Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54630.1
JCVISYN3A_0133

Toxin-antitoxin serine protease.
M. mycoides homolog: Q6MRS9.
TIGRfam Classification: 2=Generic.
Category: Nonessential.

Statistics

Total GO Annotation: 101
Unique PROST Go: 81
Unique BLAST Go: 16
Unique Foldseek Go: 0

Total Homologs: 104
Unique PROST Homologs: 95
Unique BLAST Homologs: 6
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: protease/peptidase|conserved catalytic site, similar to Vpr, AprX, Bpr
Yang and Tsui [2]: Polynucleotide phosphorylasep Pnp
Antczak et al. [3]: Subtilisin-like 1 serine protease
Zhang et al. [4]: GO:0004252|serine-type endopeptidase activity
Bianchi et al. [5]: Serine protease

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was P28842 (Subtilisin) with a FATCAT P-Value: 6.45e-05 and RMSD of 2.96 angstrom. The sequence alignment identity is 14.1%.
Structural alignment shown in left. Query protein AVX54630.1 colored as red in alignment, homolog P28842 colored as blue. Query protein AVX54630.1 is also shown in right top, homolog P28842 showed in right bottom. They are colored based on secondary structures. 

  AVX54630.1 MNNLIVLKGKFEPGKNTKKPNSPQIPKTSIIKLEDCYRILDQLIKASSFWKEQKIDINPIINVKYKRIISKSNRVSYLLLKSLQKNNEHIIGSSFLDELV 100
      P28842 ---------------------------------------------------------------------------------------------------- 0

  AVX54630.1 EKKIVKKQVITYCLTQKDLQEAIKRLDTITNILKKTHFKRIDNNLINLIANEQYLPIKKEIQKYEFLSRTAFIS-TL------VDLNYIEEIFIKTTHID 193
      P28842 --------------------------------------------------------MKRS-GK---IFTTAMLAVTLMMPAMGVSAN--E----GNAAAE 34

  AVX54630.1 NNVDSVVTLYDTGIKAID---LLN-KLDINVNMSDFI-DDYTLFLDRN--QYNELK-----T--KAPFL-ISMSVDD---L---------T----KFIID 262
      P28842 GN-EKFRVLVDS----VDQKNLKNAKQQYGVH-WDFAGEGFT--TDMNEKQFNALKKNKNLTVEKVPELEIATATDKPEALYNAMAASQSTPWGIKAIYN 126

  AVX54630.1 DKQEEITKND----I-ISIPDP---TNEP-IVGVIDTMFCKDVYFSKWVDFRKEVSDDILLDSKDYQHGTQVS-SIIVDG----------PSFN----KK 338
      P28842 NSS--ITQTSGGGGINIAVLDTGVNTNHPDLRNNVEQ--CKD--FTVGTTY----TNNSCTDRQG--HGTHVAGSALADGGTGNGVYGVAPDADLWAYKV 214

  AVX54630.1 L-EDGCG-----RFRVRHFGVMAHSSGNVFSLFKKIKSIVINNLDIKVWNLSLGSIREVSSNYISLLGSLLDQLQYENDVIFI-VAGTNDNECKQKIVGS 431
      P28842 LGDDGSGYADDIAAAIRHAGDQA-TALNT----K----VVI--------NMSLG-----SSGESSLITNAV-NYSYNKGVLIIAAAG-NSGP-YQGSIGY 289

  AVX54630.1 PADSINSIVVNSVDFKNKPANYSRKGPVLTYFNKPDISYYG-----GVDN--NK----ITVCGC--Y------GEAKVQGTSFAAPWITRKVAYLIYKM- 511
      P28842 PGALVNAVAVAALE--NKVEN----G---TY-RVADFSSRGYSWTDG-DYAIQKGDVEISAPGAAIYSTWFDGGYATISGTSMASP----HAAGLAAKIW 374

  AVX54630.1 -NYSKEEAKALIIDSAIKFDKQKDNNRDLI-GY------------GVVPIHINEILQSKNTDIKVLLSYNTKAYYTYNFNLPVPTKENKFPFIAKLTFAY 597
      P28842 AQYPS--ASNVDVRGELQY-RAYEN--DILSGYYAGYGDDFASGFGFATVQ------------------------------------------------- 420

