Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54633.1
JCVISYN3A_0139

NanoRNAse.
M. mycoides homolog: Q6MU91.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 29
Unique PROST Go: 4
Unique BLAST Go: 3
Unique Foldseek Go: 12

Total Homologs: 238
Unique PROST Homologs: 12
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 117

Literature

Danchin and Fang [1]: nanoRNase|degradation of oligonucleotides shorter than 5nt
Yang and Tsui [2]: Phosphoesterase DHH family protein
Antczak et al. [3]: Manganese binding DHH-family phosphoesterase
Zhang et al. [4]: GO:0004427|inorganic diphosphatase activity
Bianchi et al. [5]: nanoRNAse/PAP phosphatase

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O34600 (Bifunctional oligoribonuclease and PAP phosphatase NrnA) with a FATCAT P-Value: 0 and RMSD of 2.91 angstrom. The sequence alignment identity is 33.4%.
Structural alignment shown in left. Query protein AVX54633.1 colored as red in alignment, homolog O34600 colored as blue. Query protein AVX54633.1 is also shown in right top, homolog O34600 showed in right bottom. They are colored based on secondary structures. 

  AVX54633.1 MLDQKKSQLLLDKIKQYQNIIITKHKQPDWDAQGSAIGLANIINDNFKNKTIYVVGSRISDDD-SFF--IDETNLSDEFVKNSLIITVDTATKKRVDFNR 97
      O34600 M----KTE-LIRTISLYDTIILHRHVRPDPDAYGSQCGLTEILRETYPEKNIFAVGT--PEPSLSFLYSLDE--VDNETYEGALVIVCDTANQERIDDQR 91

  AVX54633.1 FDLSCDSFKIDHHINVED-YCKNDLI-DDSSISN-TQVI-SL--------WALENDLFISPT-AAYNLYLGLLTDSNRFLYDKTNQTTF-YVASKLLE-- 181
      O34600 YPSGAKLMKIDHHPN-EDPY--GDLLWVDTSASSVSEMIYELYLEGKEHGWKL-N------TKAAELIYAGIVGDTGRFLFPNTTEKTLKY-AGELIQYP 180

  AVX54633.1 -AGANLKKANDFLYVSDL---KLRQWVMYSFSKMKLTNTGIAYIVLLDED-LKDWDLS-YEETKL--ALSAMSGIKEIKIWFTIIQVEDILKVSLRSRDF 273
      O34600 FSSSEL--FNQ-LYETKLNVVKLNGFI---FQNVSLSENGAAS-VFIKKDTLEKFGTTASEASQLVGTLGNISGIRA---WVFFVEEDDQIRVRFRSKGP 270

  AVX54633.1 SIDKIANKYNGGGHRLASGAEISSLDQINDLINDLEQLIKGEQ- 316
      O34600 VINGLARKYNGGGHPLASGASIYSWDEADRILADLETLCK-EHE 313

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0004527 exonuclease activity
1. PBF GO:0004309 exopolyphosphatase activity
1. PBF GO:0008441 3'(2'),5'-bisphosphate nucleotidase activity
1. PBF GO:0003676 nucleic acid binding
1. PBF GO:0006798 polyphosphate catabolic process
2. PF GO:0005737 cytoplasm
2. PF GO:0004427 inorganic diphosphatase activity
2. PF GO:0006793 phosphorus metabolic process
2. PF GO:0030145 manganese ion binding
3. BF GO:0052929 ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity
5. P GO:1901857 positive regulation of cellular respiration
5. P GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity
5. P GO:0035641 locomotory exploration behavior
