Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54636.1
JCVISYN3A_0142
Protein-(glutamine-N5) methyltransferase, release factor-specific.
M. mycoides homolog: Q6MU88.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 111
Unique PROST Go: 14
Unique BLAST Go: 9
Unique Foldseek Go: 61
Total Homologs: 1409
Unique PROST Homologs: 374
Unique BLAST Homologs: 32
Unique Foldseek Homologs: 851
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q63QE9
(Release factor glutamine methyltransferase) with a FATCAT P-Value: 0 and RMSD of 2.68 angstrom. The sequence alignment identity is 24.6%.
Structural alignment shown in left. Query protein AVX54636.1 colored as red in alignment, homolog Q63QE9 colored as blue.
Query protein AVX54636.1 is also shown in right top, homolog Q63QE9 showed in right bottom. They are colored based on secondary structures.
AVX54636.1 MNN------TIFNVLNKIKNTNISLNKADVYHILEHIINKDYQWIISNLDYKLTKKQIYKIDQILD-LLKQNY-----------PLAYILKSKYFYSNNF 82 Q63QE9 MNTTKPSPATAAELL---RAS--PLDALDARILLAHALG----WSRTQL---IT-----RADEPLDAAARARYLALQARRAAGEPIAQLTGAREFFGLEF 83 AVX54636.1 FINKDVLIPRNESELIIDHASEFVKNNNDLL----IVDLCTGSGCLGISCALLN-DQNKVILTDISYKALKVANKNIKKFNLTNTSCLNG--NFI--D-- 171 Q63QE9 DITPDVLIPRPETELLVETALDAI----DGIASPCVLDLGTGSGAIAVSIASERPDA-RVWALERSVAALDVARRNARK--LLDPARAGGPLRFLESDWY 176 AVX54636.1 VLIKNNLKANLIICNPPYIDINDQNIDKNVIDFEPSIALFAPNKGLYFYEILIKNIDKILDTNKNFL-----IVLEFGWLQKDSIEQLLINNCLKYKWEF 266 Q63QE9 AALDPGLRFHVVVSNPPYIARHDPHLAEGDLRFEPRGALTDENDGL----AAIRTI--VAGAHA-FVAPGGALWLEHGYDQAAAVRTLL--DAAGF---- 263 AVX54636.1 KKDYNDYWR-NLI-IKNF------- 282 Q63QE9 -ADVES--RADLASIERASGGRLPG 285
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity |
| 1. PBF | GO:0008276 | protein methyltransferase activity |
| 1. PBF | GO:0009007 | site-specific DNA-methyltransferase (adenine-specific) activity |
| 1. PBF | GO:0036009 | protein-glutamine N-methyltransferase activity |
| 1. PBF | GO:0003676 | nucleic acid binding |
| 1. PBF | GO:0102559 | protein-(glutamine-N5) methyltransferase activity |
| 1. PBF | GO:0018364 | peptidyl-glutamine methylation |
| 2. PF | GO:0031515 | tRNA (m1A) methyltransferase complex |
| 2. PF | GO:0070475 | rRNA base methylation |
| 2. PF | GO:0016429 | tRNA (adenine-N1-)-methyltransferase activity |
| 2. PF | GO:0005634 | nucleus |
| 2. PF | GO:0005737 | cytoplasm |
| 2. PF | GO:0070043 | rRNA (guanine-N7-)-methyltransferase activity |
| 2. PF | GO:0032259 | methylation |
| 2. PF | GO:0008171 | O-methyltransferase activity |
| 3. BF | GO:0052916 | 23S rRNA (guanine(1835)-N(2))-methyltransferase activity |
| 3. BF | GO:0052914 | 16S rRNA (guanine(1207)-N(2))-methyltransferase activity |
| 3. BF | GO:0043776 | cobalt-precorrin-6B C5-methyltransferase activity |
| 3. BF | GO:0008168 | methyltransferase activity |
| 3. BF | GO:0008173 | RNA methyltransferase activity |
| 3. BF | GO:0008176 | tRNA (guanine-N7-)-methyltransferase activity |
| 3. BF | GO:0031167 | rRNA methylation |
| 4. PB | GO:0006306 | DNA methylation |
| 4. PB | GO:0006479 | protein methylation |
| 4. PB | GO:0008170 | N-methyltransferase activity |
| 4. PB | GO:0006451 | translational readthrough |
| 4. PB | GO:0070126 | mitochondrial translational termination |
| 5. P | GO:0019438 | aromatic compound biosynthetic process |
| 5. P | GO:0018022 | peptidyl-lysine methylation |
| 5. P | GO:0030187 | melatonin biosynthetic process |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0052907 | 23S rRNA (adenine(1618)-N(6))-methyltransferase activity |
| 5. P | GO:0030755 | quercetin 3-O-methyltransferase activity |
| 5. P | GO:0008990 | rRNA (guanine-N2-)-methyltransferase activity |
| 5. P | GO:0009812 | flavonoid metabolic process |
| 5. P | GO:0008983 | protein-glutamate O-methyltransferase activity |
| 5. P | GO:0047763 | caffeate O-methyltransferase activity |
| 5. P | GO:0030744 | luteolin O-methyltransferase activity |
| 5. P | GO:0140381 | 4-hydroxytryptamine 4-phosphate methyltransferase activity |
| 5. P | GO:0017096 | acetylserotonin O-methyltransferase activity |
| 5. P | GO:0102822 | quercetin 3'-O-methyltransferase activity |
| 6. F | GO:0102094 | S-adenosylmethionine:2-demethylmenaquinol methyltransferase activity |
| 6. F | GO:0102964 | S-adenosyl-L-methionine:(S)-corytuberine-N-methyltransferase activity |
| 6. F | GO:0003723 | RNA binding |
| 6. F | GO:0006744 | ubiquinone biosynthetic process |
| 6. F | GO:0030488 | tRNA methylation |
| 6. F | GO:0043333 | 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity |
| 6. F | GO:0030794 | (S)-coclaurine-N-methyltransferase activity |
| 6. F | GO:0009383 | rRNA (cytosine-C5-)-methyltransferase activity |
| 6. F | GO:0052729 | dimethylglycine N-methyltransferase activity |
| 6. F | GO:0004395 | hexaprenyldihydroxybenzoate methyltransferase activity |
| 6. F | GO:0006364 | rRNA processing |
| 6. F | GO:0052913 | 16S rRNA (guanine(966)-N(2))-methyltransferase activity |
| 6. F | GO:1990259 | histone-glutamine methyltransferase activity |
| 6. F | GO:0008689 | 3-demethylubiquinone-9 3-O-methyltransferase activity |
| 6. F | GO:1990258 | histone glutamine methylation |
| 6. F | GO:0006355 | regulation of transcription, DNA-templated |
| 6. F | GO:0000494 | box C/D RNA 3'-end processing |
| 6. F | GO:0008033 | tRNA processing |
| 6. F | GO:0036265 | RNA (guanine-N7)-methylation |
| 6. F | GO:0003838 | sterol 24-C-methyltransferase activity |
| 6. F | GO:0102526 | 8-demethylnovobiocic acid C8-methyltransferase activity |
| 6. F | GO:0052730 | sarcosine N-methyltransferase activity |
| 6. F | GO:0019286 | glycine betaine biosynthetic process from glycine |
| 6. F | GO:0004719 | protein-L-isoaspartate (D-aspartate) O-methyltransferase activity |
| 6. F | GO:0071424 | rRNA (cytosine-N4-)-methyltransferase activity |
| 6. F | GO:0046872 | metal ion binding |
| 6. F | GO:0010340 | carboxyl-O-methyltransferase activity |
| 6. F | GO:0102168 | 5-methyl-phenazine-1-carboxylate N-methyltransferase activity |
| 6. F | GO:0009060 | aerobic respiration |
| 6. F | GO:0051539 | 4 iron, 4 sulfur cluster binding |
| 6. F | GO:0004809 | tRNA (guanine-N2-)-methyltransferase activity |
| 6. F | GO:1901771 | daunorubicin biosynthetic process |
| 6. F | GO:0030091 | protein repair |
| 6. F | GO:0016021 | integral component of membrane |
| 6. F | GO:0052915 | 23S rRNA (guanine(2445)-N(2))-methyltransferase activity |
| 6. F | GO:0009236 | cobalamin biosynthetic process |
| 6. F | GO:0043770 | demethylmenaquinone methyltransferase activity |
| 6. F | GO:0017000 | antibiotic biosynthetic process |
| 6. F | GO:0031428 | box C/D RNP complex |
| 6. F | GO:0009234 | menaquinone biosynthetic process |
| 6. F | GO:0043527 | tRNA methyltransferase complex |
| 6. F | GO:0102208 | 2-polyprenyl-6-hydroxyphenol methylase activity |
| 6. F | GO:0000287 | magnesium ion binding |
| 6. F | GO:0008425 | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
| 6. F | GO:0016434 | rRNA (cytosine) methyltransferase activity |
| 6. F | GO:0005506 | iron ion binding |
| 6. F | GO:0030782 | (S)-tetrahydroprotoberberine N-methyltransferase activity |
| 6. F | GO:0102308 | erythromycin D 3''-o-methyltransferase activity |
| 6. F | GO:0061543 | 3-demethylubiquinol-6 3-O-methyltransferase activity |
| 6. F | GO:0046025 | precorrin-6Y C5,15-methyltransferase (decarboxylating) activity |
| 6. F | GO:0102027 | S-adenosylmethionine:2-demethylquinol-8 methyltransferase activity |
| 6. F | GO:0044598 | doxorubicin metabolic process |
| 6. F | GO:1901012 | (S)-reticuline biosynthetic process |
| 6. F | GO:0001510 | RNA methylation |
| 6. F | GO:0046140 | corrin biosynthetic process |
| 6. F | GO:0008649 | rRNA methyltransferase activity |
| 6. F | GO:0043642 | novobiocin biosynthetic process |
| 6. F | GO:0102130 | malonyl-CoA methyltransferase activity |
| 6. F | GO:0102307 | erythromycin C 3''-o-methyltransferase activity |
| 6. F | GO:0102955 | S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity |
| 6. F | GO:0070041 | rRNA (uridine-C5-)-methyltransferase activity |
| 7. B | GO:0016430 | tRNA (adenine-N6-)-methyltransferase activity |
| 7. B | GO:1904047 | S-adenosyl-L-methionine binding |
| 7. B | GO:0003725 | double-stranded RNA binding |
| 7. B | GO:0006396 | RNA processing |
| 7. B | GO:0098794 | postsynapse |
| 7. B | GO:0042995 | cell projection |
| 7. B | GO:0008988 | rRNA (adenine-N6-)-methyltransferase activity |
| 7. B | GO:0098793 | presynapse |
| 7. B | GO:0048863 | stem cell differentiation |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity |
| GO:0008276 | protein methyltransferase activity |
| GO:0006479 | protein methylation |
| GO:0043412 | macromolecule modification |
| GO:0036009 | protein-glutamine N-methyltransferase activity |
| GO:0008168 | methyltransferase activity |
| GO:0003676 | nucleic acid binding |
| GO:0102559 | protein-(glutamine-N5) methyltransferase activity |
| GO:0044260 | cellular macromolecule metabolic process |
| GO:0032259 | methylation |
| GO:0019538 | protein metabolic process |
| GO:0018364 | peptidyl-glutamine methylation |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P57269 | Release factor glutamine methyltransferase | 0.00e+00 | 1.67e-39 | 5.27e-27 | 0.8679 |
| 1. PBF | Q87DF7 | Release factor glutamine methyltransferase | 0.00e+00 | 8.17e-44 | 5.82e-34 | 0.8792 |
| 1. PBF | A5HY34 | Release factor glutamine methyltransferase | 0.00e+00 | 1.34e-40 | 3.49e-25 | 0.8503 |
| 1. PBF | Q97F67 | Release factor glutamine methyltransferase | 0.00e+00 | 9.47e-37 | 2.72e-30 | 0.8668 |
| 1. PBF | Q8PC99 | Release factor glutamine methyltransferase | 0.00e+00 | 1.54e-42 | 7.60e-36 | 0.8917 |
| 1. PBF | Q5NEL0 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.76e-34 | 8.35e-28 | 0.7758 |
| 1. PBF | Q7ULT2 | Release factor glutamine methyltransferase | 0.00e+00 | 2.30e-34 | 2.05e-13 | 0.8868 |
| 1. PBF | Q0WDE1 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 1.96e-32 | 3.36e-19 | 0.8387 |
| 1. PBF | Q8DHV7 | Release factor glutamine methyltransferase | 0.00e+00 | 2.52e-32 | 2.03e-16 | 0.8001 |
| 1. PBF | Q1II29 | Release factor glutamine methyltransferase | 0.00e+00 | 7.97e-36 | 1.69e-23 | 0.8553 |
| 1. PBF | P9WHV2 | Release factor glutamine methyltransferase | 0.00e+00 | 1.32e-34 | 5.18e-09 | 0.8289 |
| 1. PBF | Q9KQ83 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.30e-28 | 9.91e-20 | 0.7978 |
| 1. PBF | B5YIQ8 | Release factor glutamine methyltransferase | 0.00e+00 | 1.33e-47 | 5.28e-22 | 0.8723 |
| 1. PBF | Q2RWE0 | Release factor glutamine methyltransferase | 0.00e+00 | 5.31e-26 | 4.21e-22 | 0.8746 |
| 1. PBF | A0R213 | Release factor glutamine methyltransferase | 0.00e+00 | 1.23e-37 | 7.32e-15 | 0.8316 |
| 1. PBF | Q9RXR2 | Release factor glutamine methyltransferase | 0.00e+00 | 8.75e-36 | 1.74e-13 | 0.8579 |
| 1. PBF | P0DJB1 | Release factor glutamine methyltransferase | 0.00e+00 | 6.18e-34 | 1.18e-09 | 0.829 |
| 1. PBF | Q9CNN7 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 6.04e-26 | 1.91e-19 | 0.7853 |
| 1. PBF | Q748B2 | Release factor glutamine methyltransferase | 0.00e+00 | 1.44e-37 | 3.45e-22 | 0.8499 |
| 1. PBF | P0A293 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.23e-32 | 8.26e-22 | 0.8204 |
| 1. PBF | P45832 | Release factor glutamine methyltransferase | 0.00e+00 | 3.33e-37 | 6.51e-13 | 0.8258 |
| 1. PBF | P45253 | Release factor glutamine methyltransferase | 0.00e+00 | 3.09e-38 | 1.32e-24 | 0.8471 |
| 1. PBF | Q32GZ5 | Release factor glutamine methyltransferase | 0.00e+00 | 7.81e-39 | 1.41e-28 | 0.8829 |
| 1. PBF | Q63QE9 | Release factor glutamine methyltransferase | 0.00e+00 | 8.17e-41 | 5.73e-21 | 0.8385 |
| 1. PBF | Q7VDL7 | Release factor glutamine methyltransferase | 0.00e+00 | 5.06e-37 | 1.06e-06 | 0.8272 |
| 1. PBF | Q831F7 | Release factor glutamine methyltransferase | 0.00e+00 | 3.13e-39 | 1.69e-26 | 0.8494 |
| 1. PBF | Q98G94 | Release factor glutamine methyltransferase | 0.00e+00 | 3.07e-33 | 8.86e-21 | 0.8842 |
| 1. PBF | Q7CIA2 | Release factor glutamine methyltransferase | 0.00e+00 | 2.04e-40 | 1.30e-28 | 0.8742 |
| 1. PBF | Q814U1 | Release factor glutamine methyltransferase | 0.00e+00 | 5.05e-40 | 1.95e-27 | 0.8706 |
| 1. PBF | Q6MU88 | Release factor glutamine methyltransferase | 0.00e+00 | 5.61e-81 | 0.0 | 0.9988 |
| 1. PBF | Q8KCD5 | Release factor glutamine methyltransferase | 0.00e+00 | 9.67e-39 | 1.67e-25 | 0.8599 |
| 1. PBF | Q9KQ26 | Release factor glutamine methyltransferase | 0.00e+00 | 1.12e-37 | 9.51e-22 | 0.858 |
| 1. PBF | Q9JYC0 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 3.39e-28 | 2.53e-13 | 0.791 |
| 1. PBF | P0ACC2 | Release factor glutamine methyltransferase | 0.00e+00 | 5.72e-39 | 2.44e-29 | 0.8852 |
| 1. PBF | Q8F987 | Release factor glutamine methyltransferase | 0.00e+00 | 6.56e-39 | 5.97e-32 | 0.8722 |
| 1. PBF | Q8R619 | Release factor glutamine methyltransferase | 0.00e+00 | 4.82e-15 | 7.55e-17 | 0.873 |
| 1. PBF | Q2S0V8 | Release factor glutamine methyltransferase | 0.00e+00 | 3.01e-28 | 4.70e-22 | 0.8755 |
| 1. PBF | Q8DPZ3 | Release factor glutamine methyltransferase | 0.00e+00 | 5.38e-33 | 4.81e-18 | 0.8084 |
| 1. PBF | Q9JTA1 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.55e-28 | 2.71e-13 | 0.7909 |
| 1. PBF | Q9K4E3 | Release factor glutamine methyltransferase | 0.00e+00 | 1.13e-33 | 9.46e-17 | 0.8092 |
| 1. PBF | Q8EAR4 | Release factor glutamine methyltransferase | 0.00e+00 | 1.97e-43 | 5.16e-21 | 0.8445 |
| 1. PBF | Q9WYV8 | Release factor glutamine methyltransferase | 0.00e+00 | 1.25e-32 | 9.75e-22 | 0.7776 |
| 1. PBF | Q5E6T2 | Release factor glutamine methyltransferase | 0.00e+00 | 3.79e-43 | 2.97e-18 | 0.8718 |
| 1. PBF | Q89AT0 | Release factor glutamine methyltransferase | 0.00e+00 | 4.97e-41 | 2.41e-28 | 0.8697 |
| 1. PBF | Q8G3P4 | Release factor glutamine methyltransferase | 0.00e+00 | 2.63e-36 | 7.42e-12 | 0.8704 |
| 1. PBF | Q7VXJ6 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 1.17e-31 | 2.11e-19 | 0.7882 |
| 1. PBF | O84027 | Release factor glutamine methyltransferase | 0.00e+00 | 4.39e-32 | 8.06e-20 | 0.878 |
| 1. PBF | Q5F5B4 | Release factor glutamine methyltransferase | 0.00e+00 | 1.23e-34 | 2.66e-25 | 0.843 |
| 1. PBF | Q87DS5 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 3.12e-28 | 2.41e-14 | 0.8178 |
| 1. PBF | Q8P7Q8 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 1.37e-26 | 1.05e-14 | 0.8139 |
| 1. PBF | Q2RFW1 | Release factor glutamine methyltransferase | 0.00e+00 | 5.90e-36 | 2.38e-25 | 0.8917 |
| 1. PBF | Q89DG5 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 8.36e-23 | 2.42e-14 | 0.7899 |
| 1. PBF | P0A294 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.23e-32 | 8.26e-22 | 0.8197 |
| 1. PBF | O66506 | Release factor glutamine methyltransferase | 0.00e+00 | 6.70e-41 | 1.33e-18 | 0.8571 |
| 1. PBF | Q9HVC8 | Release factor glutamine methyltransferase | 0.00e+00 | 7.05e-40 | 5.46e-18 | 0.9006 |
| 1. PBF | Q89XT8 | Release factor glutamine methyltransferase | 0.00e+00 | 1.76e-25 | 3.74e-17 | 0.8796 |
| 1. PBF | Q9CHX0 | Release factor glutamine methyltransferase | 0.00e+00 | 1.40e-38 | 1.05e-22 | 0.8608 |