  AVX54630.1 FAESQRSQGVDYTQDELDIQFGPIDNKSESINDINENNQSSSSSNAYIYEYEARKMFAKWNTVKSIIKWSKTNKGKKRQFIKTTNNRWGIRVIRKTRTDN 697
      P28842 ---------------------------------------------------------------------------------------------------- 420

  AVX54630.1 INNKSIKFSLVITFRSIDNKDRIEEFISLCNKSGYWVASKVQIDNKIDIHGKSNEYLDFE 757
      P28842 ------------------------------------------------------------ 420

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0004252 serine-type endopeptidase activity
2. PF GO:0005576 extracellular region
2. PF GO:0005615 extracellular space
4. PB GO:0006508 proteolysis
5. P GO:0004177 aminopeptidase activity
5. P GO:0040017 positive regulation of locomotion
5. P GO:0030070 insulin processing
5. P GO:0061837 neuropeptide processing
5. P GO:0048359 mucilage metabolic process involved in seed coat development
5. P GO:0010037 response to carbon dioxide
5. P GO:0048046 apoplast
5. P GO:1900425 negative regulation of defense response to bacterium
5. P GO:0010877 lipid transport involved in lipid storage
5. P GO:1904014 response to serotonin
5. P GO:0008240 tripeptidyl-peptidase activity
5. P GO:0008236 serine-type peptidase activity
5. P GO:0005802 trans-Golgi network
5. P GO:0030536 larval feeding behavior
5. P GO:0007635 chemosensory behavior
5. P GO:0070051 fibrinogen binding
5. P GO:1904810 negative regulation of dense core granule transport
5. P GO:0042730 fibrinolysis
5. P GO:2000038 regulation of stomatal complex development
5. P GO:0042784 evasion of host immune response via regulation of host complement system
5. P GO:1904731 positive regulation of intestinal lipid absorption
5. P GO:0043936 asexual sporulation resulting in formation of a cellular spore
5. P GO:1901046 positive regulation of oviposition
5. P GO:2000748 positive regulation of defecation rhythm
5. P GO:0030476 ascospore wall assembly
5. P GO:2000292 regulation of defecation
5. P GO:0030435 sporulation resulting in formation of a cellular spore
5. P GO:0080001 mucilage extrusion from seed coat
5. P GO:0005618 cell wall
5. P GO:0061096 negative regulation of turning behavior involved in mating
5. P GO:2001222 regulation of neuron migration
5. P GO:0090474 arg-arg specific dibasic protein processing
5. P GO:0090326 positive regulation of locomotion involved in locomotory behavior
5. P GO:0031638 zymogen activation
5. P GO:0090472 dibasic protein processing
5. P GO:0040011 locomotion
5. P GO:1905852 positive regulation of backward locomotion
5. P GO:0009610 response to symbiotic fungus
5. P GO:2000009 negative regulation of protein localization to cell surface
5. P GO:0010214 seed coat development
5. P GO:0050775 positive regulation of dendrite morphogenesis
5. P GO:0007274 neuromuscular synaptic transmission
5. P GO:0014057 positive regulation of acetylcholine secretion, neurotransmission
5. P GO:1903859 regulation of dendrite extension
5. P GO:1903998 regulation of eating behavior
5. P GO:1903861 positive regulation of dendrite extension
5. P GO:2000122 negative regulation of stomatal complex development
5. P GO:0098770 FBXO family protein binding
5. P GO:0036010 protein localization to endosome
5. P GO:0060456 positive regulation of digestive system process
5. P GO:0008239 dipeptidyl-peptidase activity
5. P GO:0008582 regulation of synaptic assembly at neuromuscular junction
5. P GO:0045887 positive regulation of synaptic assembly at neuromuscular junction
5. P GO:0005619 ascospore wall
5. P GO:0043058 regulation of backward locomotion
5. P GO:0040002 collagen and cuticulin-based cuticle development
5. P GO:0009567 double fertilization forming a zygote and endosperm
5. P GO:0070593 dendrite self-avoidance
5. P GO:0016486 peptide hormone processing
5. P GO:0036377 arbuscular mycorrhizal association
5. P GO:1905954 positive regulation of lipid localization
5. P GO:0016485 protein processing
5. P GO:1900073 regulation of neuromuscular synaptic transmission
5. P GO:0090558 plant epidermis development
5. P GO:1900006 positive regulation of dendrite development
5. P GO:0019863 IgE binding
5. P GO:0099503 secretory vesicle
5. P GO:0048814 regulation of dendrite morphogenesis
5. P GO:0006956 complement activation
5. P GO:1905885 positive regulation of triglyceride transport
5. P GO:0030421 defecation
5. P GO:0035418 protein localization to synapse
5. P GO:0006937 regulation of muscle contraction
5. P GO:0060309 elastin catabolic process
5. P GO:2000294 positive regulation of defecation
5. P GO:1905910 negative regulation of dauer entry
5. P GO:0009860 pollen tube growth
5. P GO:1902075 cellular response to salt
5. P GO:0030173 integral component of Golgi membrane
5. P GO:0090325 regulation of locomotion involved in locomotory behavior
5. P GO:1905850 positive regulation of forward locomotion
7. B GO:0031293 membrane protein intracellular domain proteolysis
7. B GO:0007040 lysosome organization
7. B GO:0036500 ATF6-mediated unfolded protein response
7. B GO:0030968 endoplasmic reticulum unfolded protein response
7. B GO:0030574 collagen catabolic process
7. B GO:0006629 lipid metabolic process
7. B GO:0005788 endoplasmic reticulum lumen
7. B GO:0008233 peptidase activity
7. B GO:0045540 regulation of cholesterol biosynthetic process
7. B GO:0008203 cholesterol metabolic process
7. B GO:0005794 Golgi apparatus
7. B GO:0005795 Golgi stack
7. B GO:0034976 response to endoplasmic reticulum stress
7. B GO:0060627 regulation of vesicle-mediated transport
7. B GO:0005789 endoplasmic reticulum membrane
7. B GO:0000139 Golgi membrane