5. P GO:0006112 energy reserve metabolic process
6. F GO:0006412 translation
6. F GO:0003735 structural constituent of ribosome
6. F GO:0008409 5'-3' exonuclease activity
6. F GO:0005886 plasma membrane
6. F GO:0006419 alanyl-tRNA aminoacylation
6. F GO:0016021 integral component of membrane
6. F GO:0008270 zinc ion binding
6. F GO:0016597 amino acid binding
6. F GO:0004813 alanine-tRNA ligase activity
6. F GO:0002161 aminoacyl-tRNA editing activity
6. F GO:0000049 tRNA binding
6. F GO:0005524 ATP binding
7. B GO:0030435 sporulation resulting in formation of a cellular spore
7. B GO:0006813 potassium ion transport
7. B GO:0016787 hydrolase activity

Uniprot GO Annotations

GO Description
GO:0003676 nucleic acid binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P22746 Bifunctional oligoribonuclease and PAP phosphatase NrnA 0.00e+00 9.38e-58 1.55e-40 0.8261
1. PBF Q8DTN6 Probable bifunctional oligoribonuclease and PAP phosphatase NrnA 0.00e+00 3.13e-63 1.39e-50 0.8641
1. PBF O34600 Bifunctional oligoribonuclease and PAP phosphatase NrnA 0.00e+00 2.30e-63 3.77e-43 0.8477
1. PBF Q5SM25 Bifunctional oligoribonuclease and PAP phosphatase NrnA 0.00e+00 2.38e-50 9.20e-12 0.8045
1. PBF P75229 Uncharacterized protein MG371 homolog 0.00e+00 8.73e-59 7.37e-36 0.8398
1. PBF Q49428 Uncharacterized protein MG371 0.00e+00 1.56e-59 2.88e-44 0.851
1. PBF P75144 Bifunctional oligoribonuclease and PAP phosphatase NrnA 0.00e+00 2.85e-59 1.15e-36 0.7893
2. PF Q5XDN3 Probable manganese-dependent inorganic pyrophosphatase 8.73e-08 1.24e-10 NA 0.4804
2. PF Q04JL5 Probable manganese-dependent inorganic pyrophosphatase 8.02e-08 9.24e-10 NA 0.4706
2. PF Q6GFD7 Probable manganese-dependent inorganic pyrophosphatase 1.81e-09 2.59e-12 NA 0.4751
2. PF Q74JD5 Probable manganese-dependent inorganic pyrophosphatase 6.61e-08 9.30e-13 NA 0.4615
2. PF B5E699 Probable manganese-dependent inorganic pyrophosphatase 8.43e-08 9.24e-10 NA 0.4649
2. PF B7HUD5 Probable manganese-dependent inorganic pyrophosphatase 2.05e-06 2.67e-11 NA 0.4818
2. PF Q8CUT9 Probable manganese-dependent inorganic pyrophosphatase 4.66e-09 8.39e-12 NA 0.4897
2. PF Q043J4 Probable manganese-dependent inorganic pyrophosphatase 7.00e-08 1.25e-12 NA 0.4802
2. PF Q04AP3 Probable manganese-dependent inorganic pyrophosphatase 8.43e-08 5.56e-11 NA 0.4692
2. PF P0DD14 Probable manganese-dependent inorganic pyrophosphatase 8.97e-08 1.24e-10 NA 0.4858
2. PF Q8DYS6 Probable manganese-dependent inorganic pyrophosphatase 8.20e-08 1.54e-09 NA 0.4825
2. PF Q5M5T1 Probable manganese-dependent inorganic pyrophosphatase 1.17e-07 3.31e-10 NA 0.4722