| 1. PBF | A9WBM9 | Release factor glutamine methyltransferase | 0.00e+00 | 1.72e-33 | 4.98e-27 | 0.8606 |
| 1. PBF | Q5E3U5 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 6.16e-32 | 2.10e-20 | 0.7898 |
| 1. PBF | P74003 | Release factor glutamine methyltransferase | 0.00e+00 | 8.75e-33 | 3.82e-14 | 0.8033 |
| 1. PBF | P40816 | Release factor glutamine methyltransferase | 0.00e+00 | 1.77e-36 | 9.12e-25 | 0.8702 |
| 1. PBF | Q9I347 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 3.55e-36 | 3.63e-25 | 0.8618 |
| 1. PBF | Q8K9W9 | Release factor glutamine methyltransferase | 0.00e+00 | 7.37e-39 | 2.19e-22 | 0.8926 |
| 1. PBF | P45873 | Release factor glutamine methyltransferase | 0.00e+00 | 4.14e-40 | 6.43e-35 | 0.8796 |
| 1. PBF | Q5NIA7 | Release factor glutamine methyltransferase | 0.00e+00 | 2.42e-43 | 1.02e-33 | 0.8969 |
| 1. PBF | B0B9D1 | Release factor glutamine methyltransferase | 0.00e+00 | 1.13e-31 | 1.07e-19 | 0.8763 |
| 1. PBF | P39200 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 1.40e-32 | 1.54e-20 | 0.7835 |
| 1. PBF | Q7W022 | Release factor glutamine methyltransferase | 0.00e+00 | 1.76e-38 | 1.29e-34 | 0.8862 |
| 1. PBF | Q727D9 | Release factor glutamine methyltransferase | 0.00e+00 | 4.80e-39 | 9.51e-24 | 0.8459 |
| 1. PBF | Q9PD67 | Release factor glutamine methyltransferase | 0.00e+00 | 1.71e-39 | 2.90e-33 | 0.88 |
| 1. PBF | A4QDG2 | Release factor glutamine methyltransferase | 0.00e+00 | 6.18e-34 | 1.18e-09 | 0.8297 |
| 1. PBF | Q83AD8 | Release factor glutamine methyltransferase | 0.00e+00 | 4.13e-36 | 2.36e-24 | 0.8986 |
| 1. PBF | Q8A1D7 | Release factor glutamine methyltransferase | 0.00e+00 | 6.58e-31 | 1.69e-17 | 0.8119 |
| 1. PBF | Q3J2B7 | Release factor glutamine methyltransferase | 0.00e+00 | 8.55e-42 | 2.23e-13 | 0.8658 |
| 1. PBF | P45106 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 3.57e-28 | 6.09e-22 | 0.821 |
| 1. PBF | Q9A9T7 | Release factor glutamine methyltransferase | 0.00e+00 | 4.09e-32 | 1.29e-21 | 0.8691 |
| 1. PBF | Q6F0I4 | Release factor glutamine methyltransferase | 0.00e+00 | 2.97e-34 | 1.38e-58 | 0.9551 |
| 1. PBF | A9CG70 | Release factor glutamine methyltransferase | 0.00e+00 | 7.84e-37 | 9.66e-16 | 0.8854 |
| 1. PBF | Q7NJS7 | Release factor glutamine methyltransferase | 0.00e+00 | 4.80e-39 | 1.36e-18 | 0.8704 |
| 1. PBF | Q9PDL1 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.82e-28 | 1.69e-13 | 0.8175 |
| 1. PBF | A6H162 | Release factor glutamine methyltransferase | 0.00e+00 | 1.98e-41 | 3.75e-20 | 0.8323 |
| 1. PBF | B8E004 | Release factor glutamine methyltransferase | 0.00e+00 | 1.16e-37 | 9.95e-21 | 0.853 |
| 1. PBF | Q5F783 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.01e-29 | 1.49e-13 | 0.788 |
| 1. PBF | Q8Y4A9 | Release factor glutamine methyltransferase | 0.00e+00 | 2.66e-42 | 1.66e-30 | 0.8837 |
| 1. PBF | Q32DK7 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 4.43e-29 | 6.71e-21 | 0.8347 |
| 1. PBF | Q81JX2 | Release factor glutamine methyltransferase | 0.00e+00 | 4.48e-40 | 2.87e-27 | 0.8408 |
| 1. PBF | Q9CN82 | Release factor glutamine methyltransferase | 0.00e+00 | 4.60e-37 | 1.94e-21 | 0.8467 |
| 1. PBF | Q8ECQ4 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 4.64e-30 | 4.20e-21 | 0.8259 |
| 2. PF | Q1BR98 | Ribosomal RNA small subunit methyltransferase G | 9.41e-07 | 1.57e-02 | NA | 0.4493 |
| 2. PF | B7VN06 | Ribosomal RNA small subunit methyltransferase G | 1.75e-06 | 2.79e-02 | NA | 0.4506 |
| 2. PF | Q65Q00 | Ribosomal RNA small subunit methyltransferase G | 1.84e-06 | 3.50e-02 | NA | 0.5049 |
| 2. PF | Q3J6M1 | Ribosomal RNA small subunit methyltransferase G | 1.71e-06 | 3.38e-03 | NA | 0.4876 |
| 2. PF | A1BJ05 | Ribosomal RNA small subunit methyltransferase G | 6.17e-06 | 3.55e-02 | NA | 0.573 |
| 2. PF | B8FBE9 | Ribosomal protein L11 methyltransferase | 1.82e-06 | 4.48e-03 | NA | 0.6841 |
| 2. PF | Q8EUW9 | Ribosomal RNA small subunit methyltransferase G | 6.98e-07 | 1.61e-02 | NA | 0.5368 |
| 2. PF | Q15MT4 | Ribosomal RNA small subunit methyltransferase G | 1.25e-06 | 2.90e-02 | NA | 0.4809 |
| 2. PF | Q1QSC0 | Ribosomal RNA small subunit methyltransferase G | 3.21e-06 | 3.58e-03 | NA | 0.534 |
| 2. PF | Q8DDH8 | Ribosomal RNA small subunit methyltransferase G | 2.30e-06 | 3.17e-02 | NA | 0.4374 |
| 2. PF | Q6ANR2 | Ribosomal RNA small subunit methyltransferase G | 6.13e-05 | 2.07e-02 | NA | 0.5191 |
| 2. PF | A6TG44 | Ribosomal RNA small subunit methyltransferase G | 1.43e-06 | 2.04e-02 | NA | 0.5155 |
| 2. PF | Q746Q5 | Ribosomal RNA small subunit methyltransferase G | 1.15e-06 | 1.13e-02 | NA | 0.5975 |
| 2. PF | A0K2X1 | Ribosomal RNA small subunit methyltransferase G | 1.09e-06 | 1.57e-02 | NA | 0.4776 |
| 2. PF | A5N449 | Ribosomal RNA small subunit methyltransferase G | 1.26e-06 | 3.35e-02 | NA | 0.4964 |
| 2. PF | A5WFA2 | Ribosomal RNA small subunit methyltransferase G | 3.30e-06 | 2.54e-02 | NA | 0.4802 |
| 2. PF | B9DXR9 | Ribosomal RNA small subunit methyltransferase G | 1.75e-06 | 3.35e-02 | NA | 0.5249 |
| 2. PF | Q3B6D4 | Ribosomal RNA small subunit methyltransferase G | 4.72e-06 | 2.69e-04 | NA | 0.5418 |
| 2. PF | B4SC71 | Ribosomal RNA small subunit methyltransferase G | 7.13e-06 | 2.07e-03 | NA | 0.5474 |
| 2. PF | B0RDP8 | Ribosomal RNA small subunit methyltransferase G | 1.25e-06 | 1.96e-02 | NA | 0.5791 |
| 2. PF | B8CVV5 | Ribosomal RNA small subunit methyltransferase G | 2.07e-06 | 1.91e-02 | NA | 0.4968 |
| 2. PF | A9AJF2 | Ribosomal RNA small subunit methyltransferase G | 8.44e-07 | 2.00e-02 | NA | 0.4817 |
| 2. PF | Q21DG3 | Ribosomal RNA small subunit methyltransferase G | 9.66e-06 | 4.32e-02 | NA | 0.5159 |
| 2. PF | A4JA23 | Ribosomal RNA small subunit methyltransferase G | 3.22e-08 | 4.46e-02 | NA | 0.4642 |
| 2. PF | B4E582 | Ribosomal RNA small subunit methyltransferase G | 9.26e-07 | 1.88e-02 | NA | 0.4395 |
| 2. PF | Q6LLF8 | Ribosomal RNA small subunit methyltransferase G | 2.29e-06 | 4.70e-02 | NA | 0.4968 |
| 2. PF | Q39KY8 | Ribosomal RNA small subunit methyltransferase G | 8.51e-07 | 4.95e-02 | NA | 0.4484 |
| 2. PF | B3EGW1 | Ribosomal RNA small subunit methyltransferase G | 2.47e-06 | 1.04e-02 | NA | 0.5612 |
| 2. PF | B5XZL6 | Ribosomal RNA small subunit methyltransferase G | 1.82e-06 | 3.86e-02 | NA | 0.5074 |
| 2. PF | Q0BJM7 | Ribosomal RNA small subunit methyltransferase G | 3.89e-08 | 3.75e-02 | NA | 0.4726 |
| 2. PF | A5CVC1 | Ribosomal RNA small subunit methyltransferase G | 1.48e-06 | 2.12e-02 | NA | 0.6023 |
| 2. PF | Q7MGH0 | Ribosomal RNA small subunit methyltransferase G | 2.47e-06 | 3.17e-02 | NA | 0.4352 |
| 2. PF | A3DHY6 | Ribosomal RNA small subunit methyltransferase G | 2.32e-06 | 4.29e-02 | NA | 0.5226 |
| 2. PF | B1YQK3 | Ribosomal RNA small subunit methyltransferase G | 3.38e-08 | 3.78e-02 | NA | 0.4561 |
| 3. BF | Q9ZCB3 | Bifunctional methyltransferase | 0.00e+00 | NA | 6.99e-34 | 0.8292 |
| 3. BF | Q68VR6 | Bifunctional methyltransferase | 0.00e+00 | NA | 1.37e-35 | 0.8535 |
| 3. BF | Q8DBJ8 | Ribosomal RNA large subunit methyltransferase G | 2.04e-04 | NA | 2.18e-04 | 0.6018 |
| 3. BF | Q49404 | Uncharacterized protein MG259 | 1.89e-15 | NA | 1.25e-08 | 0.74 |
| 3. BF | B5FBH8 | Ribosomal RNA large subunit methyltransferase G | 2.88e-04 | NA | 0.003 | 0.6339 |
| 3. BF | B6EIC1 | Ribosomal RNA large subunit methyltransferase G | 2.67e-04 | NA | 0.002 | 0.625 |
| 3. BF | Q4JBL7 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 3.80e-09 | NA | 0.020 | 0.6462 |
| 3. BF | Q4UJU4 | Bifunctional methyltransferase | 0.00e+00 | NA | 1.44e-34 | 0.8561 |
| 3. BF | Q892Z2 | Uncharacterized RNA methyltransferase CTC_01941 | 4.43e-05 | NA | 0.024 | 0.5643 |
| 3. BF | P75419 | Uncharacterized protein MG259 homolog | 2.49e-13 | NA | 1.89e-13 | 0.7577 |
| 3. BF | Q1RH40 | Bifunctional methyltransferase | 0.00e+00 | NA | 9.53e-40 | 0.8389 |
| 3. BF | Q8R933 | Uncharacterized RNA methyltransferase TTE1797 | 3.82e-05 | NA | 7.69e-04 | 0.5952 |
| 3. BF | Q92G13 | Bifunctional methyltransferase | 0.00e+00 | NA | 9.13e-32 | 0.839 |
| 3. BF | A7N1U8 | Ribosomal RNA large subunit methyltransferase G | 2.27e-04 | NA | 0.013 | 0.5934 |
| 3. BF | Q6LTZ3 | Ribosomal RNA large subunit methyltransferase G | 7.09e-05 | NA | 2.33e-04 | 0.6491 |
| 3. BF | Q5E6X8 | Ribosomal RNA large subunit methyltransferase G | 2.60e-04 | NA | 0.003 | 0.6262 |
| 3. BF | B7VKD0 | Ribosomal RNA large subunit methyltransferase G | 2.13e-04 | NA | 3.49e-04 | 0.6249 |
| 3. BF | Q7MIC5 | Ribosomal RNA large subunit methyltransferase G | 2.01e-04 | NA | 2.18e-04 | 0.6019 |
| 4. PB | Q9Y5R4 | MTRF1L release factor glutamine methyltransferase | 0.00e+00 | 1.78e-11 | 7.98e-07 | NA |
| 4. PB | Q921L7 | MTRF1L release factor glutamine methyltransferase | 0.00e+00 | 5.70e-11 | 2.45e-06 | NA |
| 4. PB | O51215 | Release factor glutamine methyltransferase | NA | 2.65e-38 | 5.95e-23 | NA |
| 4. PB | Q63SZ9 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 7.36e-32 | 1.62e-14 | NA |
| 4. PB | P39199 | 50S ribosomal protein L3 glutamine methyltransferase | 0.00e+00 | 2.04e-28 | 1.73e-20 | NA |
| 4. PB | P53944 | Mitochondrial MRF1 N(5)-glutamine methyltransferase MTQ1 | 1.55e-15 | 7.15e-18 | 3.61e-10 | NA |
| 4. PB | O14028 | Probable MRF1 mitochondrial N(5)-glutamine methyltransferase mtq1 | 0.00e+00 | 1.35e-34 | 4.07e-21 | NA |
| 4. PB | P72542 | 4-amino-L-phenylalanine/4-methylamino-L-phenylalanine methyltransferase | 0.00e+00 | 5.06e-37 | 7.33e-14 | NA |
| 4. PB | P9WHV3 | Release factor glutamine methyltransferase | 0.00e+00 | 8.96e-35 | 4.01e-08 | NA |
| 4. PB | Q2FWE1 | Release factor glutamine methyltransferase | 0.00e+00 | 3.54e-41 | 1.05e-30 | NA |
| 4. PB | Q97CW4 | Ribosomal RNA small subunit methyltransferase G | 2.50e-06 | 4.66e-02 | 0.003 | NA |
| 4. PB | P0ACC1 | Release factor glutamine methyltransferase | 0.00e+00 | 5.72e-39 | 2.44e-29 | NA |
| 5. P | B3QLQ8 | Ribosomal protein L11 methyltransferase | 9.59e-06 | 2.48e-03 | NA | NA |
| 5. P | B5R792 | Ribosomal RNA large subunit methyltransferase F | 6.05e-06 | 8.49e-06 | NA | NA |
| 5. P | A8FMH0 | Ribosomal protein L11 methyltransferase | 3.23e-07 | 2.99e-03 | NA | NA |
| 5. P | Q1I5F5 | Ribosomal RNA large subunit methyltransferase F | 7.26e-06 | 5.34e-06 | NA | NA |
| 5. P | A1SAM0 | Ribosomal protein L11 methyltransferase | 2.43e-05 | 4.39e-02 | NA | NA |
| 5. P | Q74G05 | Ribosomal protein L11 methyltransferase | 3.79e-06 | 2.40e-03 | NA | NA |
| 5. P | Q8PD33 | Ribosomal protein L11 methyltransferase | 7.66e-06 | 3.22e-02 | NA | NA |
| 5. P | P59049 | Flavone 3'-O-methyltransferase OMT1 | 1.42e-03 | 2.56e-02 | NA | NA |
| 5. P | B1J5U4 | Ribosomal protein L11 methyltransferase | 1.00e-05 | 2.94e-02 | NA | NA |
| 5. P | C4K4P6 | Ribosomal protein L11 methyltransferase | 5.93e-06 | 1.28e-02 | NA | NA |
| 5. P | Q3KHM8 | Ribosomal RNA large subunit methyltransferase F | 1.06e-05 | 9.15e-06 | NA | NA |
| 5. P | C1DLJ6 | Ribosomal protein L11 methyltransferase | 1.12e-05 | 2.52e-02 | NA | NA |
| 5. P | A1SSI8 | Ribosomal RNA large subunit methyltransferase F | 1.13e-07 | 1.10e-13 | NA | NA |
| 5. P | P9WFZ1 | tRNA (adenine(58)-N(1))-methyltransferase TrmI | 3.25e-05 | 3.37e-02 | NA | NA |
| 5. P | Q0VQG9 | Ribosomal RNA small subunit methyltransferase J | 1.45e-03 | 6.96e-03 | NA | NA |
| 5. P | Q0AB25 | Ribosomal protein L11 methyltransferase | 6.00e-05 | 1.44e-02 | NA | NA |
| 5. P | Q1QV72 | Ribosomal protein L11 methyltransferase | 3.50e-06 | 3.16e-03 | NA | NA |
| 5. P | B7MQR1 | Ribosomal RNA large subunit methyltransferase F | 1.77e-06 | 7.58e-06 | NA | NA |
| 5. P | A5GV37 | Ribosomal protein L11 methyltransferase | 4.28e-06 | 5.35e-03 | NA | NA |
| 5. P | Q1GX86 | Ribosomal protein L11 methyltransferase | 7.77e-06 | 4.94e-03 | NA | NA |
| 5. P | Q92NN5 | Ribosomal protein L11 methyltransferase | 4.62e-07 | 1.88e-05 | NA | NA |
| 5. P | Q7W3W2 | Ribosomal protein L11 methyltransferase | 5.28e-05 | 2.25e-02 | NA | NA |
| 5. P | B5ZWH3 | Ribosomal protein L11 methyltransferase | 2.23e-07 | 1.43e-05 | NA | NA |
| 5. P | C1DCV9 | Ribosomal protein L11 methyltransferase | 1.17e-05 | 4.63e-03 | NA | NA |
| 5. P | Q8X7W6 | Ribosomal RNA large subunit methyltransferase F | 1.93e-06 | 7.82e-05 | NA | NA |
| 5. P | A6Q4V8 | Ribosomal protein L11 methyltransferase | 7.99e-06 | 1.14e-02 | NA | NA |
| 5. P | A2C717 | Ribosomal protein L11 methyltransferase | 1.47e-07 | 1.10e-02 | NA | NA |
| 5. P | P75782 | Ribosomal RNA large subunit methyltransferase F | 6.81e-06 | 1.34e-05 | NA | NA |
| 5. P | C3LMU1 | Ribosomal RNA large subunit methyltransferase F | 2.27e-05 | 1.20e-02 | NA | NA |
| 5. P | A1TI79 | Ribosomal RNA small subunit methyltransferase G | 5.19e-07 | 8.70e-03 | NA | NA |
| 5. P | A8G0U8 | Ribosomal protein L11 methyltransferase | 2.55e-05 | 2.60e-02 | NA | NA |
| 5. P | Q13U36 | Ribosomal protein L11 methyltransferase | 7.07e-05 | 1.54e-04 | NA | NA |
| 5. P | Q5MZ45 | Ribosomal protein L11 methyltransferase | 1.70e-06 | 2.23e-02 | NA | NA |
| 5. P | A6VCV6 | Ribosomal protein L11 methyltransferase | 1.08e-05 | 3.08e-02 | NA | NA |
| 5. P | A4TM00 | Ribosomal RNA large subunit methyltransferase F | 8.76e-06 | 8.41e-06 | NA | NA |
| 5. P | B7KJ88 | Ribosomal protein L11 methyltransferase | 3.58e-08 | 4.38e-03 | NA | NA |
| 5. P | Q47C26 | Ribosomal RNA large subunit methyltransferase F | 1.40e-05 | 4.84e-02 | NA | NA |
| 5. P | A4JBD7 | Ribosomal protein L11 methyltransferase | 6.83e-05 | 2.11e-04 | NA | NA |
| 5. P | B7IFP7 | Ribosomal protein L11 methyltransferase | 6.15e-06 | 1.72e-04 | NA | NA |
| 5. P | Q1GAH2 | Ribosomal protein L11 methyltransferase | 1.40e-07 | 3.53e-02 | NA | NA |
| 5. P | B1YSW5 | Ribosomal protein L11 methyltransferase | 6.79e-05 | 2.76e-04 | NA | NA |
| 5. P | Q57C92 | Ribosomal protein L11 methyltransferase | 5.05e-07 | 7.16e-06 | NA | NA |
| 5. P | B4TC80 | Ribosomal RNA large subunit methyltransferase F | 1.86e-06 | 7.87e-06 | NA | NA |
| 5. P | Q9A838 | Ribosomal protein L11 methyltransferase | 1.96e-05 | 1.55e-04 | NA | NA |
| 5. P | B7UVS7 | Ribosomal RNA large subunit methyltransferase F | 1.05e-05 | 4.50e-06 | NA | NA |
| 5. P | Q290Z2 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 7.19e-08 | 1.29e-04 | NA | NA |
| 5. P | A7H2P1 | Ribosomal protein L11 methyltransferase | 1.55e-07 | 4.14e-03 | NA | NA |
| 5. P | B8FUN2 | Ribosomal protein L11 methyltransferase | 3.55e-08 | 4.66e-02 | NA | NA |
| 5. P | Q0AEV2 | Ribosomal protein L11 methyltransferase | 1.08e-04 | 5.35e-03 | NA | NA |
| 5. P | P0DPA9 | Psilocybin synthase | 9.94e-08 | 5.89e-03 | NA | NA |
| 5. P | Q0TJP1 | Ribosomal RNA large subunit methyltransferase F | 2.13e-06 | 7.58e-06 | NA | NA |
| 5. P | B5QXT1 | Ribosomal RNA large subunit methyltransferase F | 6.28e-06 | 8.49e-06 | NA | NA |
| 5. P | A1JU40 | Ribosomal RNA large subunit methyltransferase F | 9.08e-06 | 1.08e-10 | NA | NA |
| 5. P | P0DD18 | Ribosomal protein L11 methyltransferase | 8.93e-07 | 4.99e-02 | NA | NA |
| 5. P | A4W8E5 | Ribosomal RNA large subunit methyltransferase F | 5.62e-06 | 1.63e-05 | NA | NA |
