB	1.02e-06	NA	NA	0.5193
6. F	Q2GHE3	Holliday junction ATP-dependent DNA helicase RuvB	5.49e-07	NA	NA	0.5396
6. F	A7GZP9	Holliday junction ATP-dependent DNA helicase RuvB	5.98e-08	NA	NA	0.5097
6. F	Q40460	Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic	2.32e-04	NA	NA	0.4683
6. F	Q0A4X0	Holliday junction ATP-dependent DNA helicase RuvB	2.84e-05	NA	NA	0.5415
6. F	P61537	Holliday junction ATP-dependent DNA helicase RuvB	1.92e-06	NA	NA	0.5631
6. F	A5ERJ9	Holliday junction ATP-dependent DNA helicase RuvB	2.72e-05	NA	NA	0.53
6. F	B9MRB3	Holliday junction ATP-dependent DNA helicase RuvB	5.86e-06	NA	NA	0.5362
6. F	B1YJR1	Holliday junction ATP-dependent DNA helicase RuvB	5.06e-06	NA	NA	0.5171
6. F	A1WZ65	Holliday junction ATP-dependent DNA helicase RuvB	3.73e-05	NA	NA	0.5426
6. F	Q2YRD2	Holliday junction ATP-dependent DNA helicase RuvB	1.30e-06	NA	NA	0.5171
6. F	A1WQ68	Holliday junction ATP-dependent DNA helicase RuvB	2.63e-05	NA	NA	0.5393
6. F	Q93LP2	Holliday junction ATP-dependent DNA helicase RuvB	3.18e-05	NA	NA	0.5093
6. F	A4SG11	Holliday junction ATP-dependent DNA helicase RuvB	7.09e-07	NA	NA	0.5137
6. F	A7MEA3	Holliday junction ATP-dependent DNA helicase RuvB	4.95e-06	NA	NA	0.5655
6. F	A5I6F1	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-06	NA	NA	0.4736
6. F	Q8EPQ6	Holliday junction ATP-dependent DNA helicase RuvB	7.02e-07	NA	NA	0.5442
6. F	A5VZU7	Holliday junction ATP-dependent DNA helicase RuvB	3.15e-05	NA	NA	0.5208
6. F	Q5SL87	Holliday junction ATP-dependent DNA helicase RuvB	6.33e-08	NA	NA	0.5614
6. F	B2UFL1	Holliday junction ATP-dependent DNA helicase RuvB	3.20e-05	NA	NA	0.4887
6. F	Q97GT1	Holliday junction ATP-dependent DNA helicase RuvB	3.72e-05	NA	NA	0.5254
6. F	A6QHI3	Holliday junction ATP-dependent DNA helicase RuvB	5.16e-08	NA	NA	0.5034
6. F	C4L523	Holliday junction ATP-dependent DNA helicase RuvB	6.26e-08	NA	NA	0.4795
6. F	C4K2D4	Holliday junction ATP-dependent DNA helicase RuvB	5.26e-06	NA	NA	0.5416
6. F	A0RJ26	Holliday junction ATP-dependent DNA helicase RuvB	2.33e-05	NA	NA	0.4804
6. F	P61530	Holliday junction ATP-dependent DNA helicase RuvB	1.03e-06	NA	NA	0.4846
6. F	Q820F3	Holliday junction ATP-dependent DNA helicase RuvB	8.14e-07	NA	NA	0.5061
6. F	Q6D4A2	Holliday junction ATP-dependent DNA helicase RuvB	3.67e-06	NA	NA	0.5547
6. F	Q39XN6	Holliday junction ATP-dependent DNA helicase RuvB	7.34e-06	NA	NA	0.54
6. F	C1DRF8	Holliday junction ATP-dependent DNA helicase RuvB	3.16e-05	NA	NA	0.5365
6. F	C0MC84	Holliday junction ATP-dependent DNA helicase RuvB	1.62e-05	NA	NA	0.4798
6. F	P66754	Holliday junction ATP-dependent DNA helicase RuvB	7.27e-07	NA	NA	0.5342
6. F	A4QEN3	Holliday junction ATP-dependent DNA helicase RuvB	1.01e-06	NA	NA	0.4818
6. F	Q5PIA7	Holliday junction ATP-dependent DNA helicase RuvB	2.53e-05	NA	NA	0.5326
6. F	A5UVZ9	Holliday junction ATP-dependent DNA helicase RuvB	4.33e-05	NA	NA	0.5309
6. F	A3MP72	Holliday junction ATP-dependent DNA helicase RuvB	2.91e-05	NA	NA	0.5319
6. F	Q1GWB6	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-06	NA	NA	0.5429
6. F	Q4A6N6	Holliday junction ATP-dependent DNA helicase RuvB	1.31e-06	NA	NA	0.5172
6. F	B9KKV4	Holliday junction ATP-dependent DNA helicase RuvB	1.56e-06	NA	NA	0.5583
6. F	Q4K7D9	Holliday junction ATP-dependent DNA helicase RuvB	3.39e-05	NA	NA	0.5275
6. F	C0ZLE1	Chromosomal replication initiator protein DnaA	1.71e-04	NA	NA	0.4876
6. F	A0JXB1	Holliday junction ATP-dependent DNA helicase RuvB	1.04e-06	NA	NA	0.5423
6. F	A1V064	Holliday junction ATP-dependent DNA helicase RuvB	2.92e-05	NA	NA	0.5321
6. F	O64981	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	1.24e-04	NA	NA	0.4853
6. F	Q4ZWL1	Holliday junction ATP-dependent DNA helicase RuvB	3.14e-05	NA	NA	0.5218
6. F	Q2SZ55	Holliday junction ATP-dependent DNA helicase RuvB	2.94e-05	NA	NA	0.532
6. F	B3QHS4	Holliday junction ATP-dependent DNA helicase RuvB	2.54e-05	NA	NA	0.5484
6. F	A5EXH6	Holliday junction ATP-dependent DNA helicase RuvB	1.86e-05	NA	NA	0.53
6. F	Q1JE69	Holliday junction ATP-dependent DNA helicase RuvB	2.10e-05	NA	NA	0.4854
6. F	B5XJ28	Holliday junction ATP-dependent DNA helicase RuvB	1.91e-05	NA	NA	0.4921
6. F	Q40281	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	1.33e-04	NA	NA	0.4642
6. F	A6UWR5	Replication factor C large subunit	1.94e-04	NA	NA	0.5474
6. F	A1K313	Holliday junction ATP-dependent DNA helicase RuvB	2.86e-05	NA	NA	0.52
6. F	A0LGY6	Holliday junction ATP-dependent DNA helicase RuvB	2.48e-05	NA	NA	0.5318
6. F	B5ZBT5	Holliday junction ATP-dependent DNA helicase RuvB	3.34e-06	NA	NA	0.5578
6. F	Q3Z8V1	Holliday junction ATP-dependent DNA helicase RuvB	4.68e-06	NA	NA	0.5292
6. F	Q0T3U6	Holliday junction ATP-dependent DNA helicase RuvB	2.87e-05	NA	NA	0.4894
6. F	A0QWH6	Holliday junction ATP-dependent DNA helicase RuvB	5.28e-06	NA	NA	0.5609
6. F	B2S7D9	Holliday junction ATP-dependent DNA helicase RuvB	3.27e-05	NA	NA	0.5132
6. F	B5YR05	Holliday junction ATP-dependent DNA helicase RuvB	2.39e-05	NA	NA	0.4763
6. F	A5FRK7	Holliday junction ATP-dependent DNA helicase RuvB	5.42e-06	NA	NA	0.5245
6. F	B2HN63	Holliday junction ATP-dependent DNA helicase RuvB	9.53e-07	NA	NA	0.5482
6. F	Q8F7Y2	Holliday junction ATP-dependent DNA helicase RuvB	5.56e-06	NA	NA	0.5072
6. F	A1VC44	Holliday junction ATP-dependent DNA helicase RuvB	1.03e-06	NA	NA	0.5321
6. F	P37540	DNA polymerase III subunit delta'	2.47e-04	NA	NA	0.4158
6. F	C3L6U9	Holliday junction ATP-dependent DNA helicase RuvB	2.10e-05	NA	NA	0.4832
6. F	Q3Z2L8	Holliday junction ATP-dependent DNA helicase RuvB	2.01e-06	NA	NA	0.488
6. F	Q1JJ71	Holliday junction ATP-dependent DNA helicase RuvB	1.65e-05	NA	NA	0.4926
6. F	A4WRX0	Holliday junction ATP-dependent DNA helicase RuvB	3.76e-06	NA	NA	0.5607
6. F	B7UXW5	Holliday junction ATP-dependent DNA helicase RuvB	3.17e-05	NA	NA	0.5425
6. F	C0M7R2	Holliday junction ATP-dependent DNA helicase RuvB	7.91e-07	NA	NA	0.4745
6. F	Q5N474	Holliday junction ATP-dependent DNA helicase RuvB	2.93e-06	NA	NA	0.5277
6. F	Q5QYU5	Holliday junction ATP-dependent DNA helicase RuvB	5.20e-06	NA	NA	0.4874
6. F	Q318C6	Holliday junction ATP-dependent DNA helicase RuvB	1.43e-06	NA	NA	0.5369
6. F	A5F760	Holliday junction ATP-dependent DNA helicase RuvB	4.89e-06	NA	NA	0.5281
6. F	B1XHC8	Holliday junction ATP-dependent DNA helicase RuvB	2.12e-05	NA	NA	0.532
6. F	Q4A9R6	Holliday junction ATP-dependent DNA helicase RuvB	2.50e-08	NA	NA	0.5085
6. F	A5FJE5	Holliday junction ATP-dependent DNA helicase RuvB	5.58e-07	NA	NA	0.5173
6. F	Q8RAN2	Holliday junction ATP-dependent DNA helicase RuvB	2.37e-05	NA	NA	0.4905
6. F	A8GFI7	Holliday junction ATP-dependent DNA helicase RuvB	4.14e-06	NA	NA	0.5353
6. F	Q3JES3	Holliday junction ATP-dependent DNA helicase RuvB	5.10e-06	NA	NA	0.5601
6. F	B4EES7	Holliday junction ATP-dependent DNA helicase RuvB	3.07e-05	NA	NA	0.5312