2. PF B8DE62 Probable manganese-dependent inorganic pyrophosphatase 1.22e-07 2.11e-13 NA 0.4892
2. PF P0DD15 Probable manganese-dependent inorganic pyrophosphatase 9.81e-08 1.24e-10 NA 0.4802
2. PF B7HA46 Probable manganese-dependent inorganic pyrophosphatase 2.11e-06 2.91e-11 NA 0.4818
2. PF Q65E18 Probable manganese-dependent inorganic pyrophosphatase 1.38e-07 7.31e-10 NA 0.4787
2. PF Q88W32 Probable manganese-dependent inorganic pyrophosphatase 1.19e-09 1.62e-12 NA 0.4962
2. PF B1YLU2 Probable manganese-dependent inorganic pyrophosphatase 2.56e-09 1.30e-11 NA 0.4795
2. PF C1CLN3 Probable manganese-dependent inorganic pyrophosphatase 8.28e-08 9.24e-10 NA 0.4638
2. PF Q2YU53 Probable manganese-dependent inorganic pyrophosphatase 1.74e-09 2.59e-12 NA 0.4749
2. PF A4W395 Probable manganese-dependent inorganic pyrophosphatase 9.61e-08 2.29e-10 NA 0.4887
2. PF P65755 Probable manganese-dependent inorganic pyrophosphatase 9.02e-08 9.24e-10 NA 0.464
2. PF C0M7N7 Probable manganese-dependent inorganic pyrophosphatase 7.15e-08 2.80e-10 NA 0.4667
2. PF Q9CEM5 Probable manganese-dependent inorganic pyrophosphatase 1.35e-07 3.22e-12 NA 0.4645
2. PF P95765 Probable manganese-dependent inorganic pyrophosphatase 8.28e-08 8.62e-11 NA 0.4815
2. PF A0AIQ0 Probable manganese-dependent inorganic pyrophosphatase 1.70e-07 3.61e-14 NA 0.4838
2. PF Q5HEK1 Probable manganese-dependent inorganic pyrophosphatase 1.69e-09 2.59e-12 NA 0.472
2. PF Q71ZM2 Probable manganese-dependent inorganic pyrophosphatase 1.98e-07 2.14e-13 NA 0.4871
2. PF A6U325 Probable manganese-dependent inorganic pyrophosphatase 1.71e-09 2.59e-12 NA 0.475
2. PF Q81PH9 Probable manganese-dependent inorganic pyrophosphatase 2.41e-07 2.83e-11 NA 0.4818
2. PF B9DMR8 Probable manganese-dependent inorganic pyrophosphatase 1.23e-09 2.83e-11 NA 0.4729
2. PF Q81CE5 Probable manganese-dependent inorganic pyrophosphatase 1.72e-06 2.91e-11 NA 0.483
2. PF Q5FK05 Probable manganese-dependent inorganic pyrophosphatase 7.27e-08 3.99e-12 NA 0.473
2. PF C1KV95 Probable manganese-dependent inorganic pyrophosphatase 2.29e-07 2.22e-13 NA 0.4825
2. PF P65752 Probable manganese-dependent inorganic pyrophosphatase 1.74e-09 2.59e-12 NA 0.4753
2. PF Q3K0B5 Probable manganese-dependent inorganic pyrophosphatase 8.43e-08 1.54e-09 NA 0.4601
2. PF A2RG81 Probable manganese-dependent inorganic pyrophosphatase 7.92e-08 1.24e-10 NA 0.4617
2. PF Q8CNN7 Probable manganese-dependent inorganic pyrophosphatase 1.23e-09 2.06e-11 NA 0.4793
2. PF Q2FFH6 Probable manganese-dependent inorganic pyrophosphatase 1.81e-09 2.59e-12 NA 0.4763
2. PF Q5HN17 Probable manganese-dependent inorganic pyrophosphatase 1.27e-09 1.21e-11 NA 0.4792