| 5. P | Q8DM00 | Ribosomal protein L11 methyltransferase | 7.98e-06 | 1.35e-02 | NA | NA |
| 5. P | B0TM80 | Ribosomal RNA large subunit methyltransferase F | 2.97e-05 | 5.78e-04 | NA | NA |
| 5. P | A1U7I4 | Ribosomal RNA small subunit methyltransferase G | 5.59e-06 | 1.97e-02 | NA | NA |
| 5. P | Q7TTX0 | Ribosomal protein L11 methyltransferase | 2.78e-07 | 7.79e-04 | NA | NA |
| 5. P | Q39ZZ2 | Ribosomal protein L11 methyltransferase | 6.55e-06 | 4.24e-03 | NA | NA |
| 5. P | A5FHX5 | Ribosomal RNA large subunit methyltransferase F | 8.26e-06 | 2.56e-03 | NA | NA |
| 5. P | B1IXG1 | Ribosomal RNA large subunit methyltransferase F | 6.16e-06 | 1.34e-05 | NA | NA |
| 5. P | B5XYT7 | Ribosomal RNA large subunit methyltransferase F | 5.48e-06 | 1.39e-06 | NA | NA |
| 5. P | P9WFZ0 | tRNA (adenine(58)-N(1))-methyltransferase TrmI | 3.24e-05 | 3.37e-02 | NA | NA |
| 5. P | A7ZJM2 | Ribosomal RNA large subunit methyltransferase F | 7.18e-06 | 7.58e-06 | NA | NA |
| 5. P | Q65V70 | Ribosomal protein L11 methyltransferase | 1.62e-05 | 3.75e-02 | NA | NA |
| 5. P | Q887M4 | Ribosomal RNA large subunit methyltransferase F | 8.14e-06 | 4.90e-05 | NA | NA |
| 5. P | Q84BQ9 | Ribosomal protein L11 methyltransferase | 1.01e-05 | 8.25e-06 | NA | NA |
| 5. P | Q9PNH7 | Ribosomal protein L11 methyltransferase | 1.61e-07 | 2.99e-03 | NA | NA |
| 5. P | Q318R7 | Ribosomal RNA small subunit methyltransferase G | 6.50e-05 | 3.47e-02 | NA | NA |
| 5. P | Q5AR57 | O-methyltransferase asqN | 1.54e-03 | 4.86e-03 | NA | NA |
| 5. P | A5F7R5 | Putative ribosomal RNA large subunit methyltransferase F | 2.44e-05 | 1.34e-02 | NA | NA |
| 5. P | Q88DK7 | Ribosomal protein L11 methyltransferase | 1.01e-05 | 3.17e-02 | NA | NA |
| 5. P | B7IC17 | Ribosomal protein L11 methyltransferase | 7.72e-06 | 1.29e-02 | NA | NA |
| 5. P | A5W9K3 | Ribosomal protein L11 methyltransferase | 1.28e-05 | 3.61e-02 | NA | NA |
| 5. P | Q2KCH9 | Probable chemotaxis protein methyltransferase | 4.10e-04 | 1.14e-03 | NA | NA |
| 5. P | Q7CJ72 | Ribosomal RNA large subunit methyltransferase F | 8.49e-06 | 2.73e-07 | NA | NA |
| 5. P | Q1BZC1 | Ribosomal protein L11 methyltransferase | 6.88e-05 | 1.41e-04 | NA | NA |
| 5. P | Q9X0G8 | Ribosomal protein L11 methyltransferase | 7.96e-06 | 1.00e-04 | NA | NA |
| 5. P | Q15VI3 | Ribosomal RNA large subunit methyltransferase F | 4.22e-06 | 1.50e-05 | NA | NA |
| 5. P | A1WYK5 | Ribosomal protein L11 methyltransferase | 1.06e-04 | 3.32e-03 | NA | NA |
| 5. P | Q1LIT8 | Ribosomal protein L11 methyltransferase | 3.00e-05 | 1.35e-03 | NA | NA |
| 5. P | Q5WZ79 | Ribosomal protein L11 methyltransferase | 7.34e-06 | 1.58e-02 | NA | NA |
| 5. P | A1A947 | Ribosomal RNA large subunit methyltransferase F | 6.33e-06 | 7.58e-06 | NA | NA |
| 5. P | P72077 | Ribosomal RNA small subunit methyltransferase J | 4.39e-04 | 7.72e-03 | NA | NA |
| 5. P | Q9JXW2 | Ribosomal protein L11 methyltransferase | 1.54e-05 | 2.71e-03 | NA | NA |
| 5. P | A6WHK9 | Ribosomal RNA large subunit methyltransferase F | 1.57e-05 | 8.16e-03 | NA | NA |
| 5. P | P44402 | Ribosomal protein L11 methyltransferase | 1.51e-05 | 3.66e-02 | NA | NA |
| 5. P | A8AIX5 | Ribosomal RNA large subunit methyltransferase F | 6.16e-06 | 1.63e-05 | NA | NA |
| 5. P | C1DPF6 | Ribosomal RNA large subunit methyltransferase F | 1.21e-05 | 6.51e-07 | NA | NA |
| 5. P | Q9JTE9 | Ribosomal RNA small subunit methyltransferase J | 4.03e-04 | 9.64e-03 | NA | NA |
| 5. P | C6D8Y7 | Ribosomal RNA large subunit methyltransferase F | 1.57e-06 | 4.75e-08 | NA | NA |
| 5. P | B9JXT0 | Ribosomal protein L11 methyltransferase | 6.14e-07 | 1.10e-05 | NA | NA |
| 5. P | B1XKZ0 | Ribosomal protein L11 methyltransferase | 2.97e-06 | 4.39e-02 | NA | NA |
| 5. P | B0CHK5 | Ribosomal protein L11 methyltransferase | 5.84e-07 | 9.41e-06 | NA | NA |
| 5. P | B0V7H8 | Ribosomal protein L11 methyltransferase | 8.16e-06 | 1.29e-02 | NA | NA |
| 5. P | A4VP05 | Ribosomal RNA large subunit methyltransferase F | 9.87e-06 | 6.46e-10 | NA | NA |
| 5. P | Q6LLY5 | Ribosomal protein L11 methyltransferase | 2.60e-05 | 2.10e-02 | NA | NA |
| 5. P | A5VZ65 | Ribosomal RNA large subunit methyltransferase F | 5.48e-06 | 4.60e-07 | NA | NA |
| 5. P | B0KQK4 | Ribosomal RNA large subunit methyltransferase F | 5.47e-06 | 9.66e-07 | NA | NA |
| 5. P | Q03MQ4 | Ribosomal protein L11 methyltransferase | 1.11e-06 | 3.08e-02 | NA | NA |
| 5. P | B7NNN9 | Ribosomal RNA large subunit methyltransferase F | 1.84e-06 | 8.33e-06 | NA | NA |
| 5. P | Q5PG24 | Ribosomal RNA large subunit methyltransferase F | 1.80e-06 | 7.51e-06 | NA | NA |
| 5. P | Q54527 | Aclacinomycin 10-hydroxylase RdmB | 1.59e-03 | 4.34e-03 | NA | NA |
| 5. P | A1V0M1 | Ribosomal protein L11 methyltransferase | 6.87e-05 | 8.26e-04 | NA | NA |
| 5. P | A9WVP1 | Ribosomal RNA small subunit methyltransferase G | 7.85e-06 | 4.20e-02 | NA | NA |
| 5. P | Q64RQ5 | Ribosomal RNA large subunit methyltransferase F | 1.34e-06 | 7.98e-09 | NA | NA |
| 5. P | B5FC65 | Ribosomal protein L11 methyltransferase | 1.06e-04 | 2.87e-02 | NA | NA |
| 5. P | A9MSU1 | Ribosomal RNA large subunit methyltransferase F | 5.86e-06 | 7.87e-06 | NA | NA |
| 5. P | Q8YI53 | Ribosomal protein L11 methyltransferase | 4.01e-07 | 4.77e-06 | NA | NA |
| 5. P | Q58669 | N(4)-bis(aminopropyl)spermidine synthase | 8.68e-05 | 2.13e-02 | NA | NA |
| 5. P | Q669D4 | Ribosomal RNA large subunit methyltransferase F | 8.80e-06 | 3.51e-07 | NA | NA |
| 5. P | Q04AV7 | Ribosomal protein L11 methyltransferase | 1.51e-07 | 2.43e-02 | NA | NA |
| 5. P | B9LZ49 | Ribosomal protein L11 methyltransferase | 7.88e-06 | 4.49e-02 | NA | NA |
| 5. P | C0QLV7 | Ribosomal protein L11 methyltransferase | 2.55e-06 | 8.47e-04 | NA | NA |
| 5. P | Q7VPN5 | Ribosomal protein L11 methyltransferase | 1.30e-05 | 1.55e-02 | NA | NA |
| 5. P | Q83LU4 | Ribosomal RNA large subunit methyltransferase F | 7.22e-06 | 1.37e-05 | NA | NA |
| 5. P | A3DAC9 | Ribosomal RNA large subunit methyltransferase F | 1.37e-05 | 3.66e-03 | NA | NA |
| 5. P | B1XYL2 | Ribosomal RNA small subunit methyltransferase G | 4.96e-07 | 7.02e-03 | NA | NA |
| 5. P | A6LJG3 | Ribosomal protein L11 methyltransferase | 4.32e-05 | 4.86e-03 | NA | NA |
| 5. P | Q9JYF4 | Ribosomal RNA small subunit methyltransferase J | 4.13e-04 | 5.94e-03 | NA | NA |
| 5. P | B2K7Y6 | Ribosomal RNA large subunit methyltransferase F | 8.75e-06 | 3.51e-07 | NA | NA |
| 5. P | Q4UZB8 | Ribosomal protein L11 methyltransferase | 8.07e-06 | 3.22e-02 | NA | NA |
| 5. P | A0KHV5 | Ribosomal RNA large subunit methyltransferase F | 1.02e-05 | 8.04e-08 | NA | NA |
| 5. P | A1RFA3 | Ribosomal protein L11 methyltransferase | 2.16e-05 | 3.10e-02 | NA | NA |
| 5. P | Q9HXG4 | Ribosomal RNA large subunit methyltransferase F | 1.31e-05 | 4.50e-06 | NA | NA |
| 5. P | Q8FJM4 | Ribosomal RNA large subunit methyltransferase F | 6.97e-06 | 3.77e-05 | NA | NA |
| 5. P | O86951 | Ribosomal protein L11 methyltransferase | 5.16e-06 | 1.59e-04 | NA | NA |
| 5. P | Q6AQF1 | Ribosomal protein L11 methyltransferase | 5.87e-06 | 1.88e-02 | NA | NA |
| 5. P | P60092 | Ribosomal protein L11 methyltransferase | 2.04e-05 | 1.53e-02 | NA | NA |
| 5. P | Q7TUS7 | Ribosomal protein L11 methyltransferase | 1.46e-07 | 1.98e-03 | NA | NA |
| 5. P | B7MGR5 | Ribosomal RNA large subunit methyltransferase F | 6.17e-06 | 7.58e-06 | NA | NA |
| 5. P | B7V1R2 | Ribosomal protein L11 methyltransferase | 1.09e-05 | 2.34e-02 | NA | NA |
| 5. P | A9R6I2 | Ribosomal RNA large subunit methyltransferase F | 8.27e-06 | 5.44e-07 | NA | NA |
| 5. P | C6DY35 | Ribosomal protein L11 methyltransferase | 6.07e-06 | 6.13e-03 | NA | NA |
| 5. P | C1DD01 | Ribosomal RNA small subunit methyltransferase J | 2.15e-04 | 3.78e-02 | NA | NA |
| 5. P | O67870 | Ribosomal protein L11 methyltransferase | 6.30e-06 | 4.14e-09 | NA | NA |
| 5. P | B7M782 | Ribosomal RNA large subunit methyltransferase F | 1.82e-06 | 7.58e-06 | NA | NA |
| 5. P | Q1ME53 | Ribosomal protein L11 methyltransferase | 1.25e-07 | 9.24e-06 | NA | NA |
| 5. P | B4U5A5 | Ribosomal protein L11 methyltransferase | 1.37e-06 | 3.78e-02 | NA | NA |
| 5. P | Q482M9 | Ribosomal RNA large subunit methyltransferase F | 6.40e-06 | 2.37e-06 | NA | NA |
| 5. P | A4Y1N1 | Ribosomal RNA large subunit methyltransferase F | 1.45e-05 | 1.86e-02 | NA | NA |
| 5. P | B7UM03 | Ribosomal RNA large subunit methyltransferase F | 1.93e-06 | 6.22e-06 | NA | NA |
| 5. P | Q3IBW7 | Ribosomal RNA large subunit methyltransferase F | 8.10e-06 | 6.82e-08 | NA | NA |
| 5. P | B9LFP4 | Ribosomal protein L11 methyltransferase | 3.15e-07 | 1.30e-02 | NA | NA |
| 5. P | Q478R6 | Ribosomal protein L11 methyltransferase | 3.54e-05 | 1.48e-03 | NA | NA |
| 5. P | Q9KRM2 | Ribosomal RNA large subunit methyltransferase F | 2.70e-05 | 3.88e-03 | NA | NA |
| 5. P | A7MEZ1 | Ribosomal RNA large subunit methyltransferase F | 5.29e-06 | 5.96e-08 | NA | NA |
| 5. P | C5BP64 | Ribosomal protein L11 methyltransferase | 1.99e-05 | 1.53e-02 | NA | NA |
| 5. P | Q2S6N0 | Ribosomal RNA small subunit methyltransferase G | 1.95e-06 | 3.24e-03 | NA | NA |
| 5. P | Q39Q76 | Ribosomal protein L11 methyltransferase | 2.19e-06 | 9.61e-04 | NA | NA |
| 5. P | A1SBR7 | Ribosomal RNA large subunit methyltransferase F | 6.10e-06 | 1.72e-12 | NA | NA |
| 5. P | Q8GBB2 | tRNA (adenine(58)-N(1))-methyltransferase TrmI | 3.43e-04 | 1.61e-02 | NA | NA |
| 5. P | Q8XVP2 | Ribosomal protein L11 methyltransferase | 7.26e-05 | 3.74e-04 | NA | NA |
| 5. P | Q24SS5 | Ribosomal protein L11 methyltransferase | 4.03e-08 | 3.89e-02 | NA | NA |
| 5. P | A8GBT4 | Ribosomal RNA large subunit methyltransferase F | 9.90e-06 | 5.24e-06 | NA | NA |
| 5. P | Q3SMB4 | Ribosomal protein L11 methyltransferase | 2.44e-05 | 1.77e-03 | NA | NA |
| 5. P | A5WFX2 | Ribosomal protein L11 methyltransferase | 2.55e-05 | 1.32e-02 | NA | NA |
| 5. P | Q2YPS7 | Ribosomal protein L11 methyltransferase | 7.01e-07 | 7.16e-06 | NA | NA |
| 5. P | Q2S9L7 | Ribosomal protein L11 methyltransferase | 4.39e-05 | 2.12e-03 | NA | NA |
| 5. P | Q1Q994 | Ribosomal RNA small subunit methyltransferase J | 5.01e-05 | 1.51e-02 | NA | NA |
| 5. P | Q54B60 | Probable inactive O-methyltransferase 11 | 2.92e-03 | 2.15e-02 | NA | NA |
| 5. P | A0LQ64 | Ribosomal protein L11 methyltransferase | 1.41e-05 | 3.72e-03 | NA | NA |
| 5. P | B7NAA7 | Ribosomal RNA large subunit methyltransferase F | 6.22e-06 | 6.71e-06 | NA | NA |
| 5. P | A5IHD3 | Ribosomal protein L11 methyltransferase | 9.97e-06 | 1.76e-02 | NA | NA |
| 5. P | Q1H501 | Ribosomal RNA large subunit methyltransferase F | 1.20e-05 | 2.34e-04 | NA | NA |
| 5. P | Q07UP0 | Ribosomal RNA small subunit methyltransferase G | 8.24e-05 | 3.35e-02 | NA | NA |
| 5. P | Q8UDP9 | Ribosomal protein L11 methyltransferase | 3.09e-07 | 1.27e-05 | NA | NA |
| 5. P | A0KNJ1 | Ribosomal protein L11 methyltransferase | 1.98e-04 | 4.77e-02 | NA | NA |
| 5. P | Q8EKF9 | Ribosomal RNA large subunit methyltransferase F | 1.41e-05 | 9.22e-04 | NA | NA |
| 5. P | Q98KD0 | Ribosomal protein L11 methyltransferase | 2.15e-07 | 7.15e-05 | NA | NA |
| 5. P | A5EVX5 | Ribosomal protein L11 methyltransferase | 4.19e-05 | 1.38e-02 | NA | NA |
| 5. P | A6H0G2 | Ribosomal RNA large subunit methyltransferase F | 1.17e-05 | 2.95e-06 | NA | NA |
| 5. P | Q6ANQ6 | Ribosomal RNA large subunit methyltransferase F | 6.43e-06 | 3.03e-12 | NA | NA |
| 5. P | Q10X25 | Ribosomal protein L11 methyltransferase | 2.66e-06 | 2.52e-02 | NA | NA |
| 5. P | B1KQE8 | Ribosomal protein L11 methyltransferase | 2.24e-05 | 1.65e-02 | NA | NA |
| 5. P | A6QBN7 | Ribosomal protein L11 methyltransferase | 6.80e-07 | 2.17e-03 | NA | NA |
| 5. P | B0S902 | Ribosomal RNA small subunit methyltransferase G | 1.73e-04 | 3.92e-02 | NA | NA |
| 5. P | Q11GT9 | Ribosomal protein L11 methyltransferase | 1.79e-07 | 1.89e-05 | NA | NA |
| 5. P | C3MEL0 | Ribosomal protein L11 methyltransferase | 5.82e-07 | 1.47e-05 | NA | NA |
| 5. P | B7LC90 | Ribosomal RNA large subunit methyltransferase F | 6.58e-06 | 7.58e-06 | NA | NA |
| 5. P | A3D9J5 | Ribosomal protein L11 methyltransferase | 2.07e-05 | 3.72e-02 | NA | NA |
| 5. P | Q4QLT2 | Ribosomal protein L11 methyltransferase | 1.51e-05 | 2.08e-02 | NA | NA |
| 5. P | B0KJZ2 | Ribosomal protein L11 methyltransferase | 8.97e-06 | 3.75e-02 | NA | NA |
| 5. P | B0SRZ9 | Ribosomal RNA small subunit methyltransferase G | 1.84e-04 | 3.92e-02 | NA | NA |
| 5. P | B1WNQ4 | Ribosomal protein L11 methyltransferase | 8.40e-07 | 4.16e-02 | NA | NA |
| 5. P | A2S5P8 | Ribosomal protein L11 methyltransferase | 6.82e-05 | 8.26e-04 | NA | NA |
| 5. P | Q7WF92 | Ribosomal protein L11 methyltransferase | 1.69e-04 | 2.52e-02 | NA | NA |
| 5. P | B2TVC2 | Ribosomal RNA large subunit methyltransferase F | 6.60e-06 | 7.58e-06 | NA | NA |
| 5. P | C0M9U4 | Ribosomal protein L11 methyltransferase | 1.23e-06 | 3.78e-02 | NA | NA |
| 5. P | Q323Y7 | Ribosomal RNA large subunit methyltransferase F | 6.04e-06 | 7.58e-06 | NA | NA |
| 5. P | C4ZXX9 | Ribosomal RNA large subunit methyltransferase F | 7.24e-06 | 1.34e-05 | NA | NA |
| 5. P | Q62GX2 | Ribosomal protein L11 methyltransferase | 6.65e-05 | 8.26e-04 | NA | NA |
| 5. P | B4T083 | Ribosomal RNA large subunit methyltransferase F | 5.75e-06 | 8.49e-06 | NA | NA |
| 5. P | A9KVB0 | Ribosomal RNA large subunit methyltransferase F | 1.67e-05 | 5.31e-03 | NA | NA |
| 5. P | A6T2B6 | Ribosomal protein L11 methyltransferase | 1.70e-04 | 4.11e-04 | NA | NA |
| 5. P | Q02RZ9 | Ribosomal RNA large subunit methyltransferase F | 1.48e-05 | 4.50e-06 | NA | NA |
| 5. P | Q9JW08 | Ribosomal protein L11 methyltransferase | 1.54e-05 | 2.28e-03 | NA | NA |
| 5. P | Q4FVS6 | Ribosomal RNA large subunit methyltransferase F | 5.88e-06 | 8.41e-07 | NA | NA |
| 5. P | Q8FZQ6 | Ribosomal protein L11 methyltransferase | 6.04e-07 | 4.77e-06 | NA | NA |
| 5. P | A9MIS5 | Ribosomal RNA large subunit methyltransferase F | 6.29e-06 | 2.88e-04 | NA | NA |
| 5. P | Q133Y8 | Ribosomal protein L11 methyltransferase | 4.13e-05 | 1.32e-04 | NA | NA |
| 5. P | B1JBB3 | Ribosomal RNA large subunit methyltransferase F | 4.50e-06 | 7.44e-06 | NA | NA |
| 5. P | Q5X7S8 | Ribosomal protein L11 methyltransferase | 1.12e-05 | 1.10e-02 | NA | NA |
| 5. P | A5IN97 | Ribosomal protein L11 methyltransferase | 1.72e-06 | 1.65e-04 | NA | NA |
| 5. P | A4YB19 | Ribosomal protein L11 methyltransferase | 2.14e-05 | 3.10e-02 | NA | NA |
| 5. P | Q31II5 | Ribosomal protein L11 methyltransferase | 9.50e-06 | 2.26e-03 | NA | NA |
| 5. P | Q8R6G7 | Ribosomal protein L11 methyltransferase | 3.72e-07 | 3.53e-02 | NA | NA |
| 5. P | A5WBC6 | Ribosomal RNA large subunit methyltransferase F | 1.06e-05 | 5.39e-06 | NA | NA |
| 5. P | Q88P77 | Ribosomal RNA large subunit methyltransferase F | 5.34e-06 | 8.17e-07 | NA | NA |
| 5. P | Q57551 | Uncharacterized protein MJ0086 | 5.05e-04 | 1.47e-02 | NA | NA |
| 5. P | A5UIB7 | Ribosomal protein L11 methyltransferase | 1.46e-05 | 2.56e-02 | NA | NA |
| 5. P | B2JH19 | Ribosomal protein L11 methyltransferase | 2.04e-05 | 3.43e-04 | NA | NA |