6. F	P61528	Holliday junction ATP-dependent DNA helicase RuvB	2.86e-05	NA	NA	0.4815
6. F	B4TYR7	Holliday junction ATP-dependent DNA helicase RuvB	4.73e-06	NA	NA	0.5269
6. F	Q2TBV1	Replication factor C subunit 3	6.77e-05	NA	NA	0.3983
6. F	B0RPY7	Holliday junction ATP-dependent DNA helicase RuvB	1.91e-05	NA	NA	0.532
6. F	Q07H98	Holliday junction ATP-dependent DNA helicase RuvB	2.58e-05	NA	NA	0.5331
6. F	B3CMH5	Holliday junction ATP-dependent DNA helicase RuvB	3.80e-07	NA	NA	0.5633
6. F	C6E1S8	Holliday junction ATP-dependent DNA helicase RuvB	7.15e-06	NA	NA	0.5384
6. F	A4FZL6	Replication factor C large subunit	1.25e-04	NA	NA	0.5247
6. F	A5GQ68	Holliday junction ATP-dependent DNA helicase RuvB	1.82e-06	NA	NA	0.5134
6. F	Q4QNM6	Holliday junction ATP-dependent DNA helicase RuvB	3.68e-06	NA	NA	0.5362
6. F	B1LD11	Holliday junction ATP-dependent DNA helicase RuvB	2.66e-05	NA	NA	0.5487
6. F	A0LUK5	Holliday junction ATP-dependent DNA helicase RuvB	4.00e-07	NA	NA	0.4855
6. F	A6VXD3	Holliday junction ATP-dependent DNA helicase RuvB	4.62e-06	NA	NA	0.574
6. F	B9E5Q8	Holliday junction ATP-dependent DNA helicase RuvB	5.10e-06	NA	NA	0.4871
6. F	B8G5S6	Holliday junction ATP-dependent DNA helicase RuvB	3.95e-06	NA	NA	0.509
6. F	B5FSN8	Holliday junction ATP-dependent DNA helicase RuvB	2.46e-05	NA	NA	0.5318
6. F	Q0HIZ1	Holliday junction ATP-dependent DNA helicase RuvB	4.50e-06	NA	NA	0.5273
6. F	Q2EEX7	ATP-dependent zinc metalloprotease FtsH homolog	3.04e-02	NA	NA	0.5165
6. F	P58555	Ribulose bisphosphate carboxylase/oxygenase activase	1.59e-05	NA	NA	0.5072
6. F	P09122	DNA polymerase III subunit gamma/tau	1.31e-05	NA	NA	0.5132
6. F	C6DFF2	Holliday junction ATP-dependent DNA helicase RuvB	4.19e-06	NA	NA	0.5501
6. F	Q92I87	Holliday junction ATP-dependent DNA helicase RuvB	5.65e-06	NA	NA	0.5365
6. F	B7IIT2	Holliday junction ATP-dependent DNA helicase RuvB	1.48e-06	NA	NA	0.5047
6. F	Q048Y7	Holliday junction ATP-dependent DNA helicase RuvB	3.56e-07	NA	NA	0.5494
6. F	A5CS06	Holliday junction ATP-dependent DNA helicase RuvB	6.24e-07	NA	NA	0.5451
6. F	Q0S1C6	Holliday junction ATP-dependent DNA helicase RuvB	1.26e-06	NA	NA	0.4884
6. F	Q01587	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	3.61e-04	NA	NA	0.4747
6. F	B2HWT3	Holliday junction ATP-dependent DNA helicase RuvB	1.28e-06	NA	NA	0.5311
6. F	Q6AFB4	Holliday junction ATP-dependent DNA helicase RuvB	4.09e-07	NA	NA	0.5178
6. F	Q9KR02	Holliday junction ATP-dependent DNA helicase RuvB	1.25e-05	NA	NA	0.5227
6. F	B9LZC4	Holliday junction ATP-dependent DNA helicase RuvB	4.76e-06	NA	NA	0.5433
6. F	A7FY19	Holliday junction ATP-dependent DNA helicase RuvB	3.04e-06	NA	NA	0.4747
6. F	C0R250	Holliday junction ATP-dependent DNA helicase RuvB	1.91e-06	NA	NA	0.5672
6. F	B2UPI9	Holliday junction ATP-dependent DNA helicase RuvB	1.69e-06	NA	NA	0.5134
6. F	Q6MC67	Holliday junction ATP-dependent DNA helicase RuvB	2.82e-05	NA	NA	0.4965
6. F	B1XMA0	Holliday junction ATP-dependent DNA helicase RuvB	6.07e-05	NA	NA	0.5377
6. F	A4IRB2	Holliday junction ATP-dependent DNA helicase RuvB	2.33e-05	NA	NA	0.497
6. F	Q2N814	Holliday junction ATP-dependent DNA helicase RuvB	5.71e-08	NA	NA	0.5653
6. F	Q39JJ1	Holliday junction ATP-dependent DNA helicase RuvB	3.03e-05	NA	NA	0.5317
6. F	B0U2E3	Holliday junction ATP-dependent DNA helicase RuvB	1.93e-05	NA	NA	0.5353
6. F	Q1C814	Holliday junction ATP-dependent DNA helicase RuvB	4.10e-06	NA	NA	0.5349
6. F	C5CIU4	Holliday junction ATP-dependent DNA helicase RuvB	3.86e-06	NA	NA	0.5023
6. F	B9IYZ4	Holliday junction ATP-dependent DNA helicase RuvB	4.76e-06	NA	NA	0.5028
6. F	B0K956	Holliday junction ATP-dependent DNA helicase RuvB	2.26e-05	NA	NA	0.4966
6. F	P39143	Transcription activator GutR	6.63e-03	NA	NA	0.3591
6. F	A7X357	Holliday junction ATP-dependent DNA helicase RuvB	5.13e-08	NA	NA	0.5034
6. F	Q13UC0	Holliday junction ATP-dependent DNA helicase RuvB	6.54e-05	NA	NA	0.5248
6. F	B7GR18	Holliday junction ATP-dependent DNA helicase RuvB	1.89e-05	NA	NA	0.5401
6. F	A8EZ44	Holliday junction ATP-dependent DNA helicase RuvB	6.14e-06	NA	NA	0.5449
6. F	Q30PX6	Holliday junction ATP-dependent DNA helicase RuvB	2.36e-06	NA	NA	0.5659
6. F	Q9PC79	Holliday junction ATP-dependent DNA helicase RuvB	2.01e-05	NA	NA	0.5355
6. F	B7M2F1	Holliday junction ATP-dependent DNA helicase RuvB	2.45e-05	NA	NA	0.5467
6. F	Q8ZEU5	Holliday junction ATP-dependent DNA helicase RuvB	4.21e-06	NA	NA	0.5415
6. F	Q8DGR1	Holliday junction ATP-dependent DNA helicase RuvB	3.69e-06	NA	NA	0.5222
6. F	Q6NVR9	ATPase family AAA domain-containing protein 3	4.43e-05	NA	NA	0.6769
6. F	Q2GLG1	Holliday junction ATP-dependent DNA helicase RuvB	4.42e-07	NA	NA	0.5552
6. F	A0JWY3	Proteasome-associated ATPase	3.97e-04	NA	NA	0.4814
6. F	Q04YY5	Holliday junction ATP-dependent DNA helicase RuvB	1.05e-06	NA	NA	0.5588
6. F	B8ZUI2	Holliday junction ATP-dependent DNA helicase RuvB	7.03e-07	NA	NA	0.5349
6. F	Q0RNU6	Holliday junction ATP-dependent DNA helicase RuvB	9.28e-07	NA	NA	0.557
6. F	A5ITG5	Holliday junction ATP-dependent DNA helicase RuvB	4.10e-07	NA	NA	0.5151
6. F	A1KLU0	Holliday junction ATP-dependent DNA helicase RuvB	8.95e-07	NA	NA	0.5348
6. F	Q0SAG7	Chromosomal replication initiator protein DnaA	1.83e-03	NA	NA	0.5013
6. F	B3PYZ5	Holliday junction ATP-dependent DNA helicase RuvB	9.67e-07	NA	NA	0.5468
6. F	A3MZ06	Holliday junction ATP-dependent DNA helicase RuvB	2.04e-05	NA	NA	0.5657
6. F	Q9AE09	Holliday junction ATP-dependent DNA helicase RuvB	8.93e-07	NA	NA	0.4896
6. F	Q30YX7	Holliday junction ATP-dependent DNA helicase RuvB	3.57e-06	NA	NA	0.5651
6. F	A0AIY1	Holliday junction ATP-dependent DNA helicase RuvB	2.13e-05	NA	NA	0.525
6. F	Q02AG6	Holliday junction ATP-dependent DNA helicase RuvB	2.14e-06	NA	NA	0.5351
6. F	A7H1X6	Holliday junction ATP-dependent DNA helicase RuvB	4.79e-08	NA	NA	0.5336
6. F	Q2GBA2	Holliday junction ATP-dependent DNA helicase RuvB	1.07e-06	NA	NA	0.5455
6. F	A8F5R0	Holliday junction ATP-dependent DNA helicase RuvB	4.07e-06	NA	NA	0.5225
6. F	P63976	DNA polymerase III subunit gamma/tau	2.77e-05	NA	NA	0.4656
6. F	Q6LT48	Holliday junction ATP-dependent DNA helicase RuvB	4.48e-06	NA	NA	0.5216
6. F	A7I1C5	Holliday junction ATP-dependent DNA helicase RuvB	4.51e-08	NA	NA	0.5102
6. F	A7HUZ8	Holliday junction ATP-dependent DNA helicase RuvB	5.06e-06	NA	NA	0.5276
6. F	Q51426	Holliday junction ATP-dependent DNA helicase RuvB	3.23e-05	NA	NA	0.5218
6. F	Q56214	Holliday junction ATP-dependent DNA helicase RuvB	6.52e-08	NA	NA	0.5428
6. F	B1JVV3	Holliday junction ATP-dependent DNA helicase RuvB	3.09e-05	NA	NA	0.5163
6. F	Q130V3	Holliday junction ATP-dependent DNA helicase RuvB	2.84e-05	NA	NA	0.5303
6. F	O84044	Holliday junction ATP-dependent DNA helicase RuvB	1.05e-06	NA	NA	0.5376
6. F	Q5NR72	Holliday junction ATP-dependent DNA helicase RuvB	1.39e-06	NA	NA	0.5327