Uniprot GO Annotations

GO Description
GO:0006508 proteolysis
GO:0008236 serine-type peptidase activity
GO:0004252 serine-type endopeptidase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF D4AQA9 Subtilisin-like protease 12 5.21e-04 1.95e-02 NA 0.4579
5. P F4JJH4 Subtilisin-like protease SBT3.1 6.22e-02 1.69e-02 NA NA
5. P P16588 Alkaline serine exoprotease A 1.73e-04 1.66e-05 NA NA
5. P O31788 Serine protease AprX 2.93e-04 2.51e-02 NA NA
5. P O65351 Subtilisin-like protease SBT1.7 7.68e-02 5.47e-03 NA NA
5. P B0Y473 Alkaline protease 2 2.02e-03 3.30e-04 NA NA
5. P P00783 Subtilisin amylosacchariticus 2.39e-04 6.41e-03 NA NA
5. P P41362 Alkaline protease 1.80e-03 1.12e-02 NA NA
5. P Q9FI12 Subtilisin-like protease SBT2.3 3.12e-02 1.08e-03 NA NA
5. P O64481 Subtilisin-like protease SBT2.5 2.71e-01 4.55e-02 NA NA
5. P Q1PDX5 Subtilisin-like protease SBT3.11 1.11e-02 3.63e-02 NA NA
5. P P58502 Tk-subtilisin 1.32e-04 6.21e-03 NA NA
5. P B3V0K8 Subtilisin-like serine protease Cur l 4.0101 2.43e-03 2.93e-06 NA NA
5. P Q9FHA4 Subtilisin-like protease SBT1.9 7.59e-02 3.35e-02 NA NA
5. P P87184 Alkaline protease 2 1.65e-03 3.30e-04 NA NA
5. P Q9SA75 Subtilisin-like protease SBT2.1 3.72e-01 2.03e-03 NA NA
5. P Q1J501 Xaa-Pro dipeptidyl-peptidase 6.51e-01 1.11e-02 NA NA
5. P P28842 Subtilisin 6.45e-05 9.95e-05 NA NA
5. P Q9C7U8 Subtilisin-like protease SBT3.17 3.55e-02 1.69e-02 NA NA
5. P Q48RI5 Xaa-Pro dipeptidyl-peptidase 6.74e-01 4.60e-02 NA NA
5. P Q8L376 Xaa-Pro dipeptidyl-peptidase 6.18e-01 3.32e-02 NA NA
5. P Q03H46 Xaa-Pro dipeptidyl-peptidase 5.99e-01 3.63e-02 NA NA
5. P O17798 Furin-like protease kpc-1 3.50e-03 1.94e-03 NA NA
5. P Q03J44 Xaa-Pro dipeptidyl-peptidase 7.15e-01 2.53e-02 NA NA
5. P P04189 Subtilisin E 1.12e-03 6.21e-03 NA NA
5. P Q5RLZ1 Halolysin-like extracellular serine protease Nep 1.93e-04 2.53e-02 NA NA
5. P P23314 Extracellular protease 1.12e-03 2.55e-07 NA NA
5. P P27693 Alkaline protease 2.81e-03 8.58e-03 NA NA
5. P A1CWF3 Alkaline protease 1 1.95e-04 4.13e-02 NA NA
5. P A0A0M3R8G2 Subtilisin-like protease 7.03e-02 1.95e-02 NA NA
5. P P00782 Subtilisin BPN' 1.28e-03 4.25e-02 NA NA
5. P Q9ZSB0 Subtilisin-like protease SBT3.9 1.36e-02 9.42e-03 NA NA
5. P Q1JF50 Xaa-Pro dipeptidyl-peptidase 6.40e-01 2.48e-02 NA NA
5. P Q84WS0 Subtilisin-like protease SBT1.1 4.96e-02 4.93e-02 NA NA