| 5. P | B5E9X4 | Ribosomal protein L11 methyltransferase | 1.18e-05 | 1.91e-02 | NA | NA |
| 5. P | A7FGU1 | Ribosomal RNA large subunit methyltransferase F | 8.37e-06 | 3.51e-07 | NA | NA |
| 5. P | A3M6R7 | Ribosomal protein L11 methyltransferase | 9.69e-06 | 1.29e-02 | NA | NA |
| 5. P | B0VLL0 | Ribosomal protein L11 methyltransferase | 8.47e-06 | 1.87e-02 | NA | NA |
| 5. P | B7LJV2 | Ribosomal RNA large subunit methyltransferase F | 7.02e-06 | 2.19e-05 | NA | NA |
| 5. P | Q1CHT7 | Ribosomal RNA large subunit methyltransferase F | 8.35e-06 | 2.73e-07 | NA | NA |
| 5. P | P60095 | Ribosomal protein L11 methyltransferase | 4.29e-07 | 3.14e-03 | NA | NA |
| 5. P | A6VM22 | Ribosomal protein L11 methyltransferase | 1.54e-05 | 3.40e-02 | NA | NA |
| 5. P | A6V0S3 | Ribosomal RNA large subunit methyltransferase F | 1.07e-05 | 3.31e-06 | NA | NA |
| 5. P | A9M676 | Ribosomal protein L11 methyltransferase | 5.34e-07 | 4.77e-06 | NA | NA |
| 5. P | A5UD93 | Ribosomal protein L11 methyltransferase | 1.26e-05 | 2.56e-02 | NA | NA |
| 5. P | Q32I85 | Ribosomal RNA large subunit methyltransferase F | 2.00e-06 | 1.59e-05 | NA | NA |
| 5. P | B9KDE1 | Ribosomal protein L11 methyltransferase | 1.55e-05 | 3.43e-03 | NA | NA |
| 5. P | Q1C6E5 | Ribosomal RNA large subunit methyltransferase F | 8.88e-06 | 2.73e-07 | NA | NA |
| 5. P | B5F0A4 | Ribosomal RNA large subunit methyltransferase F | 6.05e-06 | 5.00e-06 | NA | NA |
| 5. P | B1JH95 | Ribosomal RNA large subunit methyltransferase F | 7.68e-06 | 3.51e-07 | NA | NA |
| 5. P | Q5M6B7 | Ribosomal protein L11 methyltransferase | 1.04e-06 | 2.20e-02 | NA | NA |
| 5. P | B5YS99 | Ribosomal RNA large subunit methyltransferase F | 7.63e-06 | 7.82e-05 | NA | NA |
| 5. P | Q48MF3 | Ribosomal RNA large subunit methyltransferase F | 8.02e-06 | 2.13e-06 | NA | NA |
| 5. P | Q1QA78 | Ribosomal protein L11 methyltransferase | 1.57e-05 | 6.08e-03 | NA | NA |
| 5. P | Q5F7B7 | Ribosomal RNA small subunit methyltransferase J | 4.40e-04 | 7.72e-03 | NA | NA |
| 5. P | Q12T32 | Ribosomal RNA large subunit methyltransferase F | 1.10e-05 | 3.72e-03 | NA | NA |
| 5. P | B1LM99 | Ribosomal RNA large subunit methyltransferase F | 6.25e-06 | 1.89e-05 | NA | NA |
| 5. P | A1KS36 | Ribosomal protein L11 methyltransferase | 1.65e-05 | 1.33e-03 | NA | NA |
| 5. P | Q4FR06 | Ribosomal RNA small subunit methyltransferase J | 1.77e-03 | 2.52e-02 | NA | NA |
| 5. P | Q30Z06 | Ribosomal RNA small subunit methyltransferase G | 1.04e-05 | 6.46e-04 | NA | NA |
| 5. P | B5EVS5 | Ribosomal RNA large subunit methyltransferase F | 7.57e-06 | 2.03e-04 | NA | NA |
| 5. P | A7ZES6 | Ribosomal protein L11 methyltransferase | 1.04e-04 | 7.66e-03 | NA | NA |
| 5. P | Q9CLW2 | Ribosomal protein L11 methyltransferase | 1.13e-05 | 1.51e-02 | NA | NA |
| 5. P | Q5FAH7 | Ribosomal protein L11 methyltransferase | 1.39e-05 | 1.98e-03 | NA | NA |
| 5. P | B8E680 | Ribosomal protein L11 methyltransferase | 2.69e-05 | 3.12e-02 | NA | NA |
| 5. P | B2UCS1 | Ribosomal protein L11 methyltransferase | 2.05e-05 | 1.02e-03 | NA | NA |
| 5. P | A5G9G5 | Ribosomal protein L11 methyltransferase | 3.91e-06 | 3.53e-02 | NA | NA |
| 5. P | A0RQL1 | Ribosomal protein L11 methyltransferase | 1.66e-06 | 8.26e-04 | NA | NA |
| 5. P | B1ZUS4 | Ribosomal protein L11 methyltransferase | 1.49e-06 | 1.68e-03 | NA | NA |
| 5. P | A1KV29 | Ribosomal RNA small subunit methyltransferase J | 4.10e-04 | 6.64e-03 | NA | NA |
| 5. P | B9K9N3 | Ribosomal protein L11 methyltransferase | 8.19e-06 | 9.44e-05 | NA | NA |
| 5. P | C0RE56 | Ribosomal protein L11 methyltransferase | 6.27e-07 | 4.77e-06 | NA | NA |
| 5. P | D3KU67 | Acetylserotonin O-methyltransferase | 2.72e-03 | 3.66e-02 | NA | NA |
| 5. P | B5FP91 | Ribosomal RNA large subunit methyltransferase F | 2.02e-06 | 8.49e-06 | NA | NA |
| 5. P | A6WTE5 | Ribosomal protein L11 methyltransferase | 2.00e-05 | 3.98e-02 | NA | NA |
| 5. P | Q31E43 | Ribosomal RNA small subunit methyltransferase J | 6.07e-04 | 1.29e-03 | NA | NA |
| 5. P | B2SYT3 | Ribosomal protein L11 methyltransferase | 6.95e-05 | 1.09e-04 | NA | NA |
| 5. P | Q0BIF9 | Ribosomal protein L11 methyltransferase | 6.76e-05 | 2.91e-04 | NA | NA |
| 5. P | Q5ZKT6 | EEF1A lysine methyltransferase 1 | 1.42e-02 | 1.22e-02 | NA | NA |
| 5. P | P0DD19 | Ribosomal protein L11 methyltransferase | 8.82e-07 | 4.99e-02 | NA | NA |
| 5. P | Q0T6F4 | Ribosomal RNA large subunit methyltransferase F | 2.57e-06 | 1.37e-05 | NA | NA |
| 5. P | Q87C45 | Ribosomal protein L11 methyltransferase | 7.78e-06 | 1.14e-02 | NA | NA |
| 5. P | Q3JC88 | Ribosomal protein L11 methyltransferase | 8.88e-06 | 4.07e-02 | NA | NA |
| 5. P | A4SKI2 | Ribosomal RNA large subunit methyltransferase F | 1.53e-06 | 5.28e-07 | NA | NA |
| 5. P | Q9RU72 | Ribosomal protein L11 methyltransferase | 7.82e-06 | 4.01e-05 | NA | NA |
| 5. P | Q7VAM5 | Ribosomal protein L11 methyltransferase | 1.97e-07 | 4.63e-02 | NA | NA |
| 5. P | B1XT48 | Ribosomal protein L11 methyltransferase | 8.14e-05 | 6.14e-04 | NA | NA |
| 5. P | A1AT86 | Ribosomal protein L11 methyltransferase | 1.65e-06 | 2.08e-02 | NA | NA |
| 5. P | A6W2M9 | Ribosomal RNA large subunit methyltransferase F | 9.54e-06 | 3.86e-10 | NA | NA |
| 5. P | Q63QN9 | Ribosomal protein L11 methyltransferase | 6.63e-05 | 8.76e-04 | NA | NA |
| 5. P | Q3Z3X8 | Ribosomal RNA large subunit methyltransferase F | 7.10e-06 | 7.58e-06 | NA | NA |
| 5. P | Q5HTY7 | Ribosomal protein L11 methyltransferase | 5.16e-07 | 2.40e-03 | NA | NA |
| 5. P | Q5ZYB1 | Ribosomal protein L11 methyltransferase | 6.70e-06 | 1.32e-02 | NA | NA |
| 5. P | A7ZY64 | Ribosomal RNA large subunit methyltransferase F | 6.76e-06 | 1.34e-05 | NA | NA |
| 5. P | B4RIY4 | Ribosomal RNA small subunit methyltransferase J | 3.22e-04 | 8.16e-03 | NA | NA |
| 5. P | Q4ZXI1 | Ribosomal RNA large subunit methyltransferase F | 7.76e-06 | 5.39e-07 | NA | NA |
| 5. P | Q0I0H7 | Ribosomal RNA large subunit methyltransferase F | 1.50e-05 | 9.06e-04 | NA | NA |
| 5. P | B0T1G7 | Ribosomal protein L11 methyltransferase | 1.33e-06 | 1.16e-03 | NA | NA |
| 5. P | Q5LBA7 | Ribosomal RNA large subunit methyltransferase F | 4.89e-06 | 2.79e-08 | NA | NA |
| 5. P | B1MZ55 | Ribosomal protein L11 methyltransferase | 2.46e-08 | 1.93e-02 | NA | NA |
| 5. P | C3K6G1 | Ribosomal RNA large subunit methyltransferase F | 8.40e-06 | 1.01e-05 | NA | NA |
| 5. P | Q5DYC3 | Ribosomal RNA large subunit methyltransferase F | 2.89e-06 | 1.07e-04 | NA | NA |
| 5. P | A9AI41 | Ribosomal protein L11 methyltransferase | 7.05e-05 | 2.76e-04 | NA | NA |
| 5. P | Q4FRP0 | Ribosomal protein L11 methyltransferase | 1.44e-05 | 3.15e-02 | NA | NA |
| 5. P | B1JVC0 | Ribosomal protein L11 methyltransferase | 6.69e-05 | 1.77e-04 | NA | NA |
| 5. P | B8E1A7 | Ribosomal protein L11 methyltransferase | 2.15e-08 | 1.25e-02 | NA | NA |
| 5. P | B5BC01 | Ribosomal RNA large subunit methyltransferase F | 6.05e-06 | 7.51e-06 | NA | NA |
| 5. P | Q0HP08 | Ribosomal RNA large subunit methyltransferase F | 1.39e-05 | 1.57e-03 | NA | NA |
| 5. P | Q11XA9 | Ribosomal RNA large subunit methyltransferase F | 8.77e-06 | 1.46e-05 | NA | NA |
| 5. P | Q5M1S5 | Ribosomal protein L11 methyltransferase | 3.97e-06 | 2.20e-02 | NA | NA |
| 5. P | A0K4C9 | Ribosomal protein L11 methyltransferase | 6.65e-05 | 1.41e-04 | NA | NA |
| 5. P | A7I0N5 | Ribosomal protein L11 methyltransferase | 2.51e-05 | 5.06e-03 | NA | NA |
| 5. P | A9KKT8 | Ribosomal protein L11 methyltransferase | 2.83e-07 | 2.79e-02 | NA | NA |
| 5. P | A0A286LEZ7 | Psilocybin synthase | 6.19e-08 | 2.60e-03 | NA | NA |
| 5. P | Q21P11 | Ribosomal RNA large subunit methyltransferase F | 9.44e-06 | 3.67e-11 | NA | NA |
| 5. P | B8E3W0 | Ribosomal RNA large subunit methyltransferase F | 1.38e-05 | 1.54e-03 | NA | NA |
| 5. P | O53532 | Uncharacterized S-adenosylmethionine-dependent methyltransferase Rv2258c | 2.16e-04 | 2.08e-02 | NA | NA |
| 5. P | Q8D935 | Ribosomal RNA large subunit methyltransferase F | 3.78e-05 | 1.73e-02 | NA | NA |
| 5. P | A8HA69 | Ribosomal RNA large subunit methyltransferase F | 2.44e-05 | 7.35e-05 | NA | NA |
| 5. P | A6VUQ9 | Ribosomal RNA small subunit methyltransferase J | 7.97e-04 | 1.74e-02 | NA | NA |
| 5. P | Q89YP0 | Ribosomal RNA large subunit methyltransferase F | 1.54e-06 | 6.82e-08 | NA | NA |
| 5. P | Q02FH0 | Ribosomal protein L11 methyltransferase | 1.05e-05 | 2.34e-02 | NA | NA |
| 5. P | C3K6W5 | Ribosomal protein L11 methyltransferase | 1.19e-05 | 4.80e-02 | NA | NA |
| 5. P | B4E5V2 | Ribosomal protein L11 methyltransferase | 7.05e-05 | 1.25e-04 | NA | NA |
| 5. P | B7K2J4 | Ribosomal protein L11 methyltransferase | 2.60e-06 | 7.91e-03 | NA | NA |
| 5. P | Q89FW1 | Ribosomal protein L11 methyltransferase | 5.16e-05 | 1.09e-05 | NA | NA |
| 5. P | Q5E263 | Ribosomal protein L11 methyltransferase | 1.32e-04 | 2.87e-02 | NA | NA |
| 5. P | Q2K6E0 | Ribosomal protein L11 methyltransferase | 2.07e-07 | 2.41e-06 | NA | NA |
| 5. P | B0UV84 | Ribosomal protein L11 methyltransferase | 1.68e-05 | 2.28e-02 | NA | NA |
| 5. P | A9L5E5 | Ribosomal protein L11 methyltransferase | 2.03e-05 | 4.49e-02 | NA | NA |
| 5. P | A0LE46 | Ribosomal RNA small subunit methyltransferase G | 1.37e-05 | 1.27e-03 | NA | NA |
| 5. P | B1L841 | Ribosomal protein L11 methyltransferase | 1.48e-06 | 1.52e-04 | NA | NA |
| 5. P | B0JX03 | Ribosomal protein L11 methyltransferase | 1.77e-06 | 2.04e-02 | NA | NA |
| 5. P | Q08A02 | Ribosomal RNA large subunit methyltransferase F | 2.47e-05 | 5.61e-03 | NA | NA |
| 5. P | A6T6Q1 | Ribosomal RNA large subunit methyltransferase F | 1.75e-06 | 7.85e-07 | NA | NA |
| 5. P | Q8ZQN4 | Ribosomal RNA large subunit methyltransferase F | 6.18e-06 | 8.49e-06 | NA | NA |
| 5. P | Q6D958 | Ribosomal RNA large subunit methyltransferase F | 3.82e-06 | 2.91e-08 | NA | NA |
| 5. P | A3MRB1 | Ribosomal protein L11 methyltransferase | 6.79e-05 | 8.26e-04 | NA | NA |
| 5. P | A8ZW25 | Ribosomal protein L11 methyltransferase | 9.39e-06 | 1.68e-03 | NA | NA |
| 5. P | B2IH12 | Ribosomal protein L11 methyltransferase | 6.51e-06 | 3.23e-04 | NA | NA |
| 5. P | Q60354 | Putative methyltransferase MJ0046 | 8.65e-08 | 1.16e-13 | NA | NA |
| 5. P | Q9HUW3 | Ribosomal protein L11 methyltransferase | 1.06e-05 | 2.34e-02 | NA | NA |
| 5. P | Q2SZE1 | Ribosomal protein L11 methyltransferase | 6.05e-05 | 1.85e-04 | NA | NA |
| 5. P | A0KRF2 | Ribosomal RNA large subunit methyltransferase F | 1.39e-05 | 1.24e-03 | NA | NA |
| 5. P | Q6AL31 | Ribosomal RNA small subunit methyltransferase J | 6.97e-04 | 3.19e-03 | NA | NA |
| 5. P | Q0A4L8 | Ribosomal RNA small subunit methyltransferase G | 6.47e-06 | 4.74e-03 | NA | NA |
| 5. P | Q42653 | Flavone 3'-O-methyltransferase OMT2 | 9.21e-04 | 1.69e-02 | NA | NA |
| 5. P | A8G6G4 | Ribosomal protein L11 methyltransferase | 9.72e-06 | 1.86e-02 | NA | NA |
| 5. P | A1W0A4 | Ribosomal protein L11 methyltransferase | 1.12e-07 | 3.91e-03 | NA | NA |
| 5. P | Q60A25 | Ribosomal protein L11 methyltransferase | 5.25e-06 | 1.12e-02 | NA | NA |
| 5. P | A0M4S0 | Ribosomal RNA large subunit methyltransferase F | 1.42e-06 | 3.88e-09 | NA | NA |
| 5. P | Q1J043 | Ribosomal protein L11 methyltransferase | 3.62e-05 | 1.95e-04 | NA | NA |
| 5. P | P37876 | Uncharacterized protein YtxK | 5.32e-04 | 4.07e-03 | NA | NA |
| 5. P | Q39JS9 | Ribosomal protein L11 methyltransferase | 7.11e-05 | 1.91e-04 | NA | NA |
| 5. P | Q46XA5 | Ribosomal protein L11 methyltransferase | 2.57e-05 | 3.77e-04 | NA | NA |
| 5. P | Q7K3B9 | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase | 7.06e-08 | 6.96e-03 | NA | NA |
| 5. P | Q6F9P9 | Ribosomal protein L11 methyltransferase | 8.77e-06 | 4.42e-02 | NA | NA |
| 5. P | Q7MLD9 | Ribosomal RNA large subunit methyltransferase F | 3.02e-05 | 1.94e-02 | NA | NA |
| 5. P | P60091 | Ribosomal protein L11 methyltransferase | 2.83e-05 | 1.95e-03 | NA | NA |
| 5. P | A0KQY8 | Ribosomal RNA small subunit methyltransferase G | 2.70e-06 | 1.43e-02 | NA | NA |
| 5. P | A8G1Q8 | Ribosomal RNA large subunit methyltransferase F | 2.92e-04 | 3.20e-02 | NA | NA |
| 5. P | B4TQW9 | Ribosomal RNA large subunit methyltransferase F | 1.82e-06 | 5.55e-06 | NA | NA |
| 5. P | Q0I1Y6 | Ribosomal protein L11 methyltransferase | 1.82e-05 | 4.66e-02 | NA | NA |
| 5. P | Q1REB8 | Ribosomal RNA large subunit methyltransferase F | 6.44e-06 | 7.58e-06 | NA | NA |
| 5. P | Q31N39 | Ribosomal protein L11 methyltransferase | 1.05e-07 | 2.23e-02 | NA | NA |
| 5. P | A9WD89 | Ribosomal protein L11 methyltransferase | 2.40e-07 | 1.30e-02 | NA | NA |
| 5. P | A3NDQ7 | Ribosomal protein L11 methyltransferase | 6.60e-05 | 9.22e-04 | NA | NA |
| 5. P | Q1QEW1 | Ribosomal RNA large subunit methyltransferase F | 9.29e-06 | 2.17e-06 | NA | NA |
| 5. P | Q0K6X3 | Ribosomal protein L11 methyltransferase | 2.69e-05 | 9.94e-04 | NA | NA |
| 5. P | Q8KG70 | Ribosomal protein L11 methyltransferase | 8.36e-06 | 2.40e-03 | NA | NA |
| 5. P | Q3JNI0 | Ribosomal protein L11 methyltransferase | 6.61e-05 | 9.22e-04 | NA | NA |
| 5. P | A1RQ03 | Ribosomal RNA large subunit methyltransferase F | 7.00e-06 | 1.86e-02 | NA | NA |
| 5. P | Q5SKN4 | tRNA (adenine(58)-N(1))-methyltransferase TrmI | 3.43e-04 | 9.64e-03 | NA | NA |
| 5. P | A4XY67 | Ribosomal RNA large subunit methyltransferase F | 1.27e-05 | 1.50e-07 | NA | NA |
| 5. P | B2S6P1 | Ribosomal protein L11 methyltransferase | 4.94e-07 | 7.16e-06 | NA | NA |
| 5. P | Q2S4C3 | Ribosomal protein L11 methyltransferase | 2.30e-07 | 4.86e-05 | NA | NA |
| 5. P | Q38XP2 | Ribosomal protein L11 methyltransferase | 3.53e-08 | 5.89e-03 | NA | NA |
| 5. P | B8NY85 | O-methyltransferase agiB | 2.88e-03 | 3.27e-03 | NA | NA |
| 5. P | Q1DD74 | Ribosomal protein L11 methyltransferase | 4.64e-06 | 2.83e-02 | NA | NA |
| 5. P | B0R4J5 | Chemotaxis protein methyltransferase | 3.59e-04 | 3.22e-02 | NA | NA |
| 5. P | B3PTU0 | Ribosomal protein L11 methyltransferase | 2.46e-07 | 5.50e-06 | NA | NA |
| 5. P | Q1I4C5 | Ribosomal protein L11 methyltransferase | 1.09e-05 | 2.27e-02 | NA | NA |
| 5. P | C4LAF1 | Ribosomal protein L11 methyltransferase | 1.60e-04 | 8.98e-03 | NA | NA |
| 5. P | B9JH32 | Ribosomal protein L11 methyltransferase | 1.60e-07 | 1.79e-05 | NA | NA |
| 5. P | B7H0I7 | Ribosomal protein L11 methyltransferase | 7.78e-06 | 1.29e-02 | NA | NA |
| 5. P | Q81ZZ9 | Ribosomal protein L11 methyltransferase | 1.93e-05 | 4.67e-03 | NA | NA |
| 5. P | B1X7D7 | Ribosomal RNA large subunit methyltransferase F | 6.44e-06 | 1.34e-05 | NA | NA |
| 5. P | Q3APK2 | Ribosomal RNA small subunit methyltransferase G | 3.65e-06 | 1.33e-02 | NA | NA |
| 5. P | A3M2K0 | Ribosomal RNA small subunit methyltransferase J | 1.27e-03 | 4.01e-02 | NA | NA |
| 5. P | A4G8P4 | Ribosomal protein L11 methyltransferase | 1.81e-04 | 5.09e-04 | NA | NA |
| 5. P | A9M1A6 | Ribosomal RNA small subunit methyltransferase J | 3.69e-04 | 9.64e-03 | NA | NA |
| 5. P | B5XIN3 | Ribosomal protein L11 methyltransferase | 8.67e-07 | 4.66e-02 | NA | NA |