6. F	A6H1G3	Holliday junction ATP-dependent DNA helicase RuvB	4.82e-07	NA	NA	0.5151
6. F	Q6G8S8	Holliday junction ATP-dependent DNA helicase RuvB	4.81e-08	NA	NA	0.5034
6. F	Q87QU7	Holliday junction ATP-dependent DNA helicase RuvB	2.42e-05	NA	NA	0.5218
6. F	Q48FC5	Holliday junction ATP-dependent DNA helicase RuvB	3.09e-05	NA	NA	0.5243
6. F	B4PL32	Spastin	1.89e-05	NA	NA	0.6415
6. F	Q7VKV5	Holliday junction ATP-dependent DNA helicase RuvB	1.85e-05	NA	NA	0.535
6. F	B0JY77	Holliday junction ATP-dependent DNA helicase RuvB	3.29e-06	NA	NA	0.4867
6. F	C0Q2F5	Holliday junction ATP-dependent DNA helicase RuvB	2.29e-05	NA	NA	0.5322
6. F	Q3B0J1	Holliday junction ATP-dependent DNA helicase RuvB	1.40e-06	NA	NA	0.5582
6. F	A6WY76	Holliday junction ATP-dependent DNA helicase RuvB	2.83e-05	NA	NA	0.5012
6. F	C1AF61	Holliday junction ATP-dependent DNA helicase RuvB	7.81e-07	NA	NA	0.5476
6. F	B4U5F8	Holliday junction ATP-dependent DNA helicase RuvB	1.79e-05	NA	NA	0.478
6. F	B2G6E8	Holliday junction ATP-dependent DNA helicase RuvB	7.47e-06	NA	NA	0.5119
6. F	Q609L0	Holliday junction ATP-dependent DNA helicase RuvB	2.07e-05	NA	NA	0.5384
6. F	O69170	DNA polymerase III subunit delta'	1.18e-04	NA	NA	0.4459
6. F	A6LTM7	Holliday junction ATP-dependent DNA helicase RuvB	1.96e-05	NA	NA	0.5345
6. F	A9AH73	Holliday junction ATP-dependent DNA helicase RuvB	3.10e-05	NA	NA	0.5324
6. F	Q4UXL7	Holliday junction ATP-dependent DNA helicase RuvB	1.90e-05	NA	NA	0.5297
6. F	A7I4H6	Holliday junction ATP-dependent DNA helicase RuvB	3.63e-05	NA	NA	0.522
6. F	B0U0B6	Holliday junction ATP-dependent DNA helicase RuvB	2.45e-05	NA	NA	0.5242
6. F	B1WP72	Holliday junction ATP-dependent DNA helicase RuvB	7.47e-06	NA	NA	0.4481
6. F	C5B9T2	Holliday junction ATP-dependent DNA helicase RuvB	4.60e-06	NA	NA	0.5443
6. F	A5UAH8	Holliday junction ATP-dependent DNA helicase RuvB	3.90e-06	NA	NA	0.5369
6. F	Q2IS53	Holliday junction ATP-dependent DNA helicase RuvB	2.67e-05	NA	NA	0.5322
6. F	A7ZEM1	Holliday junction ATP-dependent DNA helicase RuvB	5.45e-08	NA	NA	0.5007
6. F	Q0I1M3	Holliday junction ATP-dependent DNA helicase RuvB	3.71e-06	NA	NA	0.5606
6. F	P40833	Holliday junction ATP-dependent DNA helicase RuvB	6.36e-07	NA	NA	0.5514
6. F	B5ZP80	Holliday junction ATP-dependent DNA helicase RuvB	1.04e-06	NA	NA	0.5486
6. F	Q3ABY0	Holliday junction ATP-dependent DNA helicase RuvB	1.89e-06	NA	NA	0.502
6. F	Q8G6B7	Holliday junction ATP-dependent DNA helicase RuvB	8.71e-08	NA	NA	0.4932
6. F	Q7NGP9	Holliday junction ATP-dependent DNA helicase RuvB	1.70e-05	NA	NA	0.5436
6. F	Q8PHV2	Holliday junction ATP-dependent DNA helicase RuvB	1.94e-05	NA	NA	0.5301
6. F	B8DHL6	Holliday junction ATP-dependent DNA helicase RuvB	2.14e-05	NA	NA	0.5348
6. F	A7HJD6	Holliday junction ATP-dependent DNA helicase RuvB	7.62e-07	NA	NA	0.5008
6. F	Q1MC52	Holliday junction ATP-dependent DNA helicase RuvB	1.12e-06	NA	NA	0.5507
6. F	Q5HFC2	Holliday junction ATP-dependent DNA helicase RuvB	5.10e-08	NA	NA	0.5032
6. F	P85190	ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment)	9.37e-08	NA	NA	0.6986
6. F	B8FQV5	Holliday junction ATP-dependent DNA helicase RuvB	2.46e-05	NA	NA	0.4999
6. F	B1YTD9	Holliday junction ATP-dependent DNA helicase RuvB	3.09e-05	NA	NA	0.531
6. F	A0PZV4	Holliday junction ATP-dependent DNA helicase RuvB	1.50e-06	NA	NA	0.4907
6. F	B4SDZ7	Holliday junction ATP-dependent DNA helicase RuvB	8.43e-07	NA	NA	0.5627
6. F	Q7M879	Holliday junction ATP-dependent DNA helicase RuvB	1.30e-06	NA	NA	0.5558
6. F	B5EAH3	Holliday junction ATP-dependent DNA helicase RuvB	7.49e-06	NA	NA	0.5329
6. F	Q7MJ78	Holliday junction ATP-dependent DNA helicase RuvB	2.60e-05	NA	NA	0.5491
6. F	B4ST32	Holliday junction ATP-dependent DNA helicase RuvB	2.84e-05	NA	NA	0.5333
6. F	A1JRJ5	Holliday junction ATP-dependent DNA helicase RuvB	4.35e-06	NA	NA	0.5571
6. F	B0BB27	Holliday junction ATP-dependent DNA helicase RuvB	1.03e-06	NA	NA	0.5244
6. F	A3M7W1	Holliday junction ATP-dependent DNA helicase RuvB	7.57e-06	NA	NA	0.529
6. F	O98997	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	1.85e-04	NA	NA	0.457
6. F	B7L7R3	Holliday junction ATP-dependent DNA helicase RuvB	2.13e-05	NA	NA	0.5299
6. F	B3DRY0	Holliday junction ATP-dependent DNA helicase RuvB	5.46e-06	NA	NA	0.547
6. F	Q5HAK4	Holliday junction ATP-dependent DNA helicase RuvB	8.38e-07	NA	NA	0.5253
6. F	Q7UPG4	Holliday junction ATP-dependent DNA helicase RuvB	1.73e-05	NA	NA	0.4916
6. F	A8GWC4	Holliday junction ATP-dependent DNA helicase RuvB	7.25e-06	NA	NA	0.5155
6. F	C0ZAN4	Holliday junction ATP-dependent DNA helicase RuvB	1.13e-06	NA	NA	0.5464
6. F	Q2RHT7	Holliday junction ATP-dependent DNA helicase RuvB	2.31e-05	NA	NA	0.5306
6. F	P56369	ATP-dependent zinc metalloprotease FtsH homolog	3.03e-02	NA	NA	0.5545
6. F	A5N206	Holliday junction ATP-dependent DNA helicase RuvB	4.93e-06	NA	NA	0.4662
6. F	Q92M92	Holliday junction ATP-dependent DNA helicase RuvB	1.07e-06	NA	NA	0.5299
6. F	A8KZE6	Holliday junction ATP-dependent DNA helicase RuvB	7.11e-07	NA	NA	0.5352
6. F	A5CEJ6	Holliday junction ATP-dependent DNA helicase RuvB	2.51e-08	NA	NA	0.5179
6. F	Q3KMY1	Holliday junction ATP-dependent DNA helicase RuvB	1.06e-06	NA	NA	0.5262
6. F	A9QGV6	Inactive disease susceptibility protein LOV1	1.40e-02	NA	NA	0.3842
6. F	Q71ZD8	Holliday junction ATP-dependent DNA helicase RuvB	2.11e-05	NA	NA	0.5359
6. F	B2VJ95	Holliday junction ATP-dependent DNA helicase RuvB	4.19e-06	NA	NA	0.5491
6. F	P61533	Holliday junction ATP-dependent DNA helicase RuvB	7.59e-07	NA	NA	0.5108
6. F	Q9Z8F3	Holliday junction ATP-dependent DNA helicase RuvB	7.50e-07	NA	NA	0.5251
6. F	Q2K4J8	Holliday junction ATP-dependent DNA helicase RuvB	1.32e-06	NA	NA	0.5355
6. F	Q5FG39	Holliday junction ATP-dependent DNA helicase RuvB	8.55e-07	NA	NA	0.5255
6. F	Q83HN0	Holliday junction ATP-dependent DNA helicase RuvB	6.12e-07	NA	NA	0.5555
6. F	A4TJK0	Holliday junction ATP-dependent DNA helicase RuvB	3.85e-06	NA	NA	0.5364
6. F	Q7MWU9	Holliday junction DNA helicase RuvB	2.23e-06	NA	NA	0.5324
6. F	Q1J924	Holliday junction ATP-dependent DNA helicase RuvB	1.78e-05	NA	NA	0.5308
6. F	Q4A7W4	Holliday junction ATP-dependent DNA helicase RuvB	2.58e-08	NA	NA	0.5086
6. F	C3PNA6	Holliday junction ATP-dependent DNA helicase RuvB	5.58e-06	NA	NA	0.5332
6. F	O25699	Holliday junction ATP-dependent DNA helicase RuvB	3.27e-06	NA	NA	0.5343
6. F	Q2SCL3	Holliday junction ATP-dependent DNA helicase RuvB	2.94e-05	NA	NA	0.5465
6. F	B0VT89	Holliday junction ATP-dependent DNA helicase RuvB	4.94e-06	NA	NA	0.5294
6. F	A0QIB7	Holliday junction ATP-dependent DNA helicase RuvB	8.41e-07	NA	NA	0.5364
6. F	Q98PR1	Holliday junction ATP-dependent DNA helicase RuvB	3.20e-08	NA	NA	0.5391
6. F	A9MUX4	Holliday junction ATP-dependent DNA helicase RuvB	2.52e-05	NA	NA	0.5259