2. PF C1CSF2 Probable manganese-dependent inorganic pyrophosphatase 9.10e-08 9.24e-10 NA 0.4576
2. PF A8YVH1 Probable manganese-dependent inorganic pyrophosphatase 7.05e-08 1.40e-11 NA 0.4697
2. PF B7IJP9 Probable manganese-dependent inorganic pyrophosphatase 1.98e-06 4.69e-11 NA 0.4826
2. PF Q5WDX3 Probable manganese-dependent inorganic pyrophosphatase 2.77e-09 1.96e-12 NA 0.4733
2. PF C4L0S9 Probable manganese-dependent inorganic pyrophosphatase 1.47e-07 1.98e-10 NA 0.4814
2. PF A7ZAR2 Probable manganese-dependent inorganic pyrophosphatase 9.39e-08 2.49e-10 NA 0.4977
2. PF P65759 Probable manganese-dependent inorganic pyrophosphatase 8.88e-08 1.24e-10 NA 0.4579
2. PF B9DTT7 Probable manganese-dependent inorganic pyrophosphatase 6.44e-08 1.64e-10 NA 0.4598
2. PF Q03M65 Probable manganese-dependent inorganic pyrophosphatase 1.15e-07 3.47e-10 NA 0.4891
2. PF B2IR53 Probable manganese-dependent inorganic pyrophosphatase 8.04e-08 9.24e-10 NA 0.465
2. PF B7JRU3 Probable manganese-dependent inorganic pyrophosphatase 2.08e-07 2.83e-11 NA 0.4817
2. PF Q6G813 Probable manganese-dependent inorganic pyrophosphatase 1.85e-09 2.59e-12 NA 0.4717
2. PF P65757 Probable manganese-dependent inorganic pyrophosphatase 8.33e-08 1.24e-10 NA 0.4797
2. PF O25683 3',5'-cyclic-nucleotide phosphodiesterase 3.53e-04 8.85e-20 NA 0.2584
2. PF A3CPM5 Probable manganese-dependent inorganic pyrophosphatase 1.07e-07 1.26e-08 NA 0.4632
2. PF C1EXV7 Probable manganese-dependent inorganic pyrophosphatase 1.80e-06 1.21e-11 NA 0.4877
2. PF B1ICV4 Probable manganese-dependent inorganic pyrophosphatase 8.24e-08 9.24e-10 NA 0.4647
2. PF B5XJY9 Probable manganese-dependent inorganic pyrophosphatase 1.02e-07 2.26e-10 NA 0.4799
2. PF A8FJD5 Probable manganese-dependent inorganic pyrophosphatase 2.08e-09 1.89e-08 NA 0.5003
2. PF P65754 Probable manganese-dependent inorganic pyrophosphatase 1.67e-09 2.59e-12 NA 0.4756
2. PF O29502 Probable manganese-dependent inorganic pyrophosphatase 2.18e-07 3.10e-12 NA 0.479
2. PF A7GQ01 Probable manganese-dependent inorganic pyrophosphatase 2.15e-07 7.73e-11 NA 0.4848
2. PF B4U4N8 Probable manganese-dependent inorganic pyrophosphatase 6.42e-08 7.48e-10 NA 0.4616
2. PF O68579 Probable manganese-dependent inorganic pyrophosphatase 1.21e-07 2.44e-11 NA 0.4628
2. PF C1C8C3 Probable manganese-dependent inorganic pyrophosphatase 8.64e-08 9.24e-10 NA 0.4576
2. PF Q8Y757 Probable manganese-dependent inorganic pyrophosphatase 1.20e-07 2.22e-13 NA 0.4924
2. PF A0B5R0 Manganese-dependent inorganic pyrophosphatase 8.48e-08 8.05e-09 NA 0.5029
2. PF B9J353 Probable manganese-dependent inorganic pyrophosphatase 1.82e-06 3.95e-11 NA 0.4819