| 5. P | B3R6K3 | Ribosomal protein L11 methyltransferase | 2.89e-05 | 7.92e-04 | NA | NA |
| 5. P | B3E5Z5 | Ribosomal protein L11 methyltransferase | 1.66e-06 | 3.60e-03 | NA | NA |
| 5. P | Q4KHU0 | Ribosomal RNA large subunit methyltransferase F | 1.01e-05 | 1.41e-05 | NA | NA |
| 6. F | Q9CFX1 | Ribosomal RNA small subunit methyltransferase G | 3.73e-06 | NA | NA | 0.5271 |
| 6. F | Q3BML8 | Ribosomal RNA small subunit methyltransferase G | 1.24e-06 | NA | NA | 0.5307 |
| 6. F | B2TUM0 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.84e-05 | NA | NA | 0.6068 |
| 6. F | P67055 | Demethylmenaquinone methyltransferase | 2.12e-04 | NA | NA | 0.4852 |
| 6. F | A3M8J9 | Ribosomal RNA small subunit methyltransferase C | 2.76e-05 | NA | NA | 0.6415 |
| 6. F | A0PX79 | Ribosomal RNA small subunit methyltransferase G | 2.02e-06 | NA | NA | 0.517 |
| 6. F | B7GWT8 | Ribosomal RNA small subunit methyltransferase C | 2.66e-05 | NA | NA | 0.6226 |
| 6. F | A8FSS4 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 6.93e-05 | NA | NA | 0.6078 |
| 6. F | A2RK93 | Ribosomal RNA small subunit methyltransferase G | 3.41e-06 | NA | NA | 0.5418 |
| 6. F | Q13SP1 | Ribosomal RNA small subunit methyltransferase G | 2.51e-07 | NA | NA | 0.4846 |
| 6. F | A5U9P7 | Ribosomal RNA small subunit methyltransferase G | 2.91e-05 | NA | NA | 0.5808 |
| 6. F | Q7VG38 | Ribosomal RNA small subunit methyltransferase G | 6.84e-06 | NA | NA | 0.5676 |
| 6. F | B8ZTI4 | tRNA (guanine-N(7)-)-methyltransferase | 2.34e-05 | NA | NA | 0.5509 |
| 6. F | B1YC47 | Protein-L-isoaspartate O-methyltransferase | 2.93e-05 | NA | NA | 0.4385 |
| 6. F | A9A6C8 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.25e-04 | NA | NA | 0.4819 |
| 6. F | B0S3V0 | Ribosomal RNA small subunit methyltransferase G | 3.74e-06 | NA | NA | 0.5078 |
| 6. F | Q8DHH6 | tRNA (guanine-N(7)-)-methyltransferase | 1.23e-06 | NA | NA | 0.5139 |
| 6. F | P94298 | Demethylmenaquinone methyltransferase | 2.41e-04 | NA | NA | 0.542 |
| 6. F | B1LJR4 | Ribosomal RNA large subunit methyltransferase K/L | 1.70e-03 | NA | NA | 0.5996 |
| 6. F | B0VMY0 | Ribosomal RNA small subunit methyltransferase G | 1.84e-06 | NA | NA | 0.519 |
| 6. F | Q8NLS3 | tRNA (guanine-N(7)-)-methyltransferase | 3.97e-05 | NA | NA | 0.4787 |
| 6. F | Q9F411 | tRNA (guanine-N(7)-)-methyltransferase | 8.35e-06 | NA | NA | 0.5791 |
| 6. F | Q971W2 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 1.71e-04 | NA | NA | 0.5618 |
| 6. F | C5BED3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.61e-05 | NA | NA | 0.5211 |
| 6. F | C3SBW0 | Pavine N-methyltransferase | 6.27e-03 | NA | NA | 0.4176 |
| 6. F | B1KQN1 | Ribosomal RNA small subunit methyltransferase F | 3.07e-03 | NA | NA | 0.5023 |
| 6. F | O32036 | tRNA 5-hydroxyuridine methyltransferase | 8.06e-06 | NA | NA | 0.5276 |
| 6. F | A4FYN1 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.16e-04 | NA | NA | 0.4858 |
| 6. F | Q88CS7 | tRNA (guanine-N(7)-)-methyltransferase | 2.09e-05 | NA | NA | 0.4707 |
| 6. F | B7NPF5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.12e-05 | NA | NA | 0.51 |
| 6. F | Q8F9Q1 | tRNA (guanine-N(7)-)-methyltransferase | 7.19e-06 | NA | NA | 0.5384 |
| 6. F | Q87AR1 | Ribosomal RNA small subunit methyltransferase B | 1.87e-03 | NA | NA | 0.4733 |
| 6. F | B7NAK5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.69e-05 | NA | NA | 0.5083 |
| 6. F | A1A2F7 | Ribosomal RNA small subunit methyltransferase H | 8.55e-04 | NA | NA | 0.4571 |
| 6. F | Q3IY65 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 8.76e-04 | NA | NA | 0.3849 |
| 6. F | Q83WC3 | Sarcosine/dimethylglycine N-methyltransferase | 1.95e-05 | NA | NA | 0.4515 |
| 6. F | Q87D24 | Ribosomal RNA small subunit methyltransferase G | 3.92e-07 | NA | NA | 0.529 |
| 6. F | B8ZJU9 | Ribosomal RNA small subunit methyltransferase G | 3.26e-06 | NA | NA | 0.4767 |
| 6. F | Q32B61 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5192 |
| 6. F | Q88L39 | Ribosomal RNA large subunit methyltransferase K/L | 2.59e-03 | NA | NA | 0.4974 |
| 6. F | B8H8Y9 | Ribosomal RNA small subunit methyltransferase G | 6.70e-06 | NA | NA | 0.5271 |
| 6. F | C6DJG4 | Ribosomal RNA small subunit methyltransferase G | 1.22e-06 | NA | NA | 0.5259 |
| 6. F | B7GHP8 | Demethylmenaquinone methyltransferase | 2.29e-04 | NA | NA | 0.5005 |
| 6. F | Q6MS67 | Ribosomal RNA small subunit methyltransferase G | 6.94e-04 | NA | NA | 0.4957 |
| 6. F | Q32KX8 | Methyltransferase-like 26 | 3.30e-09 | NA | NA | 0.62 |
| 6. F | Q1JDG1 | Ribosomal RNA small subunit methyltransferase G | 4.49e-06 | NA | NA | 0.4844 |
| 6. F | A8ACP6 | Ribosomal RNA small subunit methyltransferase G | 1.53e-06 | NA | NA | 0.5031 |
| 6. F | Q02U31 | tRNA (guanine-N(7)-)-methyltransferase | 2.78e-05 | NA | NA | 0.4433 |
| 6. F | B4F1L5 | Ribosomal RNA small subunit methyltransferase B | 7.31e-04 | NA | NA | 0.4928 |
| 6. F | A8FEK9 | Demethylmenaquinone methyltransferase | 3.90e-04 | NA | NA | 0.486 |
| 6. F | Q4ZM56 | tRNA (guanine-N(7)-)-methyltransferase | 3.42e-05 | NA | NA | 0.5041 |
| 6. F | A6U593 | Ribosomal RNA small subunit methyltransferase G | 1.98e-06 | NA | NA | 0.4789 |
| 6. F | A5I814 | Ribosomal RNA small subunit methyltransferase G | 1.90e-06 | NA | NA | 0.4991 |
| 6. F | Q0TAW9 | Ribosomal RNA small subunit methyltransferase G | 1.37e-06 | NA | NA | 0.4993 |
| 6. F | Q2A5Y4 | Ribosomal RNA small subunit methyltransferase G | 1.28e-06 | NA | NA | 0.5452 |
| 6. F | A8AVJ7 | Ribosomal RNA small subunit methyltransferase G | 3.18e-06 | NA | NA | 0.473 |
| 6. F | A2SJR5 | tRNA (guanine-N(7)-)-methyltransferase | 3.22e-03 | NA | NA | 0.4706 |
| 6. F | Q5KU59 | Ribosomal RNA small subunit methyltransferase G | 2.25e-07 | NA | NA | 0.4512 |
| 6. F | Q03CJ9 | Ribosomal RNA small subunit methyltransferase G | 1.32e-06 | NA | NA | 0.5176 |
| 6. F | Q5WAG5 | Ribosomal RNA small subunit methyltransferase G | 1.97e-07 | NA | NA | 0.5148 |
| 6. F | A5UGZ7 | Ribosomal RNA small subunit methyltransferase G | 3.26e-06 | NA | NA | 0.4979 |
| 6. F | B7I508 | Ribosomal RNA small subunit methyltransferase G | 1.92e-06 | NA | NA | 0.5367 |
| 6. F | Q9HH35 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.52e-05 | NA | NA | 0.5273 |
| 6. F | Q0HPF1 | Ribosomal RNA small subunit methyltransferase G | 2.23e-06 | NA | NA | 0.5181 |
| 6. F | A4TN73 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 6.87e-05 | NA | NA | 0.5836 |
| 6. F | B0TW44 | Ribosomal RNA small subunit methyltransferase G | 1.62e-06 | NA | NA | 0.56 |
| 6. F | B5R1E5 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4835 |
| 6. F | B1IQ11 | Ribosomal RNA small subunit methyltransferase B | 1.29e-03 | NA | NA | 0.484 |
| 6. F | A9NBA9 | Ribosomal RNA small subunit methyltransferase G | 1.71e-06 | NA | NA | 0.5735 |
| 6. F | Q71Y84 | Demethylmenaquinone methyltransferase | 2.12e-04 | NA | NA | 0.4842 |
| 6. F | Q5X0Z7 | Ribosomal RNA small subunit methyltransferase G | 4.36e-06 | NA | NA | 0.5494 |
| 6. F | B7N0S9 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.5194 |
| 6. F | A1UU46 | tRNA (guanine-N(7)-)-methyltransferase | 7.04e-05 | NA | NA | 0.476 |
| 6. F | B4TRN5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.74e-05 | NA | NA | 0.5927 |
| 6. F | A7ZYQ0 | Ribosomal RNA large subunit methyltransferase K/L | 1.79e-03 | NA | NA | 0.5675 |
| 6. F | Q88T09 | Ribosomal RNA small subunit methyltransferase G | 2.75e-07 | NA | NA | 0.4781 |
| 6. F | O27283 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 7.41e-05 | NA | NA | 0.5483 |
| 6. F | P21921 | Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] | 8.81e-04 | NA | NA | 0.4953 |
| 6. F | A9KX16 | Ribosomal RNA small subunit methyltransferase G | 2.00e-06 | NA | NA | 0.5044 |
| 6. F | Q7MSS6 | Ribosomal RNA small subunit methyltransferase H | 3.29e-04 | NA | NA | 0.4465 |
| 6. F | Q8Z841 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.84e-05 | NA | NA | 0.5926 |
| 6. F | Q5HCI5 | Ribosomal RNA small subunit methyltransferase G | 2.18e-06 | NA | NA | 0.4821 |
| 6. F | B4SV89 | Ribosomal RNA small subunit methyltransferase F | 3.61e-03 | NA | NA | 0.4784 |
| 6. F | A7ZD05 | Ribosomal RNA small subunit methyltransferase H | 1.24e-04 | NA | NA | 0.4426 |
| 6. F | B2J5Q6 | Ribosomal RNA small subunit methyltransferase G | 1.44e-06 | NA | NA | 0.5281 |
| 6. F | Q9JWE6 | Ubiquinone biosynthesis O-methyltransferase | 5.02e-06 | NA | NA | 0.4941 |
| 6. F | Q8ZGG1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.25e-05 | NA | NA | 0.5868 |
| 6. F | Q6DJF8 | Probable methyltransferase-like protein 23 | 2.41e-07 | NA | NA | 0.5326 |
| 6. F | B7H7A0 | Ribosomal RNA small subunit methyltransferase G | 3.06e-06 | NA | NA | 0.468 |
| 6. F | Q1IVV7 | Ribosomal RNA small subunit methyltransferase G | 4.07e-06 | NA | NA | 0.4973 |
| 6. F | A5WAD6 | tRNA (guanine-N(7)-)-methyltransferase | 1.97e-05 | NA | NA | 0.4481 |
| 6. F | Q3JXU8 | Ribosomal RNA small subunit methyltransferase G | 4.38e-06 | NA | NA | 0.4191 |
| 6. F | Q9KL20 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 2.36e-05 | NA | NA | 0.5976 |
| 6. F | A7GXS7 | Carboxy-S-adenosyl-L-methionine synthase | 3.68e-04 | NA | NA | 0.5149 |
| 6. F | Q3A6I7 | tRNA (guanine-N(7)-)-methyltransferase | 2.93e-07 | NA | NA | 0.5719 |
| 6. F | B6YX51 | Protein-L-isoaspartate O-methyltransferase | 2.04e-05 | NA | NA | 0.4216 |
| 6. F | A1A3X4 | Ribosomal RNA small subunit methyltransferase G | 1.58e-05 | NA | NA | 0.5742 |
| 6. F | Q8Z5M9 | Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 6.71e-10 | NA | NA | 0.5873 |
| 6. F | C3SBU4 | Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 | 6.30e-03 | NA | NA | 0.3846 |
| 6. F | O86169 | Demethylmenaquinone methyltransferase | 2.51e-04 | NA | NA | 0.4977 |
| 6. F | Q8GHA0 | Ribosomal RNA small subunit methyltransferase G | 2.51e-06 | NA | NA | 0.4784 |
| 6. F | A1SQV5 | Ribosomal RNA small subunit methyltransferase G | 2.52e-05 | NA | NA | 0.4806 |
| 6. F | B5XJV1 | Ribosomal RNA small subunit methyltransferase G | 4.25e-06 | NA | NA | 0.4683 |
| 6. F | Q8EKU4 | Ribosomal RNA small subunit methyltransferase G | 3.02e-07 | NA | NA | 0.5361 |
| 6. F | A5CY44 | Ribosomal RNA small subunit methyltransferase G | 2.59e-06 | NA | NA | 0.532 |
| 6. F | A7X7A5 | Ribosomal RNA small subunit methyltransferase G | 2.07e-06 | NA | NA | 0.4646 |
| 6. F | B1JRJ4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.76e-05 | NA | NA | 0.6069 |
| 6. F | B1IVY4 | Ribosomal RNA large subunit methyltransferase K/L | 1.78e-03 | NA | NA | 0.5873 |
| 6. F | B1KPU0 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 9.51e-06 | NA | NA | 0.4911 |
| 6. F | Q6DDT5 | Glutathione S-transferase C-terminal domain-containing protein | 1.59e-02 | NA | NA | 0.4772 |
| 6. F | Q1D096 | tRNA (guanine-N(7)-)-methyltransferase | 4.08e-04 | NA | NA | 0.548 |
| 6. F | B4TXB2 | Ribosomal RNA small subunit methyltransferase B | 1.34e-03 | NA | NA | 0.5028 |
| 6. F | P0A6U7 | Ribosomal RNA small subunit methyltransferase G | 1.29e-06 | NA | NA | 0.507 |
| 6. F | A7ZK52 | Ribosomal RNA large subunit methyltransferase K/L | 1.58e-03 | NA | NA | 0.6191 |
| 6. F | Q8A8M2 | Ribosomal RNA small subunit methyltransferase G | 8.62e-06 | NA | NA | 0.5372 |
| 6. F | Q24MA0 | Ribosomal RNA small subunit methyltransferase G | 8.28e-06 | NA | NA | 0.514 |
| 6. F | Q89A46 | tRNA (guanine-N(7)-)-methyltransferase | 7.05e-06 | NA | NA | 0.4809 |
| 6. F | Q6CYB3 | Sterol 24-C-methyltransferase | 4.39e-04 | NA | NA | 0.4301 |
| 6. F | Q3AG54 | Ribosomal RNA small subunit methyltransferase G | 6.42e-07 | NA | NA | 0.532 |
| 6. F | B7M7D4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.93e-05 | NA | NA | 0.5083 |
| 6. F | Q8EKR0 | Ribosomal RNA small subunit methyltransferase B | 2.32e-03 | NA | NA | 0.4874 |
| 6. F | Q8DPH3 | Ribosomal RNA small subunit methyltransferase G | 3.27e-06 | NA | NA | 0.4765 |
| 6. F | A0LYD2 | Ribosomal RNA small subunit methyltransferase G | 1.29e-05 | NA | NA | 0.5084 |
| 6. F | C3LWJ3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.82e-05 | NA | NA | 0.5197 |
| 6. F | Q8E3T0 | Ribosomal RNA small subunit methyltransferase G | 4.10e-06 | NA | NA | 0.4465 |
| 6. F | P94614 | Ribosomal RNA small subunit methyltransferase G | 1.79e-06 | NA | NA | 0.5695 |
| 6. F | Q2GC39 | Ribosomal RNA small subunit methyltransferase G | 1.06e-05 | NA | NA | 0.545 |
| 6. F | A4VRK4 | tRNA (guanine-N(7)-)-methyltransferase | 2.17e-05 | NA | NA | 0.4464 |
| 6. F | B2SU21 | Ribosomal RNA small subunit methyltransferase G | 3.20e-05 | NA | NA | 0.4933 |
| 6. F | A1AHS0 | Ribosomal RNA small subunit methyltransferase G | 1.07e-06 | NA | NA | 0.5118 |
| 6. F | Q8P3N0 | Ribosomal RNA small subunit methyltransferase G | 9.78e-06 | NA | NA | 0.5194 |
| 6. F | A4F7P5 | Erythromycin 3''-O-methyltransferase | 2.45e-05 | NA | NA | 0.4221 |
| 6. F | A8GCB4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.66e-05 | NA | NA | 0.6005 |
| 6. F | Q2FDF0 | Ribosomal RNA small subunit methyltransferase G | 2.21e-06 | NA | NA | 0.4674 |
| 6. F | Q2L2S3 | Ribosomal RNA small subunit methyltransferase G | 8.06e-07 | NA | NA | 0.4824 |
| 6. F | Q50203 | Ribosomal RNA small subunit methyltransferase G | 2.16e-05 | NA | NA | 0.4792 |
| 6. F | A1A998 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.53e-05 | NA | NA | 0.5092 |
| 6. F | Q97J51 | Uncharacterized RNA methyltransferase CA_C1435 | 9.14e-05 | NA | NA | 0.5957 |
| 6. F | B5FPZ6 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.91e-05 | NA | NA | 0.5935 |
| 6. F | Q663Q0 | Ribosomal RNA small subunit methyltransferase G | 1.27e-06 | NA | NA | 0.4615 |
| 6. F | Q31VY8 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5193 |
| 6. F | Q72H89 | Ribosomal RNA small subunit methyltransferase G | 3.10e-06 | NA | NA | 0.5117 |
| 6. F | B5Y8C1 | Ribosomal RNA small subunit methyltransferase H | 2.76e-03 | NA | NA | 0.4522 |
| 6. F | Q8ZYN0 | Protein-L-isoaspartate O-methyltransferase | 2.14e-05 | NA | NA | 0.457 |
| 6. F | Q8U248 | tRNA (guanine(6)-N2)-methyltransferase | 1.15e-04 | NA | NA | 0.6116 |
| 6. F | Q1CGA8 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.60e-05 | NA | NA | 0.5931 |
| 6. F | Q0SNY7 | Ribosomal RNA small subunit methyltransferase G | 1.47e-07 | NA | NA | 0.5672 |
| 6. F | A3PFL1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 8.49e-04 | NA | NA | 0.4683 |
| 6. F | B4TN41 | Ribosomal RNA small subunit methyltransferase G | 1.49e-06 | NA | NA | 0.5025 |
| 6. F | P73374 | Uncharacterized RNA methyltransferase sll1967 | 9.30e-06 | NA | NA | 0.6143 |
| 6. F | P96576 | Uncharacterized methyltransferase YdaC | 5.30e-08 | NA | NA | 0.5992 |
| 6. F | A9VMC2 | Demethylmenaquinone methyltransferase | 3.21e-04 | NA | NA | 0.542 |
| 6. F | Q1GXM0 | Ribosomal RNA small subunit methyltransferase G | 2.16e-06 | NA | NA | 0.5285 |
| 6. F | Q3JZQ7 | Ribosomal RNA small subunit methyltransferase G | 3.04e-06 | NA | NA | 0.4471 |
| 6. F | A3D7B5 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.37e-05 | NA | NA | 0.5552 |