6. F	Q0KEC4	Holliday junction ATP-dependent DNA helicase RuvB	2.84e-05	NA	NA	0.5237
6. F	A3NDF6	Holliday junction ATP-dependent DNA helicase RuvB	2.92e-05	NA	NA	0.5317
6. F	B7NBL1	Holliday junction ATP-dependent DNA helicase RuvB	2.15e-05	NA	NA	0.5292
6. F	Q817W4	Holliday junction ATP-dependent DNA helicase RuvB	2.35e-05	NA	NA	0.4988
6. F	Q62HA9	Holliday junction ATP-dependent DNA helicase RuvB	3.18e-05	NA	NA	0.5322
6. F	C1B7S7	Chromosomal replication initiator protein DnaA	3.65e-04	NA	NA	0.5053
6. F	A2SHH9	ATP-dependent zinc metalloprotease FtsH	4.34e-05	NA	NA	0.6213
6. F	B2TWQ1	Holliday junction ATP-dependent DNA helicase RuvB	2.55e-05	NA	NA	0.5385
6. F	B1L0B2	Holliday junction ATP-dependent DNA helicase RuvB	4.49e-06	NA	NA	0.4762
6. F	B8H9D6	Holliday junction ATP-dependent DNA helicase RuvB	9.45e-07	NA	NA	0.5056
6. F	A3PLU2	Holliday junction ATP-dependent DNA helicase RuvB	3.48e-06	NA	NA	0.5609
6. F	A6UCT7	Holliday junction ATP-dependent DNA helicase RuvB	1.25e-06	NA	NA	0.557
6. F	Q0TGX2	Holliday junction ATP-dependent DNA helicase RuvB	1.87e-06	NA	NA	0.4779
6. F	P66758	Holliday junction ATP-dependent DNA helicase RuvB	4.76e-08	NA	NA	0.5115
6. F	Q1GE13	Holliday junction ATP-dependent DNA helicase RuvB	1.11e-06	NA	NA	0.5159
6. F	B9KZ09	Holliday junction ATP-dependent DNA helicase RuvB	2.85e-05	NA	NA	0.5356
6. F	B7HQH9	Holliday junction ATP-dependent DNA helicase RuvB	2.18e-05	NA	NA	0.5053
6. F	Q8FZ02	Holliday junction ATP-dependent DNA helicase RuvB	3.05e-05	NA	NA	0.5183
6. F	B9JRX1	Holliday junction ATP-dependent DNA helicase RuvB	1.14e-06	NA	NA	0.5362
6. F	Q634C4	Holliday junction ATP-dependent DNA helicase RuvB	4.93e-06	NA	NA	0.4815
6. F	Q11DH7	Holliday junction ATP-dependent DNA helicase RuvB	1.02e-06	NA	NA	0.532
6. F	B4SVE4	Holliday junction ATP-dependent DNA helicase RuvB	2.40e-05	NA	NA	0.5299
6. F	Q3BQF5	Holliday junction ATP-dependent DNA helicase RuvB	1.96e-05	NA	NA	0.5296
6. F	Q87D00	Holliday junction ATP-dependent DNA helicase RuvB	2.26e-05	NA	NA	0.5348
6. F	A4XRS1	Holliday junction ATP-dependent DNA helicase RuvB	2.45e-05	NA	NA	0.5189
6. F	A7FIC5	Holliday junction ATP-dependent DNA helicase RuvB	4.07e-06	NA	NA	0.5479
6. F	P75177	DNA polymerase III subunit gamma/tau	4.23e-03	NA	NA	0.4367
6. F	A4VSD3	Holliday junction ATP-dependent DNA helicase RuvB	1.68e-05	NA	NA	0.5116
6. F	B9KDF4	Holliday junction ATP-dependent DNA helicase RuvB	5.13e-08	NA	NA	0.5152
6. F	B6EGJ4	Holliday junction ATP-dependent DNA helicase RuvB	2.83e-05	NA	NA	0.5412
6. F	Q2W2A5	Holliday junction ATP-dependent DNA helicase RuvB	1.48e-05	NA	NA	0.5391
6. F	A7NCA9	Holliday junction ATP-dependent DNA helicase RuvB	2.86e-05	NA	NA	0.5305
6. F	Q49425	Holliday junction ATP-dependent DNA helicase RuvB	5.04e-08	NA	NA	0.5026
6. F	Q1RHZ9	Holliday junction ATP-dependent DNA helicase RuvB	6.39e-06	NA	NA	0.5112
6. F	A1AZW1	Holliday junction ATP-dependent DNA helicase RuvB	4.26e-06	NA	NA	0.5363
6. F	Q5YTE8	Holliday junction ATP-dependent DNA helicase RuvB	7.69e-07	NA	NA	0.5378
6. F	B1IMF3	Holliday junction ATP-dependent DNA helicase RuvB	1.41e-06	NA	NA	0.4721
6. F	Q9ZDE5	Holliday junction ATP-dependent DNA helicase RuvB	5.06e-06	NA	NA	0.4931
6. F	Q5XEE4	Holliday junction ATP-dependent DNA helicase RuvB	2.05e-05	NA	NA	0.4939
6. F	Q2Y5G5	Holliday junction ATP-dependent DNA helicase RuvB	2.81e-05	NA	NA	0.4826
6. F	Q6F991	Holliday junction ATP-dependent DNA helicase RuvB	3.67e-05	NA	NA	0.5251
6. F	Q32HA1	Holliday junction ATP-dependent DNA helicase RuvB	2.03e-05	NA	NA	0.5241
6. F	Q081N9	Holliday junction ATP-dependent DNA helicase RuvB	7.84e-07	NA	NA	0.5335
6. F	B4ETP8	Holliday junction ATP-dependent DNA helicase RuvB	4.88e-06	NA	NA	0.5533
6. F	P61535	Holliday junction ATP-dependent DNA helicase RuvB	8.36e-07	NA	NA	0.5201
6. F	B7MBR9	Holliday junction ATP-dependent DNA helicase RuvB	2.50e-05	NA	NA	0.4866
6. F	Q254B4	Holliday junction ATP-dependent DNA helicase RuvB	9.23e-07	NA	NA	0.5199
6. F	Q600N3	Holliday junction ATP-dependent DNA helicase RuvB	2.70e-08	NA	NA	0.532
6. F	B7I5A9	Holliday junction ATP-dependent DNA helicase RuvB	6.70e-06	NA	NA	0.5308
6. F	A4FBA8	Holliday junction ATP-dependent DNA helicase RuvB	4.07e-07	NA	NA	0.5357
6. F	Q1IHV6	Holliday junction ATP-dependent DNA helicase RuvB	5.28e-06	NA	NA	0.461
6. F	A6Q1X7	Holliday junction ATP-dependent DNA helicase RuvB	5.35e-08	NA	NA	0.5142
6. F	Q1B9Q9	Holliday junction ATP-dependent DNA helicase RuvB	9.09e-07	NA	NA	0.5278
6. F	P66755	Holliday junction ATP-dependent DNA helicase RuvB	4.71e-06	NA	NA	0.5274
6. F	Q7VTT6	Holliday junction ATP-dependent DNA helicase RuvB	3.43e-05	NA	NA	0.5477
6. F	Q9CDL3	Holliday junction ATP-dependent DNA helicase RuvB	1.52e-05	NA	NA	0.5228
6. F	B2TMZ2	Holliday junction ATP-dependent DNA helicase RuvB	4.05e-05	NA	NA	0.5188
6. F	B2K324	Holliday junction ATP-dependent DNA helicase RuvB	4.14e-06	NA	NA	0.5431
6. F	A5GI46	Holliday junction ATP-dependent DNA helicase RuvB	1.48e-04	NA	NA	0.4787
6. F	A4VYM0	Holliday junction ATP-dependent DNA helicase RuvB	1.55e-05	NA	NA	0.5115
6. F	B8H454	Holliday junction ATP-dependent DNA helicase RuvB	2.13e-06	NA	NA	0.5209
6. F	Q0C5W2	Holliday junction ATP-dependent DNA helicase RuvB	2.05e-06	NA	NA	0.5624
6. F	Q0AX16	Holliday junction ATP-dependent DNA helicase RuvB	7.51e-06	NA	NA	0.4942
6. F	Q7V9Q4	Holliday junction ATP-dependent DNA helicase RuvB	9.96e-06	NA	NA	0.5243
6. F	Q0AJA3	Holliday junction ATP-dependent DNA helicase RuvB	2.63e-05	NA	NA	0.4925
6. F	Q3APQ7	Holliday junction ATP-dependent DNA helicase RuvB	8.05e-07	NA	NA	0.5678
6. F	Q03R36	Holliday junction ATP-dependent DNA helicase RuvB	1.52e-06	NA	NA	0.567
6. F	B0TF70	Holliday junction ATP-dependent DNA helicase RuvB	3.15e-05	NA	NA	0.5362
6. F	A0Q6B4	Holliday junction ATP-dependent DNA helicase RuvB	2.83e-05	NA	NA	0.5425
6. F	Q6HDA6	Holliday junction ATP-dependent DNA helicase RuvB	4.77e-06	NA	NA	0.5038
6. F	B2STK0	Holliday junction ATP-dependent DNA helicase RuvB	2.09e-05	NA	NA	0.5305
6. F	B3PB59	Holliday junction ATP-dependent DNA helicase RuvB	3.37e-05	NA	NA	0.5348
6. F	Q1LTF3	Holliday junction ATP-dependent DNA helicase RuvB	1.25e-05	NA	NA	0.4688
6. F	Q5FQC4	Holliday junction ATP-dependent DNA helicase RuvB	2.55e-05	NA	NA	0.5423
6. F	Q9PMT7	Holliday junction ATP-dependent DNA helicase RuvB	4.74e-08	NA	NA	0.5673
6. F	P66757	Holliday junction ATP-dependent DNA helicase RuvB	4.74e-08	NA	NA	0.5118
6. F	A0LXR1	Holliday junction ATP-dependent DNA helicase RuvB	6.72e-07	NA	NA	0.5715
6. F	B0B9E8	Holliday junction ATP-dependent DNA helicase RuvB	1.10e-06	NA	NA	0.5321
6. F	Q7WGB3	Holliday junction ATP-dependent DNA helicase RuvB	3.22e-05	NA	NA	0.4988
6. F	C1FKG1	Holliday junction ATP-dependent DNA helicase RuvB	3.04e-06	NA	NA	0.4728
6. F	Q3JNS5	Holliday junction ATP-dependent DNA helicase RuvB	2.97e-05	NA	NA	0.5315
6. F	Q5GT33	Holliday junction ATP-dependent DNA helicase RuvB	9.62e-07	NA	NA	0.5657