5. P P42780 Extracellular subtilisin-like protease 9.62e-04 4.52e-05 NA NA
5. P C5P4Z8 Subtilisin-like protease CPC735_031240 1.15e-03 6.84e-05 NA NA
5. P P23916 Calcium-dependent protease 1.06e-03 1.90e-14 NA NA
5. P Q5XA40 Xaa-Pro dipeptidyl-peptidase 6.52e-01 4.01e-02 NA NA
5. P P9WEW6 Subtilisin-like serine protease EN45_078720 1.41e-03 1.77e-05 NA NA
5. P Q8GMC0 Xaa-Pro dipeptidyl-peptidase 6.03e-01 2.07e-02 NA NA
5. P A9QY40 Subtilisin-like protease 1 1.19e-02 1.71e-02 NA NA
5. P B7ZK61 Subtilisin-like serine protease Cla h 9.0101 1.50e-03 1.91e-04 NA NA
5. P P0DD36 Xaa-Pro dipeptidyl-peptidase 6.26e-01 3.22e-02 NA NA
5. P Q9SUN6 Subtilisin-like protease SBT2.2 4.22e-02 1.24e-03 NA NA
5. P Q9LNU1 CO(2)-response secreted protease 2.08e-02 4.29e-03 NA NA
5. P P35835 Subtilisin NAT 2.22e-04 7.98e-03 NA NA
5. P A2RCP2 Xaa-Pro dipeptidyl-peptidase 6.53e-01 4.34e-02 NA NA
5. P P9WEW5 Subtilisin-like serine protease Pen ch 18 9.87e-04 1.77e-05 NA NA
5. P Q8SS86 Putative subtilisin-like proteinase 2 1.17e-02 8.75e-05 NA NA
5. P Q1WRZ1 Xaa-Pro dipeptidyl-peptidase 5.99e-01 2.18e-02 NA NA
5. P Q99Y58 Xaa-Pro dipeptidyl-peptidase 6.50e-01 2.80e-02 NA NA
5. P Q8GWX9 Subtilisin-like protease SBT3.16 2.07e-02 1.90e-03 NA NA
5. P G7KEU7 Subtilisin-like protease 8.51e-03 3.02e-03 NA NA
5. P F4HYR6 Subtilisin-like protease SBT2.4 1.18e-01 3.29e-03 NA NA
5. P Q3JZF9 Xaa-Pro dipeptidyl-peptidase 6.26e-01 1.62e-03 NA NA
5. P Q9SZY2 Subtilisin-like protease SBT3.7 3.37e-02 3.22e-02 NA NA
5. P Q07596 Nisin leader peptide-processing serine protease NisP 1.02e-02 4.88e-02 NA NA
5. P P29143 Halolysin 6.71e-04 1.23e-02 NA NA
5. P G5ECN9 Neuroendocrine convertase 2 1.77e-03 2.43e-02 NA NA
5. P P0DD37 Xaa-Pro dipeptidyl-peptidase 6.46e-01 3.22e-02 NA NA
5. P P29142 Subtilisin J 2.34e-04 6.48e-03 NA NA
5. P P08594 Aqualysin-1 6.75e-04 7.04e-03 NA NA
5. P Q8NZH6 Xaa-Pro dipeptidyl-peptidase 6.47e-01 2.36e-02 NA NA
5. P D4DKQ4 Subtilisin-like protease 8 7.88e-04 1.12e-04 NA NA
5. P D4AX50 Subtilisin-like protease 8 2.32e-03 1.62e-04 NA NA
5. P Q9FIM8 Subtilisin-like protease SBT4.10 1.49e-02 3.12e-02 NA NA
5. P P28296 Alkaline protease 1 2.44e-04 3.00e-02 NA NA
5. P P91863 Endoprotease aex-5 7.52e-04 6.41e-03 NA NA
5. P F4JJH5 Subtilisin-like protease SBT3.12 6.50e-02 1.10e-03 NA NA