| 6. F | B7LRQ5 | Ribosomal RNA small subunit methyltransferase B | 1.28e-03 | NA | NA | 0.5195 |
| 6. F | Q1ICL2 | Ribosomal RNA large subunit methyltransferase K/L | 3.06e-03 | NA | NA | 0.525 |
| 6. F | A9MJR0 | Ribosomal RNA small subunit methyltransferase G | 1.43e-06 | NA | NA | 0.5334 |
| 6. F | C1DTV7 | Ribosomal RNA small subunit methyltransferase H | 5.52e-07 | NA | NA | 0.4426 |
| 6. F | O54571 | Ribosomal RNA small subunit methyltransferase G | 2.91e-05 | NA | NA | 0.5704 |
| 6. F | A4XZZ7 | tRNA (guanine-N(7)-)-methyltransferase | 2.07e-05 | NA | NA | 0.4841 |
| 6. F | B9KA96 | Ribosomal RNA small subunit methyltransferase H | 1.73e-06 | NA | NA | 0.454 |
| 6. F | A5G9V1 | Ribosomal RNA small subunit methyltransferase G | 5.37e-07 | NA | NA | 0.6026 |
| 6. F | A7GZM1 | Ribosomal RNA small subunit methyltransferase G | 1.54e-06 | NA | NA | 0.5969 |
| 6. F | Q3M6A1 | Ribosomal RNA small subunit methyltransferase G | 1.33e-06 | NA | NA | 0.4853 |
| 6. F | P58032 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.27e-04 | NA | NA | 0.5163 |
| 6. F | A7ZYG2 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.11e-05 | NA | NA | 0.5142 |
| 6. F | B0TQG4 | Ribosomal RNA small subunit methyltransferase G | 2.12e-06 | NA | NA | 0.4864 |
| 6. F | Q1RE66 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.44e-05 | NA | NA | 0.5091 |
| 6. F | Q2JJQ0 | tRNA (guanine-N(7)-)-methyltransferase | 1.60e-06 | NA | NA | 0.5154 |
| 6. F | A7Z627 | Demethylmenaquinone methyltransferase | 3.21e-04 | NA | NA | 0.5203 |
| 6. F | A5I9H3 | Ribosomal RNA large subunit methyltransferase K/L | 2.79e-03 | NA | NA | 0.5985 |
| 6. F | B7IP91 | Demethylmenaquinone methyltransferase | 3.40e-04 | NA | NA | 0.5415 |
| 6. F | Q9JU19 | tRNA (guanine-N(7)-)-methyltransferase | 2.23e-04 | NA | NA | 0.5053 |
| 6. F | A6VJQ1 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 3.29e-04 | NA | NA | 0.4801 |
| 6. F | Q0I6T7 | Ribosomal RNA small subunit methyltransferase H | 1.69e-04 | NA | NA | 0.4628 |
| 6. F | O28192 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 4.33e-05 | NA | NA | 0.5353 |
| 6. F | Q8G6J4 | Ribosomal RNA small subunit methyltransferase G | 1.24e-05 | NA | NA | 0.6043 |
| 6. F | Q7VPP8 | Ribosomal RNA small subunit methyltransferase G | 2.59e-06 | NA | NA | 0.483 |
| 6. F | B0V4Z1 | Ribosomal RNA small subunit methyltransferase C | 2.75e-05 | NA | NA | 0.636 |
| 6. F | A0LWW8 | Ribosomal RNA small subunit methyltransferase G | 4.94e-06 | NA | NA | 0.5318 |
| 6. F | Q55214 | Aklanonic acid methyltransferase DauC | 1.39e-05 | NA | NA | 0.4871 |
| 6. F | A6T742 | Ribosomal RNA large subunit methyltransferase K/L | 1.84e-03 | NA | NA | 0.5933 |
| 6. F | Q7UBD3 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.5025 |
| 6. F | P59718 | tRNA (guanine-N(7)-)-methyltransferase | 3.35e-05 | NA | NA | 0.4756 |
| 6. F | Q0ATU7 | Ribosomal RNA small subunit methyltransferase G | 2.57e-06 | NA | NA | 0.5796 |
| 6. F | Q0S679 | tRNA (guanine-N(7)-)-methyltransferase | 3.52e-05 | NA | NA | 0.4787 |
| 6. F | Q73TS5 | tRNA (guanine-N(7)-)-methyltransferase | 2.50e-04 | NA | NA | 0.5464 |
| 6. F | Q4K4C6 | tRNA (guanine-N(7)-)-methyltransferase | 2.10e-05 | NA | NA | 0.485 |
| 6. F | B0K8H7 | Ribosomal RNA small subunit methyltransferase G | 5.18e-06 | NA | NA | 0.5186 |
| 6. F | Q63PG9 | Ribosomal RNA small subunit methyltransferase G | 2.78e-06 | NA | NA | 0.4204 |
| 6. F | A9GCQ1 | Ribosomal RNA small subunit methyltransferase G | 3.12e-06 | NA | NA | 0.5229 |
| 6. F | A4TBF6 | Ribosomal RNA small subunit methyltransferase H | 2.73e-06 | NA | NA | 0.4285 |
| 6. F | B7N2H9 | Ribosomal RNA small subunit methyltransferase G | 1.29e-06 | NA | NA | 0.5115 |
| 6. F | Q0W2W0 | Protein-L-isoaspartate O-methyltransferase | 5.72e-07 | NA | NA | 0.517 |
| 6. F | Q9JXI7 | Ubiquinone biosynthesis O-methyltransferase | 5.24e-06 | NA | NA | 0.4892 |
| 6. F | Q4JY06 | tRNA (guanine-N(7)-)-methyltransferase | 2.91e-05 | NA | NA | 0.4636 |
| 6. F | B1LYT9 | Ribosomal RNA small subunit methyltransferase H | 8.48e-04 | NA | NA | 0.4155 |
| 6. F | Q3Z3S5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.30e-05 | NA | NA | 0.515 |
| 6. F | Q0VKW4 | Ribosomal RNA small subunit methyltransferase G | 1.20e-06 | NA | NA | 0.5409 |
| 6. F | Q63DL9 | Demethylmenaquinone methyltransferase | 3.26e-04 | NA | NA | 0.5418 |
| 6. F | A4VTE0 | Ribosomal RNA small subunit methyltransferase G | 3.63e-06 | NA | NA | 0.473 |
| 6. F | C3SBS8 | (S)-tetrahydroprotoberberine N-methyltransferase | 3.55e-03 | NA | NA | 0.4207 |
| 6. F | Q9PPL4 | Ribosomal RNA small subunit methyltransferase H | 1.26e-06 | NA | NA | 0.43 |
| 6. F | Q8DH87 | Ribosomal RNA small subunit methyltransferase H | 1.20e-04 | NA | NA | 0.4459 |
| 6. F | Q29LT4 | Glutathione S-transferase C-terminal domain-containing protein homolog | 2.16e-02 | NA | NA | 0.3695 |
| 6. F | Q897E6 | tRNA (guanine-N(7)-)-methyltransferase | 3.31e-05 | NA | NA | 0.5854 |
| 6. F | Q9K623 | Malonyl-[acyl-carrier protein] O-methyltransferase | 3.60e-05 | NA | NA | 0.4378 |
| 6. F | A1JM74 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.95e-05 | NA | NA | 0.6182 |
| 6. F | Q03DH7 | Ribosomal RNA small subunit methyltransferase G | 3.60e-06 | NA | NA | 0.5141 |
| 6. F | P0A6U6 | Ribosomal RNA small subunit methyltransferase G | 1.29e-06 | NA | NA | 0.5058 |
| 6. F | Q8RI89 | Ribosomal RNA small subunit methyltransferase G | 2.25e-06 | NA | NA | 0.4992 |
| 6. F | Q6KHE8 | tRNA (guanine-N(7)-)-methyltransferase | 1.45e-05 | NA | NA | 0.5327 |
| 6. F | B5YXE4 | Ribosomal RNA small subunit methyltransferase G | 1.12e-06 | NA | NA | 0.5056 |
| 6. F | Q9X027 | tRNA (guanine-N(7)-)-methyltransferase | 3.34e-06 | NA | NA | 0.5298 |
| 6. F | Q5WSS3 | Ribosomal RNA small subunit methyltransferase G | 5.22e-06 | NA | NA | 0.5358 |
| 6. F | C4ZUE3 | Ribosomal RNA small subunit methyltransferase B | 1.27e-03 | NA | NA | 0.4848 |
| 6. F | A6WCY2 | Ribosomal RNA small subunit methyltransferase H | 1.24e-03 | NA | NA | 0.4496 |
| 6. F | Q8CWG0 | Demethylmenaquinone methyltransferase | 5.30e-06 | NA | NA | 0.5418 |
| 6. F | P62477 | Ribosomal RNA small subunit methyltransferase H | 9.14e-05 | NA | NA | 0.4697 |
| 6. F | Q89B29 | Ribosomal RNA small subunit methyltransferase D | 7.49e-09 | NA | NA | 0.6048 |
| 6. F | P75466 | Ribosomal RNA small subunit methyltransferase H | 1.46e-03 | NA | NA | 0.4151 |
| 6. F | Q0IDB0 | tRNA (guanine-N(7)-)-methyltransferase | 5.25e-06 | NA | NA | 0.4639 |
| 6. F | Q8D4B4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.96e-05 | NA | NA | 0.6413 |
| 6. F | Q1J8D8 | Ribosomal RNA small subunit methyltransferase G | 4.40e-06 | NA | NA | 0.4835 |
| 6. F | A9WGI4 | Ribosomal RNA small subunit methyltransferase G | 1.80e-06 | NA | NA | 0.4882 |
| 6. F | A0JV86 | Ribosomal RNA small subunit methyltransferase H | 2.51e-03 | NA | NA | 0.4205 |
| 6. F | B2VK95 | Ribosomal RNA small subunit methyltransferase B | 1.49e-03 | NA | NA | 0.4714 |
| 6. F | Q1IGD2 | tRNA (guanine-N(7)-)-methyltransferase | 2.17e-05 | NA | NA | 0.4694 |
| 6. F | Q57J62 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4835 |
| 6. F | Q664V2 | Ribosomal RNA small subunit methyltransferase B | 8.05e-04 | NA | NA | 0.5045 |
| 6. F | Q4A9M3 | tRNA (guanine-N(7)-)-methyltransferase | 3.92e-05 | NA | NA | 0.5074 |
| 6. F | C1ER75 | Ribosomal RNA small subunit methyltransferase G | 3.22e-06 | NA | NA | 0.4654 |
| 6. F | A9KBS7 | Ribosomal RNA small subunit methyltransferase G | 2.16e-06 | NA | NA | 0.5502 |
| 6. F | C3LMI5 | Ribosomal RNA small subunit methyltransferase F | 2.32e-03 | NA | NA | 0.5188 |
| 6. F | B2GJQ6 | Ribosomal RNA small subunit methyltransferase H | 4.20e-03 | NA | NA | 0.4421 |
| 6. F | Q9HJL8 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 8.34e-05 | NA | NA | 0.5401 |
| 6. F | A4SCT8 | Ribosomal RNA small subunit methyltransferase G | 4.00e-06 | NA | NA | 0.5517 |
| 6. F | Q8G4R0 | Ribosomal RNA small subunit methyltransferase H | 1.14e-03 | NA | NA | 0.433 |
| 6. F | A0K2M2 | Ribosomal RNA small subunit methyltransferase G | 6.22e-06 | NA | NA | 0.5502 |
| 6. F | B5FN43 | Ribosomal RNA small subunit methyltransferase G | 1.50e-06 | NA | NA | 0.5031 |
| 6. F | B0VCZ6 | Ribosomal RNA small subunit methyltransferase G | 1.97e-06 | NA | NA | 0.5052 |
| 6. F | Q6F9W7 | Ribosomal RNA small subunit methyltransferase G | 2.03e-06 | NA | NA | 0.4962 |
| 6. F | A6GWQ2 | Ribosomal RNA small subunit methyltransferase G | 1.48e-05 | NA | NA | 0.5076 |
| 6. F | B8DBZ5 | Demethylmenaquinone methyltransferase | 2.10e-04 | NA | NA | 0.4852 |
| 6. F | A8GLL1 | Ribosomal RNA small subunit methyltransferase G | 1.30e-06 | NA | NA | 0.4631 |
| 6. F | Q05632 | Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 7.36e-10 | NA | NA | 0.6164 |
| 6. F | A9NFP3 | Ribosomal RNA small subunit methyltransferase H 1 | 4.13e-06 | NA | NA | 0.4502 |
| 6. F | A2S6K9 | Ribosomal RNA small subunit methyltransferase G | 1.56e-06 | NA | NA | 0.4279 |
| 6. F | D3UZL8 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.06e-05 | NA | NA | 0.6101 |
| 6. F | A1RQC0 | Ribosomal RNA small subunit methyltransferase G | 2.09e-06 | NA | NA | 0.495 |
| 6. F | Q0SAH7 | Ribosomal RNA small subunit methyltransferase G | 2.79e-05 | NA | NA | 0.583 |
| 6. F | Q9KVU5 | Ribosomal RNA small subunit methyltransferase B | 1.40e-03 | NA | NA | 0.5943 |
| 6. F | O93995 | Ubiquinone biosynthesis O-methyltransferase, mitochondrial | 1.01e-03 | NA | NA | 0.3892 |
| 6. F | Q2NQQ2 | Ribosomal RNA small subunit methyltransferase B | 1.17e-03 | NA | NA | 0.6161 |
| 6. F | Q117P8 | tRNA (guanine-N(7)-)-methyltransferase | 1.51e-06 | NA | NA | 0.4425 |
| 6. F | P0CW09 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 6.05e-05 | NA | NA | 0.4941 |
| 6. F | B1L800 | Ribosomal RNA small subunit methyltransferase G | 3.95e-06 | NA | NA | 0.5116 |
| 6. F | P53363 | Ribosomal RNA small subunit methyltransferase G | 9.94e-08 | NA | NA | 0.5732 |
| 6. F | Q7MFU0 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.58e-05 | NA | NA | 0.5316 |
| 6. F | B0VRJ4 | Ribosomal RNA small subunit methyltransferase C | 3.21e-05 | NA | NA | 0.6365 |
| 6. F | A7NPB9 | Ribosomal RNA small subunit methyltransferase G | 1.74e-06 | NA | NA | 0.5153 |
| 6. F | C1D0A7 | Ribosomal RNA small subunit methyltransferase G | 1.88e-05 | NA | NA | 0.4993 |
| 6. F | Q11VU7 | Ribosomal RNA small subunit methyltransferase G | 1.39e-05 | NA | NA | 0.568 |
| 6. F | B5YFF7 | Ribosomal RNA small subunit methyltransferase G | 1.18e-06 | NA | NA | 0.5307 |
| 6. F | Q8EBQ3 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.50e-05 | NA | NA | 0.476 |
| 6. F | Q6F0F5 | Ribosomal RNA small subunit methyltransferase G | 1.87e-06 | NA | NA | 0.5144 |
| 6. F | A0AK43 | Demethylmenaquinone methyltransferase | 2.27e-04 | NA | NA | 0.5113 |
| 6. F | A0R7J5 | Ribosomal RNA small subunit methyltransferase G | 3.38e-05 | NA | NA | 0.569 |
| 6. F | A0PX66 | Ribosomal RNA small subunit methyltransferase G | 1.77e-04 | NA | NA | 0.4537 |
| 6. F | Q1JII3 | Ribosomal RNA small subunit methyltransferase G | 4.41e-06 | NA | NA | 0.4946 |
| 6. F | Q5YYY7 | Ribosomal RNA small subunit methyltransferase H | 1.16e-03 | NA | NA | 0.4277 |
| 6. F | Q47U39 | Ribosomal RNA small subunit methyltransferase G | 1.24e-06 | NA | NA | 0.4689 |
| 6. F | A5II63 | Ribosomal RNA small subunit methyltransferase G | 4.86e-06 | NA | NA | 0.5843 |
| 6. F | A5VHQ2 | Ribosomal RNA small subunit methyltransferase G | 8.94e-08 | NA | NA | 0.5211 |
| 6. F | Q7NBG2 | tRNA (guanine-N(7)-)-methyltransferase | 2.75e-04 | NA | NA | 0.5345 |
| 6. F | A3D5D5 | Ribosomal RNA small subunit methyltransferase F | 4.42e-03 | NA | NA | 0.4637 |
| 6. F | A6WUK0 | Ribosomal RNA small subunit methyltransferase G | 1.97e-06 | NA | NA | 0.5036 |
| 6. F | Q323P2 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.27e-05 | NA | NA | 0.5085 |
| 6. F | C6A3F2 | Protein-L-isoaspartate O-methyltransferase | 1.99e-05 | NA | NA | 0.4399 |
| 6. F | B0K8J9 | Ribosomal RNA small subunit methyltransferase H | 5.01e-06 | NA | NA | 0.4379 |
| 6. F | B0K3H8 | Ribosomal RNA small subunit methyltransferase H | 5.80e-06 | NA | NA | 0.4494 |
| 6. F | Q9ZLD4 | Ribosomal RNA small subunit methyltransferase H | 2.21e-03 | NA | NA | 0.4119 |
| 6. F | D7UQ43 | O-methyltransferase sol2 | 2.48e-03 | NA | NA | 0.4411 |
| 6. F | B2V1U8 | Ribosomal RNA small subunit methyltransferase G | 1.72e-06 | NA | NA | 0.5187 |
| 6. F | Q39ZT2 | Ribosomal RNA small subunit methyltransferase G | 3.95e-07 | NA | NA | 0.5468 |
| 6. F | Q03MB7 | Ribosomal RNA small subunit methyltransferase G | 3.55e-06 | NA | NA | 0.4701 |
| 6. F | Q3SWQ3 | tRNA (guanine-N(7)-)-methyltransferase | 4.56e-05 | NA | NA | 0.4505 |
| 6. F | Q8ZQJ5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.13e-05 | NA | NA | 0.6041 |
| 6. F | A4W8M4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 1.52e-05 | NA | NA | 0.5237 |
| 6. F | C5C6N4 | Ribosomal RNA small subunit methyltransferase G | 5.67e-07 | NA | NA | 0.6298 |
| 6. F | A2RGB9 | Ribosomal RNA small subunit methyltransferase G | 5.49e-06 | NA | NA | 0.4662 |
| 6. F | Q8A005 | Demethylmenaquinone methyltransferase | 1.39e-05 | NA | NA | 0.4956 |
| 6. F | Q9PEV0 | Ribosomal RNA small subunit methyltransferase B | 1.64e-03 | NA | NA | 0.6123 |
| 6. F | C0PXN9 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.67e-05 | NA | NA | 0.5937 |
| 6. F | A1U8R4 | Ribosomal RNA small subunit methyltransferase G | 2.24e-05 | NA | NA | 0.5791 |
| 6. F | A0KU76 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 9.72e-06 | NA | NA | 0.4648 |
| 6. F | C1FP29 | Ribosomal RNA small subunit methyltransferase G | 1.81e-06 | NA | NA | 0.5015 |
| 6. F | B0BRY0 | Ribosomal RNA small subunit methyltransferase G | 2.44e-06 | NA | NA | 0.4962 |
| 6. F | Q8Z9R9 | Ribosomal RNA small subunit methyltransferase G | 1.53e-06 | NA | NA | 0.4607 |
| 6. F | B0JKS7 | Ribosomal RNA small subunit methyltransferase H | 2.70e-06 | NA | NA | 0.4311 |
| 6. F | A7FK27 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.35e-05 | NA | NA | 0.506 |
| 6. F | A0B6X7 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 6.50e-05 | NA | NA | 0.5496 |
| 6. F | P0CS08 | tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61 | 2.52e-04 | NA | NA | 0.5863 |
| 6. F | B1HXA1 | tRNA (guanine-N(7)-)-methyltransferase | 2.51e-05 | NA | NA | 0.539 |
| 6. F | B2K506 | Ribosomal RNA small subunit methyltransferase B | 1.25e-03 | NA | NA | 0.4792 |
| 6. F | Q0HL77 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.00e-05 | NA | NA | 0.4721 |
| 6. F | B6I8H9 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.03e-05 | NA | NA | 0.5088 |
| 6. F | B2VCB2 | Ribosomal RNA small subunit methyltransferase G | 1.42e-06 | NA | NA | 0.5022 |
| 6. F | A0RLR0 | Ribosomal RNA small subunit methyltransferase G | 2.99e-06 | NA | NA | 0.4738 |
| 6. F | Q8E8B0 | Ribosomal RNA small subunit methyltransferase G | 2.06e-06 | NA | NA | 0.4985 |
| 6. F | Q8Z1X1 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4834 |