6. F	A5CW96	Holliday junction ATP-dependent DNA helicase RuvB	6.15e-07	NA	NA	0.5491
6. F	Q0TP13	Holliday junction ATP-dependent DNA helicase RuvB	1.12e-05	NA	NA	0.4845
6. F	A1RJQ2	Holliday junction ATP-dependent DNA helicase RuvB	2.02e-05	NA	NA	0.5342
6. F	A9QYX2	Holliday junction ATP-dependent DNA helicase RuvB	3.95e-06	NA	NA	0.5426
6. F	B8HY57	Holliday junction ATP-dependent DNA helicase RuvB	2.99e-06	NA	NA	0.4987
6. F	B2IBR9	Holliday junction ATP-dependent DNA helicase RuvB	3.06e-05	NA	NA	0.5383
6. F	Q9KDI8	Holliday junction ATP-dependent DNA helicase RuvB	3.03e-06	NA	NA	0.5586
6. F	Q8XJ14	Holliday junction ATP-dependent DNA helicase RuvB	1.23e-05	NA	NA	0.4879
6. F	A9VIP6	Holliday junction ATP-dependent DNA helicase RuvB	1.96e-05	NA	NA	0.476
6. F	Q57NA3	Holliday junction ATP-dependent DNA helicase RuvB	2.40e-05	NA	NA	0.5291
6. F	C4LBN0	Holliday junction ATP-dependent DNA helicase RuvB	5.36e-06	NA	NA	0.5581
6. F	B9E718	Holliday junction ATP-dependent DNA helicase RuvB	2.58e-06	NA	NA	0.493
6. F	Q02IC9	Holliday junction ATP-dependent DNA helicase RuvB	2.97e-05	NA	NA	0.5212
6. F	B0K0L8	Holliday junction ATP-dependent DNA helicase RuvB	2.57e-05	NA	NA	0.5025
6. F	Q98F76	Holliday junction ATP-dependent DNA helicase RuvB	1.05e-06	NA	NA	0.5099
6. F	B0KTJ2	Holliday junction ATP-dependent DNA helicase RuvB	3.31e-05	NA	NA	0.516
6. F	C1A611	Holliday junction ATP-dependent DNA helicase RuvB	2.16e-05	NA	NA	0.5321
6. F	C3P9A7	Holliday junction ATP-dependent DNA helicase RuvB	4.78e-06	NA	NA	0.5037
6. F	Q81LG9	Holliday junction ATP-dependent DNA helicase RuvB	2.13e-05	NA	NA	0.5033
6. F	Q8Y6Z8	Holliday junction ATP-dependent DNA helicase RuvB	2.24e-05	NA	NA	0.536
6. F	P10871	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	2.66e-04	NA	NA	0.4809
6. F	A9WWH9	Holliday junction ATP-dependent DNA helicase RuvB	2.64e-05	NA	NA	0.5118
6. F	Q03ER0	Holliday junction ATP-dependent DNA helicase RuvB	2.08e-05	NA	NA	0.5319
6. F	C0QKP4	Holliday junction ATP-dependent DNA helicase RuvB	3.24e-06	NA	NA	0.5364
6. F	A4JBL2	Holliday junction ATP-dependent DNA helicase RuvB	3.16e-05	NA	NA	0.531
6. F	A3NZ67	Holliday junction ATP-dependent DNA helicase RuvB	3.06e-05	NA	NA	0.5318
6. F	Q3AND8	Holliday junction ATP-dependent DNA helicase RuvB	5.07e-06	NA	NA	0.4613
6. F	P9WGW0	Holliday junction ATP-dependent DNA helicase RuvB	7.99e-07	NA	NA	0.5347
6. F	Q9A1Y1	Holliday junction ATP-dependent DNA helicase RuvB	1.92e-05	NA	NA	0.4861
6. F	B2USM3	Holliday junction ATP-dependent DNA helicase RuvB	4.80e-08	NA	NA	0.5678
6. F	Q63QX5	Holliday junction ATP-dependent DNA helicase RuvB	2.91e-05	NA	NA	0.5315
6. F	A3DBU4	Holliday junction ATP-dependent DNA helicase RuvB	3.55e-06	NA	NA	0.5415
6. F	B2I4T1	Holliday junction ATP-dependent DNA helicase RuvB	1.93e-05	NA	NA	0.5363
6. F	Q1BZ36	Holliday junction ATP-dependent DNA helicase RuvB	3.08e-05	NA	NA	0.5165
6. F	B1AJ89	Holliday junction ATP-dependent DNA helicase RuvB	1.82e-06	NA	NA	0.5091
6. F	Q11Y53	Holliday junction ATP-dependent DNA helicase RuvB	1.52e-06	NA	NA	0.5336
6. F	Q5P2U7	Holliday junction ATP-dependent DNA helicase RuvB	3.01e-05	NA	NA	0.5273
6. F	P55150	Gas vesicle protein GvpN	5.98e-04	NA	NA	0.441
6. F	A1SJA7	Holliday junction ATP-dependent DNA helicase RuvB	2.64e-06	NA	NA	0.5207
6. F	B7HE54	Holliday junction ATP-dependent DNA helicase RuvB	1.91e-05	NA	NA	0.4811
6. F	B0C2D5	Holliday junction ATP-dependent DNA helicase RuvB	2.92e-06	NA	NA	0.4682
6. F	Q03B17	Holliday junction ATP-dependent DNA helicase RuvB	1.29e-05	NA	NA	0.5677
6. F	Q2YT89	Holliday junction ATP-dependent DNA helicase RuvB	4.83e-08	NA	NA	0.5115
6. F	A9NF62	Holliday junction ATP-dependent DNA helicase RuvB	1.80e-06	NA	NA	0.5505
6. F	Q7W4T6	Holliday junction ATP-dependent DNA helicase RuvB	3.37e-05	NA	NA	0.5003
6. F	B7LPI4	Holliday junction ATP-dependent DNA helicase RuvB	1.90e-06	NA	NA	0.4754
6. F	A6QC28	Holliday junction ATP-dependent DNA helicase RuvB	5.10e-07	NA	NA	0.5239
6. F	B8EK46	Holliday junction ATP-dependent DNA helicase RuvB	1.04e-06	NA	NA	0.5659
6. F	Q83MZ8	Holliday junction ATP-dependent DNA helicase RuvB	2.52e-07	NA	NA	0.5403
6. F	Q3YRD9	Holliday junction ATP-dependent DNA helicase RuvB	1.45e-06	NA	NA	0.5494
6. F	B1J0M8	Holliday junction ATP-dependent DNA helicase RuvB	2.09e-05	NA	NA	0.5336
6. F	Q9PQ42	Holliday junction ATP-dependent DNA helicase RuvB	2.00e-06	NA	NA	0.5177
6. F	Q57396	Holliday junction ATP-dependent DNA helicase RuvB	6.25e-06	NA	NA	0.497
6. F	P75242	Holliday junction ATP-dependent DNA helicase RuvB	3.77e-08	NA	NA	0.526
6. F	Q7X9A0	Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic	6.70e-05	NA	NA	0.504
6. F	B7NS58	Holliday junction ATP-dependent DNA helicase RuvB	2.06e-05	NA	NA	0.5277
6. F	A1AC21	Holliday junction ATP-dependent DNA helicase RuvB	2.04e-05	NA	NA	0.5263
6. F	Q8U9K6	Holliday junction ATP-dependent DNA helicase RuvB	6.29e-08	NA	NA	0.5163
6. F	Q8FGR3	Holliday junction ATP-dependent DNA helicase RuvB	2.48e-05	NA	NA	0.5468
6. F	C1B4D1	Holliday junction ATP-dependent DNA helicase RuvB	7.31e-06	NA	NA	0.4825
6. F	A7GTA2	Holliday junction ATP-dependent DNA helicase RuvB	7.34e-07	NA	NA	0.4868
6. F	Q2FG86	Holliday junction ATP-dependent DNA helicase RuvB	4.91e-08	NA	NA	0.5522
6. F	B7K1K0	Holliday junction ATP-dependent DNA helicase RuvB	3.19e-06	NA	NA	0.4836
6. F	A1UR84	Holliday junction ATP-dependent DNA helicase RuvB	1.74e-06	NA	NA	0.4611
6. F	A8LXW9	Holliday junction ATP-dependent DNA helicase RuvB	1.10e-06	NA	NA	0.5338
6. F	A1UFA4	Holliday junction ATP-dependent DNA helicase RuvB	5.45e-06	NA	NA	0.5145
6. F	B7MVZ1	Holliday junction ATP-dependent DNA helicase RuvB	2.11e-05	NA	NA	0.5343
6. F	A5U5U2	Holliday junction ATP-dependent DNA helicase RuvB	7.49e-07	NA	NA	0.5477
6. F	Q31H83	Holliday junction ATP-dependent DNA helicase RuvB	1.29e-06	NA	NA	0.4938
6. F	Q5H2A4	Holliday junction ATP-dependent DNA helicase RuvB	2.55e-05	NA	NA	0.5277
6. F	Q06721	Ribulose bisphosphate carboxylase/oxygenase activase	1.78e-05	NA	NA	0.5236
6. F	A1BDZ8	Holliday junction ATP-dependent DNA helicase RuvB	7.62e-07	NA	NA	0.5161
6. F	B3E468	Holliday junction ATP-dependent DNA helicase RuvB	3.79e-06	NA	NA	0.4767
6. F	A8FN42	Holliday junction ATP-dependent DNA helicase RuvB	4.77e-08	NA	NA	0.5332
6. F	P0A813	Holliday junction ATP-dependent DNA helicase RuvB	7.70e-06	NA	NA	0.4908
6. F	C3KTD2	Holliday junction ATP-dependent DNA helicase RuvB	4.28e-05	NA	NA	0.4726
6. F	A8FFR2	Holliday junction ATP-dependent DNA helicase RuvB	1.43e-06	NA	NA	0.5441
6. F	O49074	Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	3.36e-04	NA	NA	0.4636
6. F	Q2LRA8	Holliday junction ATP-dependent DNA helicase RuvB	2.04e-05	NA	NA	0.5142
6. F	Q9L291	Holliday junction ATP-dependent DNA helicase RuvB	2.78e-05	NA	NA	0.5062