5. P Q9MAP4 Subtilisin-like protease SBT3.2 3.25e-01 4.09e-02 NA NA
5. P Q9STQ2 Subtilisin-like protease SBT3.18 3.07e-02 4.05e-02 NA NA
5. P Q59149 Calcium-dependent protease 1.13e-03 6.02e-14 NA NA
5. P P42790 Pseudomonalisin 1.83e-03 1.97e-03 NA NA
5. P Q8E3H8 Xaa-Pro dipeptidyl-peptidase 5.98e-01 2.21e-03 NA NA
5. P I3R794 Halolysin 1.88e-04 2.29e-03 NA NA
5. P P33295 Subtilisin-like serine protease pepC 1.34e-03 2.27e-02 NA NA
5. P Q8DXW0 Xaa-Pro dipeptidyl-peptidase 6.39e-01 1.62e-03 NA NA
5. P P58371 Subtilisin-like proteinase Spm1 1.49e-03 8.32e-03 NA NA
5. P C5FII2 Subtilisin-like protease 8 1.18e-03 7.69e-05 NA NA
5. P F4HSQ2 Subtilisin-like protease SBT5.1 8.14e-02 9.34e-04 NA NA
5. P A3CKT0 Xaa-Pro dipeptidyl-peptidase 7.23e-01 2.74e-02 NA NA
5. P Q8DVS2 Xaa-Pro dipeptidyl-peptidase 6.21e-01 4.21e-02 NA NA
5. P P29145 PC3-like endoprotease variant B 3.11e-03 2.29e-02 NA NA
5. P C5PGK9 Subtilisin-like protease CPC735_050320 1.36e-04 4.69e-02 NA NA
5. P Q60106 Xanthomonalisin 6.95e-03 2.15e-05 NA NA
5. P P42779 Extracellular basic protease 1.89e-03 3.82e-03 NA NA
5. P B0Y708 Alkaline protease 1 1.65e-04 3.00e-02 NA NA
5. P Q9P8G3 Subtilisin-like serine protease Pen ch 18.0101 9.45e-04 1.20e-05 NA NA
5. P P25381 Subtilase-type proteinase RRT12 6.22e-04 1.78e-04 NA NA
5. P E4UPZ4 Subtilisin-like protease 1 2.72e-03 2.29e-03 NA NA
5. P Q9Y755 Subtilisin-like serine protease Pen c 2 1.37e-03 4.64e-02 NA NA
5. P P30199 Epidermin leader peptide-processing serine protease EpiP 1.51e-04 4.01e-02 NA NA
5. P P29141 Minor extracellular protease vpr 1.39e-02 1.42e-03 NA NA
5. P Q99405 M-protease 2.21e-03 1.39e-02 NA NA
5. P Q93LQ6 Fervidolysin 4.06e-03 4.01e-05 NA NA
5. P A0A044RE18 Endoprotease bli 1.87e-03 3.59e-03 NA NA
6. F P09230 Alkaline extracellular protease 2.24e-04 NA NA 0.5115
6. F D4D5H3 Subtilisin-like protease 6 1.19e-03 NA NA 0.4697
7. B Q9Z2A8 Membrane-bound transcription factor site-1 protease 1.57e-02 NA 0.035 NA
7. B Q5JIZ5 Subtilisin-like serine protease 1.03e-04 NA 3.16e-04 NA
7. B Q14703 Membrane-bound transcription factor site-1 protease 5.20e-03 NA 0.025 NA
7. B Q9WTZ3 Membrane-bound transcription factor site-1 protease 9.33e-03 NA 0.031 NA
7. B L8FSM5 Subtilisin-like protease 2 9.04e-05 NA 0.007 NA
7. B G3FNQ9 Cuticle-degrading serine protease 6.80e-04 NA 0.030 NA