2. PF C0ZGL2 Probable manganese-dependent inorganic pyrophosphatase 2.23e-09 4.47e-11 NA 0.4972
2. PF Q9RRB7 Probable manganese-dependent inorganic pyrophosphatase 7.23e-09 1.97e-09 NA 0.4526
2. PF A8Z2T4 Probable manganese-dependent inorganic pyrophosphatase 1.79e-09 2.59e-12 NA 0.4747
2. PF Q8E4D4 Probable manganese-dependent inorganic pyrophosphatase 8.08e-08 1.10e-09 NA 0.46
2. PF Q49YW3 Probable manganese-dependent inorganic pyrophosphatase 9.38e-08 1.08e-11 NA 0.4657
2. PF C1CFB5 Probable manganese-dependent inorganic pyrophosphatase 9.91e-08 9.24e-10 NA 0.4576
2. PF Q1GAB5 Probable manganese-dependent inorganic pyrophosphatase 8.18e-08 2.52e-10 NA 0.4686
2. PF C3LG25 Probable manganese-dependent inorganic pyrophosphatase 1.87e-06 2.83e-11 NA 0.486
2. PF Q5M194 Probable manganese-dependent inorganic pyrophosphatase 1.18e-07 3.31e-10 NA 0.4722
2. PF C3PD52 Probable manganese-dependent inorganic pyrophosphatase 1.97e-06 2.83e-11 NA 0.4831
2. PF Q63AC7 Probable manganese-dependent inorganic pyrophosphatase 2.34e-07 3.54e-11 NA 0.4838
2. PF Q6HHR6 Probable manganese-dependent inorganic pyrophosphatase 2.21e-07 2.83e-11 NA 0.4892
2. PF A9VIG8 Probable manganese-dependent inorganic pyrophosphatase 1.97e-06 1.60e-11 NA 0.4835
2. PF P65756 Probable manganese-dependent inorganic pyrophosphatase 8.69e-08 9.24e-10 NA 0.4633
2. PF Q97H75 Probable manganese-dependent inorganic pyrophosphatase 5.42e-08 9.97e-11 NA 0.496
2. PF B8ZLD4 Probable manganese-dependent inorganic pyrophosphatase 7.77e-08 9.24e-10 NA 0.4573
2. PF A7X451 Probable manganese-dependent inorganic pyrophosphatase 1.71e-09 2.59e-12 NA 0.4771
2. PF A5IU87 Probable manganese-dependent inorganic pyrophosphatase 1.85e-09 2.59e-12 NA 0.4749
2. PF Q834N3 Probable manganese-dependent inorganic pyrophosphatase 2.69e-09 1.96e-10 NA 0.4819
2. PF A4VWZ2 Probable manganese-dependent inorganic pyrophosphatase 9.58e-08 2.72e-09 NA 0.4852
2. PF P37487 Manganese-dependent inorganic pyrophosphatase 8.49e-08 9.94e-08 NA 0.4963
2. PF P65753 Probable manganese-dependent inorganic pyrophosphatase 1.99e-09 2.59e-12 NA 0.4722
2. PF Q4L7N2 Probable manganese-dependent inorganic pyrophosphatase 1.57e-09 3.52e-12 NA 0.4816
2. PF Q92BR1 Probable manganese-dependent inorganic pyrophosphatase 2.10e-07 5.84e-13 NA 0.4851
2. PF Q736P6 Probable manganese-dependent inorganic pyrophosphatase 2.05e-06 4.05e-11 NA 0.4818
2. PF C0MGI9 Probable manganese-dependent inorganic pyrophosphatase 6.94e-08 3.68e-10 NA 0.4619
3. BF A0A0H3GCG4 Cyclic-di-AMP phosphodiesterase PdeA 1.92e-14 NA 6.48e-09 0.7641
3. BF A4ITV2 Cyclic-di-AMP phosphodiesterase GdpP 2.80e-14 NA 7.38e-07 0.7457