6. F	Q2RVF5	Holliday junction ATP-dependent DNA helicase RuvB	2.14e-06	NA	NA	0.5075
6. F	Q0BT53	Holliday junction ATP-dependent DNA helicase RuvB	3.09e-05	NA	NA	0.5358
6. F	Q6GG63	Holliday junction ATP-dependent DNA helicase RuvB	5.01e-08	NA	NA	0.5165
6. F	Q03YJ6	Holliday junction ATP-dependent DNA helicase RuvB	2.36e-05	NA	NA	0.4747
6. F	A8Z2G9	Holliday junction ATP-dependent DNA helicase RuvB	4.62e-08	NA	NA	0.5105
6. F	A8F1F7	Holliday junction ATP-dependent DNA helicase RuvB	1.22e-05	NA	NA	0.4813
6. F	B0SUN9	Holliday junction ATP-dependent DNA helicase RuvB	2.52e-06	NA	NA	0.542
6. F	Q68WZ0	Holliday junction ATP-dependent DNA helicase RuvB	5.03e-06	NA	NA	0.5088
6. F	Q0BLU4	Holliday junction ATP-dependent DNA helicase RuvB	3.33e-05	NA	NA	0.5381
7. B	Q2NEP8	Lon protease	2.45e-03	NA	0.005	NA
7. B	O14114	Uncharacterized AAA domain-containing protein C31G5.19	6.29e-03	NA	1.91e-06	NA
7. B	Q8IYT4	Katanin p60 ATPase-containing subunit A-like 2	2.82e-05	NA	4.77e-04	NA
7. B	Q6GX84	Fidgetin-like protein 1	1.23e-04	NA	0.001	NA
7. B	Q67WJ2	ATP-dependent zinc metalloprotease FTSH 6, chloroplastic	4.71e-05	NA	0.005	NA
7. B	O16368	Probable 26S proteasome regulatory subunit 4	1.16e-05	NA	1.97e-09	NA
7. B	Q8VZI8	ATP-dependent zinc metalloprotease FTSH 10, mitochondrial	7.10e-04	NA	7.90e-04	NA
7. B	Q1RID6	Lon protease	2.15e-03	NA	0.023	NA
7. B	Q6BJJ8	Lon protease homolog 2, peroxisomal	3.67e-02	NA	0.031	NA
7. B	Q21222	ATPase family protein 2 homolog	1.23e-04	NA	1.02e-06	NA
7. B	P36612	26S proteasome regulatory subunit 4 homolog	1.55e-05	NA	8.90e-07	NA
7. B	Q6MTF4	Lon protease	4.03e-03	NA	0.031	NA
7. B	P0DKJ9	26S proteasome regulatory subunit 7A	1.06e-05	NA	8.51e-07	NA
7. B	A4J7L6	Lon protease	1.77e-03	NA	0.007	NA
7. B	A3Q196	Proteasome-associated ATPase	1.30e-04	NA	0.009	NA
7. B	Q55BV5	26S proteasome regulatory subunit 4 homolog	9.84e-06	NA	1.85e-08	NA
7. B	Q6PL18	ATPase family AAA domain-containing protein 2	2.26e-02	NA	1.44e-08	NA
7. B	Q8S2A7	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial	1.48e-04	NA	8.22e-04	NA
7. B	Q09769	Lon protease homolog, mitochondrial	1.30e-02	NA	3.25e-04	NA
7. B	O33089	ESX-1 secretion system protein EccA1	7.69e-06	NA	0.006	NA
7. B	P47597	Chaperone protein ClpB	2.51e-03	NA	4.89e-04	NA
7. B	Q01853	Transitional endoplasmic reticulum ATPase	3.34e-04	NA	3.24e-06	NA
7. B	Q58556	Cell division cycle protein 48 homolog MJ1156	6.66e-04	NA	1.27e-10	NA
7. B	Q9CI09	ATP-dependent Clp protease ATP-binding subunit ClpE	2.32e-03	NA	0.003	NA
7. B	Q9SEI2	26S proteasome regulatory subunit 6A homolog A	8.21e-07	NA	3.82e-06	NA
7. B	Q7VQF3	Chaperone protein ClpB	1.11e-02	NA	0.014	NA
7. B	Q9M895	Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic	1.74e-05	NA	7.40e-04	NA
7. B	Q75GT3	Chaperone protein ClpB2, chloroplastic	1.06e-02	NA	0.021	NA
7. B	P25694	Cell division control protein 48	2.34e-04	NA	1.68e-06	NA
7. B	B8BDV1	Lon protease homolog 2, peroxisomal	7.04e-03	NA	1.92e-04	NA
7. B	Q13608	Peroxisome assembly factor 2	1.12e-03	NA	3.10e-10	NA
7. B	Q54HY8	Probable mitochondrial chaperone BCS1-A	1.01e-04	NA	0.006	NA
7. B	P75247	Chaperone protein ClpB	2.95e-03	NA	0.013	NA
7. B	Q63569	26S proteasome regulatory subunit 6A	5.23e-06	NA	4.57e-04	NA
7. B	Q6E0V2	Katanin p60 ATPase-containing subunit A1	1.16e-06	NA	4.63e-06	NA
7. B	P46471	26S proteasome regulatory subunit 7	1.60e-05	NA	1.15e-05	NA
7. B	Q5RII9	Katanin p60 ATPase-containing subunit A1	9.22e-06	NA	1.70e-06	NA
7. B	Q8RY16	Peroxisome biogenesis protein 6	6.08e-04	NA	1.87e-10	NA
7. B	O17071	Probable 26S proteasome regulatory subunit 10B	2.94e-06	NA	1.41e-08	NA
7. B	Q9DBY8	Nuclear valosin-containing protein-like	5.78e-04	NA	9.16e-09	NA
7. B	B1GZQ6	Lon protease	2.58e-03	NA	0.001	NA
7. B	Q9RXG4	Lon protease	2.39e-03	NA	1.68e-04	NA
7. B	Q6FPE6	Lon protease homolog, mitochondrial	6.28e-03	NA	2.81e-05	NA
7. B	P53532	Chaperone protein ClpB	8.32e-03	NA	0.031	NA
7. B	Q9SEX2	Katanin p60 ATPase-containing subunit A1	8.24e-06	NA	3.34e-04	NA
7. B	Q6MGP8	Lon protease 2	1.94e-03	NA	2.47e-05	NA
7. B	A8XFM8	Lon protease homolog, mitochondrial	3.93e-03	NA	0.014	NA
7. B	P55072	Transitional endoplasmic reticulum ATPase	4.77e-04	NA	3.24e-06	NA
7. B	Q5HQI5	Chaperone protein ClpB	1.53e-02	NA	0.042	NA
7. B	Q7ZU99	Transitional endoplasmic reticulum ATPase	8.66e-04	NA	4.69e-06	NA
7. B	Q9SS94	Cell division control protein 48 homolog C	1.82e-04	NA	7.72e-06	NA
7. B	F3YDF1	ATP-dependent zinc metalloprotease YME1L	9.98e-06	NA	0.001	NA
7. B	Q1PDW5	ATP-dependent zinc metalloprotease FTSH 6, chloroplastic	5.77e-05	NA	3.07e-04	NA
7. B	P31539	Heat shock protein 104	6.92e-03	NA	0.014	NA
7. B	P46466	26S proteasome regulatory subunit 4 homolog	1.53e-05	NA	4.05e-08	NA
7. B	Q68XR2	Chaperone protein ClpB	9.54e-03	NA	0.002	NA
7. B	P36776	Lon protease homolog, mitochondrial	6.02e-03	NA	0.005	NA
7. B	O14325	Uncharacterized AAA domain-containing protein C16E9.10c	3.89e-04	NA	2.75e-05	NA
7. B	P54816	Tat-binding homolog 7	1.31e-02	NA	4.13e-06	NA
7. B	Q5U3S1	Katanin p60 ATPase-containing subunit A-like 1	1.18e-07	NA	2.33e-05	NA
7. B	Q54YV4	Lon protease homolog, mitochondrial 1	7.43e-03	NA	2.91e-04	NA
7. B	Q8LQJ9	ATP-dependent zinc metalloprotease FTSH 4, mitochondrial	9.22e-06	NA	1.41e-05	NA
7. B	Q75JI3	Vesicle-fusing ATPase	1.30e-03	NA	2.45e-07	NA
7. B	Q59HJ6	Lon protease homolog, mitochondrial	1.09e-02	NA	0.004	NA
7. B	Q9ULI0	ATPase family AAA domain-containing protein 2B	1.99e-02	NA	1.46e-07	NA
7. B	P18708	Vesicle-fusing ATPase	2.34e-03	NA	2.44e-07	NA
7. B	Q9LZF6	Cell division control protein 48 homolog E	5.37e-04	NA	1.89e-07	NA
7. B	A9GIS9	Lon protease 3	2.04e-03	NA	0.001	NA
7. B	P33760	Peroxisomal ATPase PEX6	8.82e-04	NA	7.42e-14	NA
7. B	Q9M9L8	Lon protease homolog 3, mitochondrial	4.81e-03	NA	0.001	NA
7. B	Q7KN62	Transitional endoplasmic reticulum ATPase TER94	6.08e-04	NA	4.18e-06	NA
7. B	Q7M9X4	Chaperone protein ClpB	5.76e-03	NA	0.016	NA
7. B	P38126	Pachytene checkpoint protein 2	8.24e-05	NA	1.44e-08	NA
7. B	P34808	Meiotic spindle formation protein mei-1	5.55e-06	NA	0.002	NA
7. B	Q73BY1	Chaperone protein ClpB	1.14e-02	NA	0.039	NA
7. B	B3ERM8	Lon protease	1.84e-03	NA	0.001	NA
7. B	Q9SCN8	Cell division control protein 48 homolog D	3.31e-04	NA	3.77e-07	NA
7. B	P54811	Transitional endoplasmic reticulum ATPase homolog 1	4.73e-04	NA	8.47e-06	NA
7. B	B2RII6	Lon protease	3.90e-03	NA	0.008	NA
7. B	Q9FGM0	ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial	1.37e-04	NA	1.72e-04	NA
7. B	Q9BVQ7	Spermatogenesis-associated protein 5-like protein 1	8.66e-05	NA	2.43e-09	NA
7. B	Q5A6N1	Lon protease homolog, mitochondrial	1.09e-02	NA	4.38e-04	NA
7. B	Q5RDX4	ATPase family AAA domain-containing protein 2	1.92e-03	NA	1.24e-08	NA
7. B	P54812	Transitional endoplasmic reticulum ATPase homolog 2	2.14e-04	NA	3.17e-05	NA
7. B	Q6ME13	Lon protease	2.25e-03	NA	0.030	NA