| 6. F | Q6G5W6 | Ribosomal RNA small subunit methyltransferase G | 2.12e-06 | NA | NA | 0.4795 |
| 6. F | Q4L2Z4 | Ribosomal RNA small subunit methyltransferase G | 3.10e-06 | NA | NA | 0.5374 |
| 6. F | Q9PRA5 | Ribosomal RNA small subunit methyltransferase G | 5.14e-07 | NA | NA | 0.5847 |
| 6. F | A3M4Y3 | Ribosomal RNA small subunit methyltransferase G | 1.87e-06 | NA | NA | 0.543 |
| 6. F | Q9KNG5 | Ribosomal RNA small subunit methyltransferase G | 1.73e-06 | NA | NA | 0.4553 |
| 6. F | B9E8Z2 | Ribosomal RNA small subunit methyltransferase G | 2.36e-06 | NA | NA | 0.4618 |
| 6. F | Q8NUF9 | Ribosomal RNA small subunit methyltransferase G | 2.13e-06 | NA | NA | 0.4672 |
| 6. F | A7FNK4 | Ribosomal RNA small subunit methyltransferase B | 1.39e-03 | NA | NA | 0.4819 |
| 6. F | B1W0I2 | Ribosomal RNA small subunit methyltransferase H | 2.16e-04 | NA | NA | 0.4398 |
| 6. F | Q6D8J7 | tRNA (guanine-N(7)-)-methyltransferase | 1.43e-04 | NA | NA | 0.4774 |
| 6. F | A1BGS9 | tRNA (guanine-N(7)-)-methyltransferase | 2.69e-06 | NA | NA | 0.5365 |
| 6. F | Q6MGL7 | Ribosomal RNA small subunit methyltransferase G 3 | 8.41e-06 | NA | NA | 0.5035 |
| 6. F | B5RQZ6 | Ribosomal RNA small subunit methyltransferase G | 4.93e-07 | NA | NA | 0.5785 |
| 6. F | Q899S0 | Ribosomal RNA small subunit methyltransferase G | 1.61e-06 | NA | NA | 0.4833 |
| 6. F | A0A1C9U5X7 | N-methyltransferase 4 | 8.69e-04 | NA | NA | 0.4074 |
| 6. F | Q8R9F9 | Ribosomal RNA small subunit methyltransferase H | 1.91e-04 | NA | NA | 0.432 |
| 6. F | Q6FE96 | Ribosomal RNA small subunit methyltransferase C | 2.51e-05 | NA | NA | 0.6313 |
| 6. F | Q9F8T9 | C-methyltransferase CouO | 8.69e-06 | NA | NA | 0.5243 |
| 6. F | Q39R75 | tRNA (guanine-N(7)-)-methyltransferase | 3.98e-07 | NA | NA | 0.5471 |
| 6. F | Q8FSV1 | Ribosomal RNA small subunit methyltransferase G | 3.96e-05 | NA | NA | 0.5082 |
| 6. F | A1AGI0 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5194 |
| 6. F | A9N824 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.59e-05 | NA | NA | 0.5903 |
| 6. F | A4T4S9 | Ribosomal RNA small subunit methyltransferase G | 2.80e-05 | NA | NA | 0.5947 |
| 6. F | B1HPM1 | Ribosomal RNA small subunit methyltransferase G | 3.26e-07 | NA | NA | 0.513 |
| 6. F | B5XY56 | Ribosomal RNA large subunit methyltransferase K/L | 1.80e-03 | NA | NA | 0.5881 |
| 6. F | A3QJS0 | Ribosomal RNA small subunit methyltransferase G | 2.09e-06 | NA | NA | 0.5395 |
| 6. F | B0C384 | Ribosomal RNA small subunit methyltransferase G | 2.37e-06 | NA | NA | 0.4649 |
| 6. F | B1VAK6 | Ribosomal RNA small subunit methyltransferase G | 3.38e-05 | NA | NA | 0.5625 |
| 6. F | B7LHZ0 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5193 |
| 6. F | A1SBV0 | Ribosomal RNA small subunit methyltransferase G | 1.87e-06 | NA | NA | 0.5225 |
| 6. F | Q74FT5 | tRNA (guanine-N(7)-)-methyltransferase | 4.42e-07 | NA | NA | 0.5627 |
| 6. F | O66479 | tRNA (guanine-N(7)-)-methyltransferase | 1.07e-06 | NA | NA | 0.5452 |
| 6. F | C5BF32 | Ribosomal RNA small subunit methyltransferase G | 1.51e-06 | NA | NA | 0.4684 |
| 6. F | B9KD58 | Ribosomal RNA small subunit methyltransferase H | 6.19e-04 | NA | NA | 0.475 |
| 6. F | A8HAH3 | Ribosomal RNA small subunit methyltransferase G | 2.08e-06 | NA | NA | 0.4898 |
| 6. F | C6DFR7 | Ribosomal RNA small subunit methyltransferase B | 1.12e-03 | NA | NA | 0.4593 |
| 6. F | S0DQQ0 | O-methyltransferase fsr2 | 8.30e-04 | NA | NA | 0.4271 |
| 6. F | Q2LY85 | Ribosomal RNA small subunit methyltransferase G | 4.44e-06 | NA | NA | 0.5276 |
| 6. F | A6L982 | Ribosomal RNA small subunit methyltransferase G | 2.81e-07 | NA | NA | 0.5154 |
| 6. F | A8F3S3 | Ribosomal RNA small subunit methyltransferase G | 1.57e-05 | NA | NA | 0.4939 |
| 6. F | A1QYX2 | Ribosomal RNA small subunit methyltransferase G | 8.77e-07 | NA | NA | 0.5854 |
| 6. F | B7L890 | Ribosomal RNA small subunit methyltransferase G | 1.36e-06 | NA | NA | 0.5082 |
| 6. F | A3P103 | Ribosomal RNA small subunit methyltransferase G | 3.85e-06 | NA | NA | 0.4193 |
| 6. F | Q1B0S6 | Ribosomal RNA small subunit methyltransferase G | 2.29e-05 | NA | NA | 0.589 |
| 6. F | C4L001 | Ribosomal RNA small subunit methyltransferase G | 3.64e-06 | NA | NA | 0.5036 |
| 6. F | Q2NQ94 | Ribosomal RNA small subunit methyltransferase G | 1.57e-06 | NA | NA | 0.4777 |
| 6. F | B1X800 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.36e-05 | NA | NA | 0.5906 |
| 6. F | B7M596 | Ribosomal RNA small subunit methyltransferase G | 1.32e-06 | NA | NA | 0.5139 |
| 6. F | B4SYE1 | Ribosomal RNA small subunit methyltransferase G | 1.43e-06 | NA | NA | 0.5035 |
| 6. F | A8EUF3 | Ribosomal RNA small subunit methyltransferase H | 3.57e-04 | NA | NA | 0.4527 |
| 6. F | Q6NE98 | Ribosomal RNA small subunit methyltransferase G | 1.77e-05 | NA | NA | 0.5437 |
| 6. F | A0QF44 | Ribosomal RNA small subunit methyltransferase H | 5.73e-03 | NA | NA | 0.462 |
| 6. F | Q662I7 | Ribosomal RNA small subunit methyltransferase G | 1.29e-07 | NA | NA | 0.5713 |
| 6. F | Q9X0H9 | Uncharacterized RNA methyltransferase TM_1094 | 7.24e-06 | NA | NA | 0.5847 |
| 6. F | A0RNH4 | Ribosomal RNA small subunit methyltransferase H | 1.54e-06 | NA | NA | 0.4389 |
| 6. F | B7UMV1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.43e-05 | NA | NA | 0.5097 |
| 6. F | Q9A1D7 | Ribosomal RNA small subunit methyltransferase G | 4.20e-06 | NA | NA | 0.4606 |
| 6. F | P44728 | Ribosomal RNA small subunit methyltransferase G | 3.12e-06 | NA | NA | 0.5004 |
| 6. F | Q64XV8 | Demethylmenaquinone methyltransferase | 9.94e-06 | NA | NA | 0.4981 |
| 6. F | Q2YZC0 | Ribosomal RNA small subunit methyltransferase G | 2.15e-06 | NA | NA | 0.4804 |
| 6. F | Q3M3Q5 | tRNA (guanine-N(7)-)-methyltransferase | 1.39e-06 | NA | NA | 0.5617 |
| 6. F | Q48JX8 | Ribosomal RNA large subunit methyltransferase K/L | 3.42e-03 | NA | NA | 0.5049 |
| 6. F | Q4V7T1 | Methyltransferase-like 26 | 5.01e-09 | NA | NA | 0.5866 |
| 6. F | B7UMK5 | Ribosomal RNA small subunit methyltransferase G | 1.33e-06 | NA | NA | 0.5059 |
| 6. F | A5UA03 | Ribosomal RNA small subunit methyltransferase G | 3.29e-06 | NA | NA | 0.4928 |
| 6. F | Q12HP1 | Ribosomal RNA small subunit methyltransferase G | 1.75e-06 | NA | NA | 0.4717 |
| 6. F | A8Z655 | Ribosomal RNA small subunit methyltransferase G | 1.00e-05 | NA | NA | 0.4787 |
| 6. F | A7MF48 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.61e-05 | NA | NA | 0.6126 |
| 6. F | Q7NMQ7 | Ribosomal RNA small subunit methyltransferase G | 3.56e-06 | NA | NA | 0.4946 |
| 6. F | Q04W54 | tRNA (guanine-N(7)-)-methyltransferase | 7.50e-06 | NA | NA | 0.563 |
| 6. F | P60399 | Ribosomal RNA small subunit methyltransferase H | 1.85e-04 | NA | NA | 0.4266 |
| 6. F | Q54818 | Aklanonic acid methyltransferase DnrC | 2.83e-03 | NA | NA | 0.3973 |
| 6. F | Q2NXD0 | Ribosomal RNA small subunit methyltransferase G | 1.33e-05 | NA | NA | 0.4995 |
| 6. F | Q5LH04 | Demethylmenaquinone methyltransferase | 9.76e-06 | NA | NA | 0.483 |
| 6. F | Q1CTC3 | tRNA (guanine-N(7)-)-methyltransferase | 1.81e-04 | NA | NA | 0.6227 |
| 6. F | Q6HL42 | Demethylmenaquinone methyltransferase | 3.27e-04 | NA | NA | 0.539 |
| 6. F | A8GKG7 | Ribosomal RNA small subunit methyltransferase B | 1.03e-03 | NA | NA | 0.4764 |
| 6. F | C1KWN1 | Demethylmenaquinone methyltransferase | 2.48e-04 | NA | NA | 0.4852 |
| 6. F | A8LNK7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.80e-03 | NA | NA | 0.4465 |
| 6. F | B3H2Q1 | Ribosomal RNA small subunit methyltransferase G | 2.44e-06 | NA | NA | 0.4999 |
| 6. F | B7JGZ8 | Demethylmenaquinone methyltransferase | 3.28e-04 | NA | NA | 0.5417 |
| 6. F | C3LSJ9 | Ribosomal RNA small subunit methyltransferase G | 1.99e-06 | NA | NA | 0.4419 |
| 6. F | B8G1D7 | tRNA (guanine-N(7)-)-methyltransferase | 1.77e-05 | NA | NA | 0.5212 |
| 6. F | B4SUR0 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4791 |
| 6. F | Q81SW0 | Demethylmenaquinone methyltransferase | 3.26e-04 | NA | NA | 0.5248 |
| 6. F | I1RJD6 | Sphingolipid C9-methyltransferase 1 | 7.96e-03 | NA | NA | 0.3498 |
| 6. F | O05979 | Uncharacterized protein RP789 | 3.48e-02 | NA | NA | 0.5666 |
| 6. F | Q0I5W5 | Ribosomal RNA small subunit methyltransferase G | 3.75e-06 | NA | NA | 0.4954 |
| 6. F | Q04Y87 | Ribosomal RNA small subunit methyltransferase H | 4.73e-04 | NA | NA | 0.4622 |
| 6. F | Q6YQV6 | Ribosomal RNA small subunit methyltransferase G | 4.67e-05 | NA | NA | 0.5768 |
| 6. F | Q6ABV7 | Ribosomal RNA small subunit methyltransferase G | 2.98e-06 | NA | NA | 0.5485 |
| 6. F | Q2RFJ0 | Ribosomal RNA small subunit methyltransferase G | 2.69e-06 | NA | NA | 0.5406 |
| 6. F | C3MPR8 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.22e-04 | NA | NA | 0.5275 |
| 6. F | Q3A209 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.59e-05 | NA | NA | 0.5096 |
| 6. F | A4WF97 | Ribosomal RNA small subunit methyltransferase B | 1.36e-03 | NA | NA | 0.5225 |
| 6. F | Q17XC0 | Ribosomal RNA small subunit methyltransferase H | 2.04e-03 | NA | NA | 0.4344 |
| 6. F | C6DYR8 | Ribosomal RNA small subunit methyltransferase G | 1.20e-06 | NA | NA | 0.4737 |
| 6. F | Q8XH32 | Ribosomal RNA small subunit methyltransferase G | 1.58e-06 | NA | NA | 0.5125 |
| 6. F | Q1CTG3 | Ribosomal RNA small subunit methyltransferase H | 2.55e-03 | NA | NA | 0.4252 |
| 6. F | A3NF53 | Ribosomal RNA small subunit methyltransferase G | 3.48e-06 | NA | NA | 0.4293 |
| 6. F | B7M0Z4 | Ribosomal RNA small subunit methyltransferase B | 1.29e-03 | NA | NA | 0.5026 |
| 6. F | Q73HZ4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.84e-04 | NA | NA | 0.4592 |
| 6. F | A1T0Z9 | Ribosomal RNA small subunit methyltransferase G | 1.56e-06 | NA | NA | 0.5106 |
| 6. F | Q0AJ68 | tRNA (guanine-N(7)-)-methyltransferase | 1.27e-04 | NA | NA | 0.503 |
| 6. F | C3L8S6 | Demethylmenaquinone methyltransferase | 3.31e-04 | NA | NA | 0.5389 |
| 6. F | B2HZC3 | Ribosomal RNA small subunit methyltransferase G | 1.78e-06 | NA | NA | 0.5433 |
| 6. F | A4Y952 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.28e-05 | NA | NA | 0.5499 |
| 6. F | A9MIM3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.13e-05 | NA | NA | 0.5859 |
| 6. F | A5IWD5 | Ribosomal RNA small subunit methyltransferase G | 2.20e-06 | NA | NA | 0.5214 |
| 6. F | B1LN12 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 6.00e-05 | NA | NA | 0.5311 |
| 6. F | Q5PIT6 | Ribosomal RNA small subunit methyltransferase B | 1.34e-03 | NA | NA | 0.4708 |
| 6. F | P9WGW8 | Ribosomal RNA small subunit methyltransferase G | 2.87e-05 | NA | NA | 0.5811 |
| 6. F | P0DF44 | Ribosomal RNA small subunit methyltransferase G | 4.12e-06 | NA | NA | 0.533 |
| 6. F | A1AVB2 | Ribosomal RNA small subunit methyltransferase G | 2.22e-06 | NA | NA | 0.5142 |
| 6. F | A4ITW9 | Ribosomal RNA small subunit methyltransferase G | 1.90e-07 | NA | NA | 0.4702 |
| 6. F | A5F0U5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.05e-06 | NA | NA | 0.6104 |
| 6. F | Q1R644 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5086 |
| 6. F | B1LL67 | Ribosomal RNA small subunit methyltransferase G | 1.34e-06 | NA | NA | 0.5094 |
| 6. F | Q6LZM7 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 3.31e-04 | NA | NA | 0.4815 |
| 6. F | Q1GC56 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 4.38e-04 | NA | NA | 0.4849 |
| 6. F | Q32HV8 | Ribosomal RNA large subunit methyltransferase K/L | 1.63e-03 | NA | NA | 0.6229 |
| 6. F | A8FLC2 | Ribosomal RNA small subunit methyltransferase H | 1.09e-06 | NA | NA | 0.4427 |
| 6. F | Q5E1M7 | Ribosomal RNA small subunit methyltransferase G | 3.15e-06 | NA | NA | 0.433 |
| 6. F | Q814F8 | Ribosomal RNA small subunit methyltransferase G | 3.06e-06 | NA | NA | 0.4719 |
| 6. F | A1BAN1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.76e-04 | NA | NA | 0.3916 |
| 6. F | C0ZA63 | Ribosomal RNA small subunit methyltransferase G | 3.74e-06 | NA | NA | 0.456 |
| 6. F | B7LK85 | Ribosomal RNA small subunit methyltransferase G | 1.38e-06 | NA | NA | 0.51 |
| 6. F | Q0ACP5 | tRNA (guanine-N(7)-)-methyltransferase | 1.83e-05 | NA | NA | 0.5161 |
| 6. F | B5XNC2 | Ribosomal RNA small subunit methyltransferase B | 1.34e-03 | NA | NA | 0.4988 |
| 6. F | B7UK12 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | Q98R44 | tRNA (guanine-N(7)-)-methyltransferase | 1.57e-05 | NA | NA | 0.5383 |
| 6. F | B8E968 | Ribosomal RNA small subunit methyltransferase F | 6.37e-03 | NA | NA | 0.4663 |
| 6. F | Q82AE4 | Ribosomal RNA small subunit methyltransferase H | 1.28e-06 | NA | NA | 0.4499 |
| 6. F | A9LZQ8 | tRNA (guanine-N(7)-)-methyltransferase | 2.30e-04 | NA | NA | 0.5208 |
| 6. F | Q0HXI0 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.08e-05 | NA | NA | 0.4758 |
| 6. F | Q93D95 | Ribosomal RNA small subunit methyltransferase G | 3.26e-06 | NA | NA | 0.4711 |
| 6. F | B1X8Q2 | Ribosomal RNA large subunit methyltransferase K/L | 1.88e-03 | NA | NA | 0.5908 |
| 6. F | O27962 | Protein-L-isoaspartate O-methyltransferase 2 | 1.08e-05 | NA | NA | 0.4246 |
| 6. F | Q9KRY1 | Ribosomal RNA small subunit methyltransferase F | 2.47e-03 | NA | NA | 0.5829 |
| 6. F | Q83RJ3 | Putative ribosomal RNA small subunit methyltransferase F | 4.84e-03 | NA | NA | 0.5057 |
| 6. F | B0UWH2 | Ribosomal RNA small subunit methyltransferase G | 3.58e-06 | NA | NA | 0.4874 |
| 6. F | Q8R6L0 | Ribosomal RNA small subunit methyltransferase G | 5.35e-06 | NA | NA | 0.5087 |
| 6. F | Q979P2 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 7.65e-04 | NA | NA | 0.5324 |
| 6. F | B2RZN8 | Ribosomal RNA small subunit methyltransferase G | 4.79e-07 | NA | NA | 0.5708 |
| 6. F | C3SBU5 | (S)-tetrahydroprotoberberine N-methyltransferase 1 | 3.88e-03 | NA | NA | 0.3876 |
| 6. F | Q04HG5 | Ribosomal RNA small subunit methyltransferase G | 4.46e-06 | NA | NA | 0.5103 |
| 6. F | A9R925 | Ribosomal RNA small subunit methyltransferase B | 8.22e-04 | NA | NA | 0.497 |
| 6. F | Q2VYQ1 | tRNA (guanine-N(7)-)-methyltransferase | 3.01e-05 | NA | NA | 0.4881 |
| 6. F | B7K639 | Ribosomal RNA small subunit methyltransferase H | 5.81e-03 | NA | NA | 0.4305 |
| 6. F | Q7N612 | Ribosomal RNA large subunit methyltransferase K/L | 1.92e-03 | NA | NA | 0.5358 |
| 6. F | B0K5N2 | Ribosomal RNA small subunit methyltransferase G | 3.39e-06 | NA | NA | 0.4838 |
| 6. F | Q8ZLM5 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.4598 |
| 6. F | A8A6K3 | Ribosomal RNA small subunit methyltransferase G | 1.35e-06 | NA | NA | 0.5014 |
| 6. F | Q02YJ6 | Ribosomal RNA small subunit methyltransferase G | 3.14e-06 | NA | NA | 0.5365 |
| 6. F | Q39PR1 | Ribosomal RNA small subunit methyltransferase G | 1.36e-06 | NA | NA | 0.5267 |
| 6. F | A8AFL6 | Ribosomal RNA small subunit methyltransferase F | 4.97e-03 | NA | NA | 0.4734 |
| 6. F | B3DP27 | Ribosomal RNA small subunit methyltransferase G | 1.16e-05 | NA | NA | 0.6047 |
| 6. F | B2J183 | Ribosomal RNA small subunit methyltransferase H | 4.30e-03 | NA | NA | 0.4052 |
| 6. F | B0KN57 | tRNA (guanine-N(7)-)-methyltransferase | 2.04e-05 | NA | NA | 0.4853 |