3. BF O66728 A-adding tRNA nucleotidyltransferase 9.14e-10 NA 3.00e-04 0.6995
3. BF Q6YRK2 50S ribosomal protein L9 9.29e-13 NA 4.95e-12 0.7448
3. BF Q2NKC0 50S ribosomal protein L9 2.55e-12 NA 6.41e-10 0.7257
3. BF P37484 Cyclic-di-AMP phosphodiesterase GdpP 2.38e-14 NA 6.87e-07 0.7476
4. PB P71615 Bifunctional oligoribonuclease and PAP phosphatase NrnA 9.99e-16 1.64e-45 2.20e-10 NA
5. P Q9HB07 MYG1 exonuclease 6.71e-02 1.38e-02 NA NA
5. P Q58395 Uncharacterized protein MJ0988 5.83e-14 1.29e-23 NA NA
5. P O17606 MYG1 protein C27H6.8 2.83e-02 3.82e-03 NA NA
5. P Q58387 Single-stranded-DNA-specific exonuclease RecJ 7.47e-04 2.03e-02 NA NA
5. P P38698 Exopolyphosphatase 2.59e-06 1.36e-07 NA NA
5. P O14094 Putative exopolyphosphatase 2.35e-06 4.63e-07 NA NA
5. P Q58025 Manganese-dependent inorganic pyrophosphatase 3.79e-07 3.40e-08 NA NA
5. P Q55G91 MYG1 protein 5.63e-02 2.80e-02 NA NA
5. P Q58241 Uncharacterized protein MJ0831 1.02e-04 2.37e-04 NA NA
5. P Q2FWY1 Probable manganese-dependent inorganic pyrophosphatase 1.79e-09 2.59e-12 NA NA
5. P P40093 MYG1 protein YER156C 9.86e-02 2.40e-02 NA NA
5. P P20191 Uncharacterized protein rrnAC1427 7.76e-05 8.26e-05 NA NA
6. F A1VEQ6 Alanine--tRNA ligase 8.68e-02 NA NA 0.3983
6. F B0BNS8 Alanine--tRNA ligase 4.72e-02 NA NA 0.3941
6. F A5ICV6 Alanine--tRNA ligase 7.87e-02 NA NA 0.4109
6. F A7MYT5 Alanine--tRNA ligase 9.35e-02 NA NA 0.4461
6. F B2KAQ0 Alanine--tRNA ligase 1.26e-01 NA NA 0.4701
6. F Q5X4B7 Alanine--tRNA ligase 7.76e-02 NA NA 0.4137
6. F Q04JW5 Alanine--tRNA ligase 1.42e-01 NA NA 0.3885
6. F Q2GEP2 Alanine--tRNA ligase 8.33e-02 NA NA 0.4716
6. F Q71ZG6 Alanine--tRNA ligase 6.84e-02 NA NA 0.4283
6. F A4S051 Alanine--tRNA ligase, chloroplastic/mitochondrial 5.61e-02 NA NA 0.3782
6. F B0K994 Alanine--tRNA ligase 8.07e-02 NA NA 0.4505
6. F Q0SS42 Alanine--tRNA ligase 4.97e-02 NA NA 0.3993
6. F A0RJ00 Alanine--tRNA ligase 6.95e-02 NA NA 0.3926
6. F Q474F4 Alanine--tRNA ligase 5.57e-02 NA NA 0.4332
6. F Q1J5Z4 Alanine--tRNA ligase 2.01e-01 NA NA 0.4194
6. F A0Q151 Alanine--tRNA ligase 6.94e-02 NA NA 0.4328
6. F Q1D084 Alanine--tRNA ligase 5.90e-02 NA NA 0.3672
6. F P61699 Alanine--tRNA ligase 7.99e-02 NA NA 0.3835
6. F Q9X1B6 Alanine--tRNA ligase 9.35e-02 NA NA 0.3996
6. F A6WCF7 Alanine--tRNA ligase 1.01e-01 NA NA 0.4023
6. F A7I206 Alanine--tRNA ligase 8.62e-02 NA NA 0.3286
6. F A6TCV9 Alanine--tRNA ligase 8.56e-02 NA NA 0.4263
6. F A3M3W2 Alanine--tRNA ligase 1.62e-01 NA NA 0.387
6. F Q9CCT0 Alanine--tRNA ligase 6.95e-02 NA NA 0.4
6. F B2THN0 Alanine--tRNA ligase 5.77e-02 NA NA 0.4239
6. F Q1CLK9 Alanine--tRNA ligase 5.56e-02 NA NA 0.3948