7. B	Q58576	Proteasome-activating nucleotidase	2.00e-06	NA	2.87e-08	NA
7. B	Q72JM6	Lon protease 2	1.99e-03	NA	0.004	NA
7. B	P41836	26S proteasome regulatory subunit 8 homolog	9.44e-07	NA	0.002	NA
7. B	Q9VQN8	Fidgetin-like protein 1	3.84e-06	NA	7.58e-04	NA
7. B	O15381	Nuclear valosin-containing protein-like	7.97e-04	NA	1.51e-08	NA
7. B	P62195	26S proteasome regulatory subunit 8	7.61e-07	NA	3.46e-05	NA
7. B	P46460	Vesicle-fusing ATPase	1.16e-03	NA	3.02e-07	NA
7. B	Q0DGP6	Vesicle-fusing ATPase	3.10e-03	NA	2.02e-06	NA
7. B	B8B406	Probable DNA helicase MCM9	1.97e-02	NA	0.003	NA
7. B	P62198	26S proteasome regulatory subunit 8	8.61e-07	NA	3.46e-05	NA
7. B	P33298	26S proteasome regulatory subunit 6B homolog	2.44e-06	NA	1.87e-06	NA
7. B	Q5AZT7	Lon protease homolog, mitochondrial	1.75e-02	NA	0.030	NA
7. B	Q94BQ2	26S proteasome regulatory subunit 8 homolog B	1.10e-06	NA	4.03e-06	NA
7. B	Q8GW96	AAA-ATPase At2g18193	2.70e-04	NA	0.032	NA
7. B	Q8EBE6	Chaperone protein ClpB	5.12e-03	NA	0.024	NA
7. B	Q5E9N5	Caseinolytic peptidase B protein homolog	9.80e-03	NA	0.026	NA
7. B	P46461	Vesicle-fusing ATPase 1	2.16e-03	NA	6.01e-09	NA
7. B	Q6AK61	Lon protease 2	1.74e-03	NA	6.06e-04	NA
7. B	F4J0B7	AAA-ATPase At3g28570, mitochondrial	3.06e-04	NA	0.004	NA
7. B	Q9LET7	Calmodulin-interacting protein 111	3.24e-03	NA	1.97e-10	NA
7. B	Q3UMC0	ATPase family protein 2 homolog	5.03e-04	NA	6.72e-08	NA
7. B	Q1B795	Proteasome-associated ATPase	8.18e-05	NA	0.009	NA
7. B	Q54CS8	Peroxisomal biogenesis factor 6	1.83e-03	NA	3.12e-12	NA
7. B	Q8CPT5	Chaperone protein ClpB	1.53e-02	NA	0.042	NA
7. B	P40340	Tat-binding homolog 7	6.18e-03	NA	1.76e-06	NA
7. B	Q9SSB5	26S proteasome regulatory subunit 7 homolog A	1.41e-05	NA	7.64e-07	NA
7. B	A9KH99	Lon protease	2.14e-03	NA	0.010	NA
7. B	Q5BL07	Peroxisome biogenesis factor 1	6.96e-03	NA	0.006	NA
7. B	Q8K0T4	Katanin p60 ATPase-containing subunit A-like 1	1.19e-07	NA	7.18e-06	NA
7. B	Q9P3A7	Cell division cycle protein 48	7.54e-04	NA	1.69e-06	NA
7. B	Q6KI22	Lon protease	6.56e-03	NA	0.001	NA
7. B	O76371	26S protease regulatory subunit 6A	3.87e-06	NA	4.06e-04	NA
7. B	P46462	Transitional endoplasmic reticulum ATPase	3.95e-04	NA	3.39e-06	NA
7. B	Q5Z974	ATP-dependent zinc metalloprotease FTSH 1, chloroplastic	1.47e-04	NA	6.60e-05	NA
7. B	F4JEX5	ATPase family AAA domain-containing protein FIGL1	1.49e-04	NA	1.99e-04	NA
7. B	Q4UN57	Chaperone protein ClpB	9.07e-03	NA	0.025	NA
7. B	Q31GE9	Lon protease 1	2.59e-03	NA	0.013	NA
7. B	Q9SSB4	26S proteasome regulatory subunit 7 homolog B	1.60e-05	NA	3.25e-06	NA
7. B	Q925S8	ATP-dependent zinc metalloprotease YME1L1	7.44e-06	NA	0.001	NA
7. B	Q99LC9	Peroxisome assembly factor 2	9.13e-04	NA	4.13e-10	NA
7. B	Q9FNP1	Peroxisome biogenesis protein 1	4.47e-03	NA	5.48e-04	NA
7. B	P54777	Peroxisome assembly factor 2	5.70e-04	NA	4.20e-10	NA
7. B	Q63570	26S proteasome regulatory subunit 6B	2.60e-06	NA	4.25e-05	NA
7. B	O80983	ATP-dependent zinc metalloprotease FTSH 4, mitochondrial	1.27e-05	NA	5.45e-06	NA
7. B	Q9S5Z2	ATP-dependent Clp protease ATP-binding subunit ClpE	2.16e-03	NA	0.003	NA
7. B	P24004	Peroxisomal ATPase PEX1	2.89e-03	NA	6.51e-08	NA
7. B	Q8BPY9	Fidgetin-like protein 1	1.56e-04	NA	7.61e-04	NA
7. B	P9WQN3	ATP-dependent zinc metalloprotease FtsH	2.02e-04	NA	1.43e-04	NA
7. B	O88685	26S proteasome regulatory subunit 6A	8.02e-06	NA	4.63e-04	NA
7. B	P39955	Protein SAP1	4.44e-04	NA	1.54e-05	NA
7. B	Q550C8	Lon protease homolog, mitochondrial 2	2.02e-03	NA	0.013	NA
7. B	A8ZX50	Lon protease	2.17e-03	NA	0.025	NA
7. B	P62196	26S proteasome regulatory subunit 8	8.75e-07	NA	3.46e-05	NA
7. B	P54351	Vesicle-fusing ATPase 2	2.65e-03	NA	5.42e-09	NA
7. B	Q54SY2	Putative ribosome biogenesis ATPase nvl	5.42e-04	NA	8.89e-07	NA
7. B	F4IFF3	Probable DNA helicase MCM9	1.81e-02	NA	0.002	NA
7. B	Q7ZV60	Mitochondrial chaperone BCS1	7.02e-05	NA	0.007	NA
7. B	P32794	ATPase family gene 2 protein	1.81e-04	NA	8.79e-08	NA
7. B	P44403	Chaperone protein ClpB	5.31e-03	NA	0.013	NA
7. B	A0LEE9	Lon protease 1	2.22e-03	NA	3.56e-05	NA
7. B	Q8CDM1	ATPase family AAA domain-containing protein 2	8.20e-03	NA	4.08e-09	NA
7. B	O42931	26S proteasome regulatory subunit 7 homolog	1.68e-05	NA	5.15e-06	NA
7. B	Q84WU8	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial	7.43e-04	NA	0.006	NA
7. B	Q7CU92	Chaperone protein ClpB	1.17e-02	NA	0.027	NA
7. B	P54609	Cell division control protein 48 homolog A	3.43e-04	NA	2.74e-06	NA
7. B	F4KF14	Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic	5.18e-04	NA	4.99e-07	NA
7. B	B8F9K1	Lon protease	2.42e-03	NA	0.010	NA
7. B	P54774	Cell division cycle protein 48 homolog	2.69e-04	NA	1.13e-06	NA
7. B	A9GBF1	Lon protease 2	1.98e-03	NA	1.02e-04	NA
7. B	Q180E4	Lon protease	1.84e-03	NA	2.97e-06	NA
7. B	Q147F9	AAA-ATPase At3g50940	5.77e-04	NA	0.009	NA
7. B	P33299	26S proteasome regulatory subunit 7 homolog	3.56e-05	NA	4.83e-06	NA
7. B	P17422	Chaperone protein ClpB	7.05e-03	NA	4.49e-04	NA
7. B	P54775	26S proteasome regulatory subunit 6B	2.61e-06	NA	4.25e-05	NA
7. B	O04019	26S proteasome regulatory subunit 6A homolog B	8.96e-07	NA	4.64e-05	NA
7. B	O31147	Lon protease	1.43e-03	NA	0.029	NA
7. B	P36775	Lon protease homolog, mitochondrial	1.14e-02	NA	5.05e-05	NA
7. B	P53549	26S proteasome subunit RPT4	4.90e-06	NA	5.47e-06	NA
7. B	O14126	26S proteasome regulatory subunit 6A	1.31e-06	NA	4.30e-05	NA
7. B	O13764	Peroxisomal ATPase pex6	2.00e-03	NA	6.01e-10	NA
7. B	Q6NW58	Spastin	2.19e-06	NA	7.84e-04	NA
7. B	Q9FH02	ATP-dependent zinc metalloprotease FTSH 5, chloroplastic	1.51e-04	NA	3.52e-04	NA
7. B	P34124	26S proteasome regulatory subunit 8	9.32e-07	NA	4.49e-05	NA
7. B	A2QCJ2	Lon protease homolog, mitochondrial	1.64e-02	NA	0.032	NA
7. B	C5CBU4	AAA ATPase forming ring-shaped complexes	1.61e-04	NA	4.50e-06	NA
7. B	P46468	Putative cell division cycle ATPase	5.49e-03	NA	6.58e-10	NA
7. B	O74941	Peroxisomal ATPase pex1	1.46e-03	NA	3.62e-06	NA
7. B	Q3V4U3	Uncharacterized protein ORF529	NA	NA	7.40e-09	NA
7. B	Q39565	Dynein beta chain, flagellar outer arm	NA	NA	0.009	NA
7. B	Q9SL67	26S proteasome regulatory subunit 4 homolog B	1.31e-05	NA	2.91e-08	NA
7. B	P0DKK0	26S proteasome regulatory subunit 7B	1.21e-05	NA	8.51e-07	NA
7. B	Q0DHL4	ATP-dependent zinc metalloprotease FTSH 8, mitochondrial	4.38e-05	NA	6.36e-04	NA
7. B	Q655S1	ATP-dependent zinc metalloprotease FTSH 2, chloroplastic	3.66e-05	NA	2.10e-06	NA
7. B	B9WLN5	Lon protease homolog, mitochondrial	1.28e-02	NA	3.14e-04	NA
7. B	P18759	Vesicular-fusion protein SEC18	1.38e-03	NA	6.85e-06	NA
7. B	Q81GM5	Chaperone protein ClpB	1.23e-02	NA	0.036	NA
7. B	Q9P3U2	Uncharacterized AAA domain-containing protein C328.04	1.89e-03	NA	7.79e-04	NA
7. B	P40341	Mitochondrial respiratory chain complexes assembly protein YTA12	2.92e-04	NA	0.002	NA
7. B	F4KFX5	AAA-ATPase At5g40000	2.68e-04	NA	0.004	NA
7. B	Q5R410	Vesicle-fusing ATPase	1.23e-03	NA	2.91e-07	NA