6. F Q5HNT2 Alanine--tRNA ligase 1.61e-01 NA NA 0.3998
6. F A7H4N3 Alanine--tRNA ligase 2.30e-01 NA NA 0.3973
6. F O67323 Alanine--tRNA ligase 1.16e-01 NA NA 0.4488
6. F B2HWK7 Alanine--tRNA ligase 1.56e-01 NA NA 0.424
6. F B1VDL4 Alanine--tRNA ligase 7.04e-02 NA NA 0.3872
6. F A9NGN9 Alanine--tRNA ligase 2.58e-01 NA NA 0.5104
6. F B0VAI3 Alanine--tRNA ligase 1.57e-01 NA NA 0.3858
6. F A8F078 Alanine--tRNA ligase 1.79e-01 NA NA 0.3725
6. F A8YTJ0 Alanine--tRNA ligase 5.92e-02 NA NA 0.3838
6. F Q74CU0 A-adding tRNA nucleotidyltransferase 6.40e-10 NA NA 0.7596
6. F A6VA71 Alanine--tRNA ligase 4.62e-02 NA NA 0.439
6. F Q5XBH1 Alanine--tRNA ligase 7.99e-02 NA NA 0.4068
6. F Q9WZ56 Probable manganese-dependent inorganic pyrophosphatase 3.14e-04 NA NA 0.3947
6. F Q5ZUJ9 Alanine--tRNA ligase 6.26e-02 NA NA 0.4186
6. F B0BVK9 Alanine--tRNA ligase 1.92e-01 NA NA 0.3786
6. F Q64YB4 Alanine--tRNA ligase 7.83e-02 NA NA 0.4166
6. F B2V3W2 Alanine--tRNA ligase 5.37e-02 NA NA 0.3879
6. F Q48SS4 Alanine--tRNA ligase 7.94e-02 NA NA 0.4138
6. F Q048Z3 Alanine--tRNA ligase 8.56e-02 NA NA 0.3646
6. F P28355 Single-stranded-DNA-specific exonuclease RecJ 6.13e-06 NA NA 0.5063
6. F B0S104 Alanine--tRNA ligase 4.14e-02 NA NA 0.3785
6. F A1AZL6 Alanine--tRNA ligase 1.56e-01 NA NA 0.4513
6. F B0B8X5 Alanine--tRNA ligase 1.16e-01 NA NA 0.3947
6. F Q03LZ8 Alanine--tRNA ligase 9.59e-02 NA NA 0.405
6. F Q0I426 Alanine--tRNA ligase 6.19e-02 NA NA 0.4254
6. F Q7N7A5 Alanine--tRNA ligase 5.38e-02 NA NA 0.4525
6. F Q6LMU3 Alanine--tRNA ligase 9.53e-02 NA NA 0.4402
6. F A8H1T6 Alanine--tRNA ligase 5.83e-02 NA NA 0.436
6. F P45112 Single-stranded-DNA-specific exonuclease RecJ 3.88e-06 NA NA 0.4802
6. F Q817Z0 Alanine--tRNA ligase 7.57e-02 NA NA 0.3948
6. F Q03R43 Alanine--tRNA ligase 9.01e-02 NA NA 0.3732
6. F Q12PX7 Alanine--tRNA ligase 1.72e-01 NA NA 0.3974
6. F Q87LR3 Alanine--tRNA ligase 9.74e-02 NA NA 0.4305
6. F A4TQ52 Alanine--tRNA ligase 5.60e-02 NA NA 0.3947
6. F Q5HC27 Alanine--tRNA ligase 2.02e-01 NA NA 0.4151
6. F Q5E9Y6 Exopolyphosphatase PRUNE1 2.38e-06 NA NA 0.4848
6. F P0DG25 Alanine--tRNA ligase 1.56e-01 NA NA 0.4216
6. F Q1JG77 Alanine--tRNA ligase 9.08e-02 NA NA 0.4356
6. F B0TFY7 Alanine--tRNA ligase 6.11e-02 NA NA 0.3684
6. F Q2NVL2 Alanine--tRNA ligase 8.43e-02 NA NA 0.4461
6. F Q15RG5 Alanine--tRNA ligase 7.26e-02 NA NA 0.3895
6. F Q835J8 Alanine--tRNA ligase 1.05e-01 NA NA 0.4051
6. F P74081 A-adding tRNA nucleotidyltransferase 4.54e-10 NA NA 0.7362
6. F A5D3F4 Alanine--tRNA ligase 7.24e-02 NA NA 0.4266
6. F Q8XIQ9 Cobalt-dependent inorganic pyrophosphatase 7.89e-04 NA NA 0.4299
6. F A9R0V7 Alanine--tRNA ligase 5.26e-02 NA NA 0.393
6. F A5IYK5 Alanine--tRNA ligase 2.13e-01 NA NA 0.4455
6. F A1R709 Alanine--tRNA ligase 5.89e-02 NA NA 0.4019
6. F A1JK09 Alanine--tRNA ligase 5.86e-02 NA NA 0.436
6. F B0SGD3 Alanine--tRNA ligase 9.73e-02 NA NA 0.3715
6. F Q99Z57 Alanine--tRNA ligase 1.94e-01 NA NA 0.4127
6. F A5F9B7 Alanine--tRNA ligase 8.88e-02 NA NA 0.4476
6. F Q3K1P7 Alanine--tRNA ligase 9.21e-02 NA NA 0.392
6. F Q03YQ2 Alanine--tRNA ligase 8.89e-02 NA NA 0.3765
6. F A0LXX3 Alanine--tRNA ligase 1.44e-01 NA NA 0.401
6. F A9KMW7 Alanine--tRNA ligase 1 5.37e-02 NA NA 0.3875
6. F B0SPT4 Alanine--tRNA ligase 9.65e-02 NA NA 0.3919
6. F A2BN65 Alanine--tRNA ligase 7.19e-02 NA NA 0.3878
6. F Q221G2 Alanine--tRNA ligase 1.24e-01 NA NA 0.3944
6. F Q9PLH5 Alanine--tRNA ligase 9.07e-02 NA NA 0.3662
6. F B1JJA0 Alanine--tRNA ligase 5.15e-02 NA NA 0.3958
6. F P39693 Single-stranded-DNA-specific exonuclease RecJ 5.42e-06 NA NA 0.4375
6. F Q4A633 Alanine--tRNA ligase 1.92e-01 NA NA 0.4125
6. F Q8KG04 Alanine--tRNA ligase 9.07e-02 NA NA 0.4264
6. F Q1H3U9 Alanine--tRNA ligase 1.20e-01 NA NA 0.4179
6. F Q47AU8 Alanine--tRNA ligase 1.26e-01 NA NA 0.4264
6. F A1RHG5 Alanine--tRNA ligase 6.61e-02 NA NA 0.4665
6. F A8FFM9 Alanine--tRNA ligase 9.50e-02 NA NA 0.3574
6. F A6LEZ8 Alanine--tRNA ligase 1.05e-01 NA NA 0.4214
6. F A6LMH9 Alanine--tRNA ligase 1.14e-01 NA NA 0.417
6. F A1VYL8 Alanine--tRNA ligase 1.55e-01 NA NA 0.3624
6. F Q0A8K7 Alanine--tRNA ligase 6.19e-02 NA NA 0.3857
6. F A9WSC4 Alanine--tRNA ligase 5.47e-02 NA NA 0.3942
6. F Q02XE9 Alanine--tRNA ligase 1.40e-01 NA NA 0.41
6. F Q5F7C4 Alanine--tRNA ligase 8.41e-02 NA NA 0.3794
6. F Q8E600 Alanine--tRNA ligase 8.32e-02 NA NA 0.4165
6. F A4W221 Alanine--tRNA ligase 1.06e-01 NA NA 0.434
6. F B2K5X9 Alanine--tRNA ligase 5.14e-02 NA NA 0.3922
6. F Q18E76 Alanine--tRNA ligase 5.73e-02 NA NA 0.4293
6. F Q015G2 Probable alanine--tRNA ligase, chloroplastic/mitochondrial 6.59e-02 NA NA 0.3794
6. F Q8Y722 Alanine--tRNA ligase 6.45e-02 NA NA 0.4279
6. F Q65VQ5 Alanine--tRNA ligase 5.08e-02 NA NA 0.436
6. F A8GU16 Alanine--tRNA ligase 1.95e-01 NA NA 0.3781
6. F Q3YSV8 Alanine--tRNA ligase 8.22e-02 NA NA 0.4401
6. F B1AJ08 Alanine--tRNA ligase 7.81e-02 NA NA 0.4481
6. F Q8DC49 Alanine--tRNA ligase 9.61e-02 NA NA 0.4359
6. F A9KYF8 Alanine--tRNA ligase 6.48e-02 NA NA 0.4329
6. F Q5LHE6 Alanine--tRNA ligase 6.88e-02 NA NA 0.4419
6. F A1W7D0 Alanine--tRNA ligase 8.09e-02 NA NA 0.3807
6. F Q2GJ36 Alanine--tRNA ligase 1.37e-01 NA NA 0.4684
6. F A8F866 Alanine--tRNA ligase 4.49e-02 NA NA 0.5118
7. B Q59027 Uncharacterized protein MJ1633 2.11e-15 NA 0.003 NA