7. B	P35998	26S proteasome regulatory subunit 7	2.10e-05	NA	1.23e-05	NA
7. B	Q9UBP0	Spastin	1.29e-06	NA	2.76e-04	NA
7. B	Q81TT4	Chaperone protein ClpB	9.27e-03	NA	0.041	NA
7. B	Q96TA2	ATP-dependent zinc metalloprotease YME1L1	1.65e-05	NA	8.44e-04	NA
7. B	Q9Y4W6	AFG3-like protein 2	6.26e-05	NA	0.004	NA
7. B	B3E7K2	Lon protease	3.98e-03	NA	3.57e-04	NA
7. B	Q8MNV0	Spastin homolog	1.18e-07	NA	3.73e-06	NA
7. B	O60058	ATPase family gene 2 protein	1.79e-04	NA	3.92e-10	NA
7. B	P46459	Vesicle-fusing ATPase	2.45e-03	NA	2.86e-07	NA
7. B	P17980	26S proteasome regulatory subunit 6A	3.37e-06	NA	4.15e-04	NA
7. B	Q9CKC0	Chaperone protein ClpB	5.23e-03	NA	0.006	NA
7. B	Q6PIW4	Fidgetin-like protein 1	2.74e-05	NA	5.68e-04	NA
7. B	Q2LVS9	Lon protease	1.55e-03	NA	7.64e-04	NA
7. B	Q5XIK7	Katanin p60 ATPase-containing subunit A-like 1	1.43e-07	NA	6.81e-06	NA
7. B	Q9XTT9	26S proteasome regulatory subunit 8	1.21e-06	NA	9.75e-05	NA
7. B	B1AIY7	Lon protease	1.39e-03	NA	0.048	NA
7. B	Q63347	26S proteasome regulatory subunit 7	2.92e-05	NA	1.23e-05	NA
7. B	P40327	26S proteasome regulatory subunit 4 homolog	1.12e-05	NA	9.56e-07	NA
7. B	A8MPR5	Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic	1.52e-04	NA	1.41e-04	NA
7. B	Q9HGM3	Mitochondrial respiratory chain complexes assembly protein rca1	1.98e-04	NA	3.82e-06	NA
7. B	P33289	Peroxisomal biogenesis factor 6	3.06e-03	NA	3.34e-08	NA
7. B	Q9D3R6	Katanin p60 ATPase-containing subunit A-like 2	2.12e-05	NA	0.002	NA
7. B	Q89YY3	Chaperone protein ClpB	4.61e-03	NA	0.011	NA
7. B	B5Y8Q8	Lon protease	1.44e-03	NA	0.001	NA
7. B	A8Z5Z0	Lon protease	3.46e-03	NA	1.26e-04	NA
7. B	B5YFG2	Lon protease	1.67e-03	NA	0.005	NA
7. B	Q9FIM2	ATP-dependent zinc metalloprotease FTSH 9, chloroplastic	1.66e-04	NA	1.74e-05	NA
7. B	P93647	Lon protease homolog 2, peroxisomal	7.55e-03	NA	3.30e-04	NA
7. B	Q920A7	AFG3-like protein 1	8.21e-05	NA	0.003	NA
7. B	O66605	Lon protease	2.33e-03	NA	0.016	NA
7. B	Q9BW62	Katanin p60 ATPase-containing subunit A-like 1	8.51e-07	NA	1.14e-05	NA
7. B	Q9P7Q4	Vesicular-fusion protein sec18	2.07e-03	NA	1.18e-06	NA
7. B	Q4A696	Lon protease	3.59e-03	NA	5.12e-05	NA
7. B	Q7KUT2	Lon protease homolog, mitochondrial	8.75e-03	NA	0.010	NA
7. B	P32839	Mitochondrial chaperone BCS1	1.38e-04	NA	3.28e-04	NA
7. B	Q9WV86	Katanin p60 ATPase-containing subunit A1	2.78e-06	NA	1.33e-05	NA
7. B	Q469F5	Lon protease	1.76e-03	NA	0.009	NA
7. B	O59824	ATP-dependent zinc metalloprotease YME1 homolog	1.28e-04	NA	2.67e-05	NA
7. B	Q54PN7	26S proteasome regulatory subunit 6A homolog	3.00e-06	NA	1.72e-04	NA
7. B	A0QFB2	Proteasome-associated ATPase	1.39e-04	NA	0.012	NA
7. B	A5IYF2	Lon protease	8.08e-03	NA	0.012	NA
7. B	Q9QYY8	Spastin	9.92e-06	NA	3.09e-04	NA
7. B	Q9ZEA9	Chaperone protein ClpB	5.17e-03	NA	0.003	NA
7. B	Q39102	ATP-dependent zinc metalloprotease FTSH 1, chloroplastic	2.31e-04	NA	2.67e-04	NA
7. B	Q6H6R9	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	1.35e-04	NA	7.46e-06	NA
7. B	O22993	Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic	1.93e-04	NA	1.46e-04	NA
7. B	P0AAI3	ATP-dependent zinc metalloprotease FtsH	2.28e-05	NA	2.73e-04	NA
7. B	A2ZVG7	ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial	2.02e-04	NA	4.36e-04	NA
7. B	P32795	Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1	8.47e-06	NA	1.92e-07	NA
7. B	P33297	26S proteasome regulatory subunit 6A	3.29e-06	NA	5.21e-06	NA
7. B	O44952	Lon protease homolog, mitochondrial	5.16e-03	NA	0.005	NA
7. B	Q9C5U3	26S proteasome regulatory subunit 8 homolog A	1.13e-06	NA	4.74e-06	NA
7. B	B2RYN7	Spastin	2.11e-06	NA	2.73e-04	NA
7. B	P48601	26S proteasome regulatory subunit 4	1.16e-05	NA	8.01e-09	NA
7. B	A8X0L9	Tat-binding homolog 7	1.96e-02	NA	3.96e-08	NA
7. B	P34732	Vesicular-fusion protein SEC18	4.26e-03	NA	1.89e-05	NA
7. B	O88967	ATP-dependent zinc metalloprotease YME1L1	1.18e-05	NA	7.38e-04	NA
7. B	B2V6N0	Lon protease	2.21e-03	NA	0.001	NA
7. B	P43686	26S proteasome regulatory subunit 6B	1.66e-06	NA	4.60e-05	NA
7. B	Q9ZPR1	Cell division control protein 48 homolog B	1.94e-05	NA	4.95e-08	NA
7. B	P40328	Probable 26S proteasome subunit YTA6	1.43e-04	NA	6.60e-09	NA
7. B	F1QDI9	DNA helicase MCM9	1.02e-01	NA	0.043	NA
7. B	Q9ZMH1	Chaperone protein ClpB	8.75e-03	NA	0.035	NA
7. B	Q0J032	Lon protease homolog 2, peroxisomal	4.80e-03	NA	2.07e-04	NA
7. B	Q94392	Vesicle-fusing ATPase	3.93e-03	NA	1.32e-07	NA
7. B	O43078	ATPase-like fidgetin	8.03e-05	NA	1.14e-04	NA
7. B	Q9SD67	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	9.81e-05	NA	4.33e-05	NA
7. B	Q9RA63	Chaperone protein ClpB	5.80e-03	NA	0.003	NA
7. B	A4XJL4	Lon protease	1.48e-03	NA	2.79e-05	NA
7. B	Q72IK9	Chaperone protein ClpB	5.64e-03	NA	0.004	NA
7. B	Q9NAG4	Protein mac-1	2.56e-04	NA	1.84e-05	NA
7. B	Q07844	Ribosome biogenesis ATPase RIX7	5.41e-04	NA	3.39e-06	NA
7. B	Q6CNR9	Lon protease homolog, mitochondrial	1.06e-02	NA	3.79e-04	NA
7. B	Q8JZQ2	AFG3-like protein 2	7.35e-05	NA	0.004	NA
7. B	O75449	Katanin p60 ATPase-containing subunit A1	1.07e-06	NA	2.62e-06	NA
7. B	P62193	26S proteasome regulatory subunit 4	1.02e-05	NA	7.02e-09	NA
7. B	Q18787	26S proteasome regulatory subunit 7	2.14e-05	NA	9.22e-06	NA
7. B	A3M072	Lon protease homolog, mitochondrial (Fragment)	5.55e-03	NA	1.18e-04	NA
7. B	P34123	26S proteasome regulatory subunit 6B homolog	1.50e-06	NA	2.20e-05	NA
7. B	Q9SZD4	26S proteasome regulatory subunit 4 homolog A	1.32e-05	NA	1.23e-07	NA
7. B	O80860	ATP-dependent zinc metalloprotease FTSH 2, chloroplastic	4.13e-05	NA	5.89e-06	NA
7. B	P39925	Mitochondrial respiratory chain complexes assembly protein AFG3	5.46e-05	NA	0.004	NA
7. B	A7HK39	Lon protease	1.70e-03	NA	3.59e-04	NA
7. B	Q9M0Y8	Vesicle-fusing ATPase	1.65e-03	NA	3.23e-05	NA
7. B	Q60649	Caseinolytic peptidase B protein homolog	2.50e-02	NA	0.023	NA
7. B	O43933	Peroxisome biogenesis factor 1	6.96e-03	NA	0.005	NA
7. B	Q69QA6	Probable DNA helicase MCM9	1.60e-02	NA	0.004	NA
7. B	Q72QU2	Chaperone protein ClpB	6.44e-03	NA	0.029	NA
7. B	Q8NB90	ATPase family protein 2 homolog	4.55e-04	NA	1.26e-07	NA
7. B	P62192	26S proteasome regulatory subunit 4	9.12e-06	NA	7.02e-09	NA
7. B	Q9QUL6	Vesicle-fusing ATPase	1.28e-03	NA	2.69e-07	NA
7. B	Q86JA1	26S proteasome regulatory subunit 7	1.27e-05	NA	1.15e-06	NA
7. B	P46465	26S proteasome regulatory subunit 6A homolog	5.24e-06	NA	4.86e-06	NA
7. B	P62191	26S proteasome regulatory subunit 4	9.68e-06	NA	7.02e-09	NA
7. B	Q8W585	ATP-dependent zinc metalloprotease FTSH 8, chloroplastic	5.31e-05	NA	2.01e-06	NA
7. B	Q6C0B5	Lon protease homolog, mitochondrial	1.23e-02	NA	1.73e-04	NA
7. B	Q6BKJ4	Lon protease homolog, mitochondrial	1.14e-02	NA	5.26e-04	NA
7. B	O18413	26S proteasome regulatory subunit 8	9.02e-07	NA	1.08e-05	NA
7. B	Q8LQJ8	ATP-dependent zinc metalloprotease FTSH 5, mitochondrial	1.74e-05	NA	7.03e-06	NA
7. B	Q8F509	Chaperone protein ClpB	7.96e-03	NA	0.029	NA