| 6. F | B9KAS1 | Ribosomal RNA small subunit methyltransferase G | 1.76e-07 | NA | NA | 0.4713 |
| 6. F | Q72I77 | tRNA (guanine-N(7)-)-methyltransferase | 1.92e-06 | NA | NA | 0.5674 |
| 6. F | D5FKJ3 | 2-ketoarginine methyltransferase | 5.74e-05 | NA | NA | 0.5185 |
| 6. F | A8FJF8 | Ribosomal RNA small subunit methyltransferase G | 3.62e-06 | NA | NA | 0.5142 |
| 6. F | Q0ADD7 | Ribosomal RNA small subunit methyltransferase G | 2.34e-06 | NA | NA | 0.4191 |
| 6. F | B2HYF8 | Ribosomal RNA small subunit methyltransferase C | 2.71e-05 | NA | NA | 0.6359 |
| 6. F | Q0TCH3 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5195 |
| 6. F | C7BZ94 | Ribosomal RNA small subunit methyltransferase H | 2.53e-03 | NA | NA | 0.4284 |
| 6. F | Q1RDR6 | Ribosomal RNA large subunit methyltransferase K/L | 1.71e-03 | NA | NA | 0.6003 |
| 6. F | B1VEE1 | tRNA (guanine-N(7)-)-methyltransferase | 5.54e-05 | NA | NA | 0.4194 |
| 6. F | A0LTL5 | Ribosomal RNA small subunit methyltransferase H | 7.59e-04 | NA | NA | 0.4491 |
| 6. F | A1T1J8 | tRNA (guanine-N(7)-)-methyltransferase | 4.14e-04 | NA | NA | 0.5714 |
| 6. F | Q8P2K1 | Ribosomal RNA small subunit methyltransferase G | 4.48e-06 | NA | NA | 0.491 |
| 6. F | B2K9X0 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 6.62e-05 | NA | NA | 0.6058 |
| 6. F | Q5ZRJ1 | Ribosomal RNA small subunit methyltransferase G | 4.15e-06 | NA | NA | 0.5707 |
| 6. F | Q0SPQ5 | Ribosomal RNA small subunit methyltransferase G | 1.60e-06 | NA | NA | 0.4965 |
| 6. F | P49016 | Demethylmenaquinone methyltransferase | 4.90e-04 | NA | NA | 0.4762 |
| 6. F | B1KUB0 | Ribosomal RNA small subunit methyltransferase G | 1.82e-06 | NA | NA | 0.4989 |
| 6. F | B4ET17 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.07e-06 | NA | NA | 0.5004 |
| 6. F | B5YSF1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.87e-05 | NA | NA | 0.6072 |
| 6. F | A9N8B3 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.4949 |
| 6. F | B9IVN5 | Demethylmenaquinone methyltransferase | 3.31e-04 | NA | NA | 0.4925 |
| 6. F | B9MQF1 | Ribosomal RNA small subunit methyltransferase G | 3.46e-07 | NA | NA | 0.5275 |
| 6. F | Q8TI93 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 4.13e-10 | NA | NA | 0.5793 |
| 6. F | B5BGV5 | Ribosomal RNA small subunit methyltransferase B | 1.38e-03 | NA | NA | 0.4781 |
| 6. F | B2TUN5 | Ribosomal RNA small subunit methyltransferase G | 1.38e-06 | NA | NA | 0.5081 |
| 6. F | B0JYE6 | Ribosomal RNA small subunit methyltransferase G | 3.41e-06 | NA | NA | 0.5321 |
| 6. F | A1VIB2 | Ribosomal RNA small subunit methyltransferase G | 3.80e-07 | NA | NA | 0.4883 |
| 6. F | Q1IVQ3 | Ribosomal RNA small subunit methyltransferase G | 1.48e-06 | NA | NA | 0.5464 |
| 6. F | B1J2G9 | tRNA (guanine-N(7)-)-methyltransferase | 2.03e-05 | NA | NA | 0.4535 |
| 6. F | Q0RNP9 | Ribosomal RNA small subunit methyltransferase H | 7.20e-04 | NA | NA | 0.4672 |
| 6. F | A0A1X9WEP1 | Nocamycin O-methyltransferase | 1.97e-03 | NA | NA | 0.5902 |
| 6. F | A4IXN4 | Ribosomal RNA large subunit methyltransferase K/L | 5.05e-03 | NA | NA | 0.4962 |
| 6. F | Q1CCG7 | Ribosomal RNA small subunit methyltransferase G | 1.53e-06 | NA | NA | 0.4659 |
| 6. F | A6Q7Y2 | Ribosomal RNA small subunit methyltransferase H | 5.18e-05 | NA | NA | 0.4678 |
| 6. F | A8A593 | Ribosomal RNA small subunit methyltransferase B | 1.45e-03 | NA | NA | 0.4763 |
| 6. F | B5BBV5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.00e-05 | NA | NA | 0.5899 |
| 6. F | B1LGP5 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | A1RHE4 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.15e-05 | NA | NA | 0.5509 |
| 6. F | Q72HI4 | Demethylmenaquinone methyltransferase | 1.31e-05 | NA | NA | 0.5592 |
| 6. F | A0A1C9U5X5 | Reticuline N-methyltransferase | 4.25e-03 | NA | NA | 0.4184 |
| 6. F | A4TSI5 | Ribosomal RNA small subunit methyltransferase G | 1.53e-06 | NA | NA | 0.4662 |
| 6. F | A3CLJ1 | Ribosomal RNA small subunit methyltransferase G | 3.27e-06 | NA | NA | 0.4763 |
| 6. F | A0QME9 | tRNA (guanine-N(7)-)-methyltransferase | 9.42e-04 | NA | NA | 0.5084 |
| 6. F | A9BF05 | Ribosomal RNA small subunit methyltransferase G | 2.72e-05 | NA | NA | 0.5384 |
| 6. F | Q5QZI9 | Ribosomal RNA small subunit methyltransferase G | 1.04e-06 | NA | NA | 0.4963 |
| 6. F | A6VL65 | Ribosomal RNA small subunit methyltransferase G | 2.71e-06 | NA | NA | 0.4595 |
| 6. F | Q7VI24 | tRNA (guanine-N(7)-)-methyltransferase | 6.46e-04 | NA | NA | 0.442 |
| 6. F | Q60CS4 | Ribosomal RNA small subunit methyltransferase G | 2.89e-06 | NA | NA | 0.5652 |
| 6. F | A6UYJ1 | tRNA (guanine-N(7)-)-methyltransferase | 2.72e-05 | NA | NA | 0.4793 |
| 6. F | A4WGE7 | Ribosomal RNA small subunit methyltransferase G | 1.19e-06 | NA | NA | 0.4984 |
| 6. F | Q600J2 | tRNA (guanine-N(7)-)-methyltransferase | 4.92e-05 | NA | NA | 0.5353 |
| 6. F | Q0TJI9 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.65e-05 | NA | NA | 0.509 |
| 6. F | Q8PY64 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 1.33e-09 | NA | NA | 0.5949 |
| 6. F | C5BW67 | Ribosomal RNA small subunit methyltransferase H | 8.56e-04 | NA | NA | 0.4521 |
| 6. F | A9KLX7 | Ribosomal RNA small subunit methyltransferase G | 3.77e-06 | NA | NA | 0.4856 |
| 6. F | P64240 | Ribosomal RNA small subunit methyltransferase G | 2.14e-06 | NA | NA | 0.5214 |
| 6. F | B7LPL0 | Ribosomal RNA small subunit methyltransferase F | 5.07e-03 | NA | NA | 0.4945 |
| 6. F | A1VZ48 | Ribosomal RNA small subunit methyltransferase H | 9.96e-07 | NA | NA | 0.4414 |
| 6. F | Q8KAK0 | Ribosomal RNA small subunit methyltransferase G | 2.52e-06 | NA | NA | 0.5201 |
| 6. F | B6J2B9 | Ribosomal RNA small subunit methyltransferase G | 1.75e-06 | NA | NA | 0.5737 |
| 6. F | Q04K39 | Ribosomal RNA small subunit methyltransferase G | 3.18e-06 | NA | NA | 0.4758 |
| 6. F | A5FJ42 | Ribosomal RNA small subunit methyltransferase G | 2.06e-05 | NA | NA | 0.5119 |
| 6. F | B8EDW0 | Ribosomal RNA small subunit methyltransferase G | 1.99e-06 | NA | NA | 0.5004 |
| 6. F | Q5M5Y2 | Ribosomal RNA small subunit methyltransferase G | 3.54e-06 | NA | NA | 0.4705 |
| 6. F | B5F101 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.89e-05 | NA | NA | 0.5941 |
| 6. F | B1IHR7 | Ribosomal RNA small subunit methyltransferase G | 1.86e-06 | NA | NA | 0.5007 |
| 6. F | Q31RM0 | Ribosomal RNA small subunit methyltransferase G | 1.66e-06 | NA | NA | 0.5719 |
| 6. F | Q7NA87 | Ribosomal RNA small subunit methyltransferase G | 1.52e-06 | NA | NA | 0.4695 |
| 6. F | Q04XB2 | tRNA (guanine-N(7)-)-methyltransferase | 1.02e-05 | NA | NA | 0.5616 |
| 6. F | A6L4P5 | Ribosomal RNA small subunit methyltransferase G | 1.45e-05 | NA | NA | 0.5307 |
| 6. F | A8YXD7 | Ribosomal RNA small subunit methyltransferase G | 1.78e-06 | NA | NA | 0.5388 |
| 6. F | Q9HZU0 | Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] | 1.12e-03 | NA | NA | 0.4908 |
| 6. F | Q8XEE5 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.5193 |
| 6. F | Q3K588 | tRNA (guanine-N(7)-)-methyltransferase | 1.88e-05 | NA | NA | 0.451 |
| 6. F | Q87MA4 | Ribosomal RNA large subunit methyltransferase G | 2.18e-04 | NA | NA | 0.6 |
| 6. F | B4T0E3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.78e-05 | NA | NA | 0.5935 |
| 6. F | Q81FQ6 | Demethylmenaquinone methyltransferase | 3.32e-04 | NA | NA | 0.5412 |
| 6. F | C1CL20 | Ribosomal RNA small subunit methyltransferase G | 3.19e-06 | NA | NA | 0.4755 |
| 6. F | B7NDR0 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5194 |
| 6. F | B7LD52 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.81e-05 | NA | NA | 0.6088 |
| 6. F | Q9WZG6 | Ribosomal RNA small subunit methyltransferase G | 1.75e-06 | NA | NA | 0.4901 |
| 6. F | Q1JND4 | Ribosomal RNA small subunit methyltransferase G | 5.04e-06 | NA | NA | 0.4882 |
| 6. F | C5D3E5 | Demethylmenaquinone methyltransferase | 4.36e-06 | NA | NA | 0.5381 |
| 6. F | Q5GU13 | Ribosomal RNA small subunit methyltransferase G | 4.61e-05 | NA | NA | 0.5357 |
| 6. F | Q57R80 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.69e-05 | NA | NA | 0.5935 |
| 6. F | Q5XDS2 | Ribosomal RNA small subunit methyltransferase G | 4.12e-06 | NA | NA | 0.482 |
| 6. F | Q9I6B3 | tRNA (guanine-N(7)-)-methyltransferase | 3.36e-04 | NA | NA | 0.4419 |
| 6. F | B1MXV5 | Ribosomal RNA small subunit methyltransferase H | 9.38e-06 | NA | NA | 0.4375 |
| 6. F | B6J8V2 | Ribosomal RNA small subunit methyltransferase G | 1.90e-06 | NA | NA | 0.5539 |
| 6. F | Q1WRS8 | Ribosomal RNA small subunit methyltransferase G | 9.78e-08 | NA | NA | 0.5299 |
| 6. F | B7MCQ4 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5194 |
| 6. F | P0DF45 | Ribosomal RNA small subunit methyltransferase G | 4.21e-06 | NA | NA | 0.4381 |
| 6. F | B4TJX9 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4677 |
| 6. F | Q82YY1 | Ribosomal RNA small subunit methyltransferase G | 4.06e-07 | NA | NA | 0.5021 |
| 6. F | Q047S1 | Ribosomal RNA small subunit methyltransferase G | 3.31e-06 | NA | NA | 0.5077 |
| 6. F | Q8FJE7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.39e-05 | NA | NA | 0.514 |
| 6. F | Q9HWH2 | Phenazine-1-carboxylate N-methyltransferase | 5.47e-04 | NA | NA | 0.5291 |
| 6. F | Q9LCY2 | Ribosomal RNA small subunit methyltransferase G | 1.97e-05 | NA | NA | 0.5294 |
| 6. F | C1CR21 | Ribosomal RNA small subunit methyltransferase G | 3.13e-06 | NA | NA | 0.477 |
| 6. F | B2VDF6 | Ribosomal RNA large subunit methyltransferase K/L | 1.98e-03 | NA | NA | 0.5166 |
| 6. F | A4XN49 | Ribosomal RNA small subunit methyltransferase G | 1.03e-06 | NA | NA | 0.5242 |
| 6. F | B2GF22 | Ribosomal RNA small subunit methyltransferase G | 8.68e-08 | NA | NA | 0.5075 |
| 6. F | Q2S6G7 | Ribosomal RNA small subunit methyltransferase G | 1.72e-07 | NA | NA | 0.4997 |
| 6. F | C6DEQ3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.54e-05 | NA | NA | 0.4997 |
| 6. F | B1X6E1 | Ribosomal RNA small subunit methyltransferase B | 1.28e-03 | NA | NA | 0.4844 |
| 6. F | Q6A9R0 | Ribosomal RNA small subunit methyltransferase H | 1.06e-03 | NA | NA | 0.4761 |
| 6. F | B9DTP3 | Ribosomal RNA small subunit methyltransferase G | 4.61e-06 | NA | NA | 0.4685 |
| 6. F | C0M821 | Ribosomal RNA small subunit methyltransferase G | 2.94e-06 | NA | NA | 0.4786 |
| 6. F | Q01NF9 | Ribosomal RNA small subunit methyltransferase G | 6.18e-05 | NA | NA | 0.5675 |
| 6. F | A9MN78 | Ribosomal RNA small subunit methyltransferase B | 1.34e-03 | NA | NA | 0.519 |
| 6. F | A3QB25 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.32e-05 | NA | NA | 0.6228 |
| 6. F | Q5YMS1 | Ribosomal RNA small subunit methyltransferase G | 6.44e-05 | NA | NA | 0.5895 |
| 6. F | A1RCA8 | Ribosomal RNA small subunit methyltransferase G | 7.62e-06 | NA | NA | 0.5282 |
| 6. F | A6L3D5 | Demethylmenaquinone methyltransferase | 7.35e-06 | NA | NA | 0.4896 |
| 6. F | A7ZJS7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.57e-05 | NA | NA | 0.5091 |
| 6. F | A4SUS4 | Ribosomal RNA small subunit methyltransferase G | 3.12e-06 | NA | NA | 0.4773 |
| 6. F | P0ADY0 | Ribosomal RNA small subunit methyltransferase D | 9.59e-09 | NA | NA | 0.6404 |
| 6. F | A4J9R9 | Ribosomal RNA small subunit methyltransferase G | 2.10e-06 | NA | NA | 0.5375 |
| 6. F | Q0HD69 | Ribosomal RNA small subunit methyltransferase G | 2.20e-06 | NA | NA | 0.521 |
| 6. F | B7HL23 | Demethylmenaquinone methyltransferase | 3.30e-04 | NA | NA | 0.5272 |
| 6. F | C1CEP0 | Ribosomal RNA small subunit methyltransferase G | 3.29e-06 | NA | NA | 0.4767 |
| 6. F | Q83S14 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.10e-05 | NA | NA | 0.6062 |
| 6. F | Q2JTZ8 | Ribosomal RNA small subunit methyltransferase G | 6.96e-05 | NA | NA | 0.4775 |
| 6. F | B7NLK8 | Ribosomal RNA small subunit methyltransferase B | 1.29e-03 | NA | NA | 0.5027 |
| 6. F | A7ZSH7 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | P59720 | tRNA (guanine-N(7)-)-methyltransferase | 1.54e-04 | NA | NA | 0.5164 |
| 6. F | A9MXB7 | Ribosomal RNA small subunit methyltransferase G | 1.46e-06 | NA | NA | 0.5056 |
| 6. F | B7J1B0 | Ribosomal RNA small subunit methyltransferase G | 1.30e-07 | NA | NA | 0.5803 |
| 6. F | Q8X6Q5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.00e-05 | NA | NA | 0.6068 |
| 6. F | A9M0C4 | Ubiquinone biosynthesis O-methyltransferase | 5.07e-06 | NA | NA | 0.5024 |
| 6. F | P47464 | Ribosomal RNA small subunit methyltransferase H | 1.70e-03 | NA | NA | 0.4162 |
| 6. F | Q6F847 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 1.29e-04 | NA | NA | 0.5332 |
| 6. F | Q07VT4 | Ribosomal RNA small subunit methyltransferase G | 1.83e-06 | NA | NA | 0.5 |
| 6. F | Q4UP54 | Ribosomal RNA small subunit methyltransferase G | 8.26e-07 | NA | NA | 0.519 |
| 6. F | Q5NEF0 | Ribosomal RNA small subunit methyltransferase G | 1.19e-06 | NA | NA | 0.4834 |
| 6. F | Q32F19 | Ribosomal RNA small subunit methyltransferase F | 5.52e-03 | NA | NA | 0.5041 |
| 6. F | Q1G8A5 | Ribosomal RNA small subunit methyltransferase G | 3.43e-06 | NA | NA | 0.5077 |
| 6. F | Q4QN56 | Ribosomal RNA small subunit methyltransferase G | 3.19e-06 | NA | NA | 0.4959 |
| 6. F | P57946 | Ribosomal RNA small subunit methyltransferase G | 3.05e-06 | NA | NA | 0.4721 |
| 6. F | Q1CCX4 | Ribosomal RNA small subunit methyltransferase B | 1.12e-03 | NA | NA | 0.4987 |
| 6. F | Q32ID7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.34e-05 | NA | NA | 0.5887 |
| 6. F | A4QIE3 | Ribosomal RNA small subunit methyltransferase G | 3.40e-05 | NA | NA | 0.5657 |
| 6. F | B6I202 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | B8G6Y3 | Ribosomal RNA small subunit methyltransferase G | 9.48e-06 | NA | NA | 0.5117 |
| 6. F | Q10Y54 | Ribosomal RNA small subunit methyltransferase G | 1.79e-06 | NA | NA | 0.5073 |
| 6. F | Q2GCL0 | tRNA (guanine-N(7)-)-methyltransferase | 3.35e-06 | NA | NA | 0.5552 |
| 6. F | Q1CAC8 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.83e-05 | NA | NA | 0.6047 |
| 6. F | Q8NL53 | Ribosomal RNA small subunit methyltransferase G | 3.14e-05 | NA | NA | 0.4803 |
| 6. F | A4QHQ6 | tRNA (guanine-N(7)-)-methyltransferase | 3.28e-05 | NA | NA | 0.4845 |
| 6. F | A1U992 | tRNA (guanine-N(7)-)-methyltransferase | 6.55e-05 | NA | NA | 0.521 |
| 6. F | Q4R6Y8 | Glutathione S-transferase C-terminal domain-containing protein | 1.95e-02 | NA | NA | 0.4675 |
| 6. F | C4KH10 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.31e-04 | NA | NA | 0.5272 |
| 6. F | Q30SG7 | tRNA (guanine-N(7)-)-methyltransferase | 6.70e-05 | NA | NA | 0.4576 |
| 6. F | Q9L9F3 | 8-demethylnovobiocic acid C(8)-methyltransferase | 1.52e-03 | NA | NA | 0.5128 |
| 6. F | Q49UI6 | Ribosomal RNA small subunit methyltransferase G | 2.15e-06 | NA | NA | 0.5265 |
| 6. F | C0R2Q3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 2.42e-04 | NA | NA | 0.4578 |
| 6. F | P67056 | Demethylmenaquinone methyltransferase | 2.13e-04 | NA | NA | 0.4855 |
| 6. F | A8AIQ7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.74e-05 | NA | NA | 0.6013 |
| 6. F | B5F7R5 | Ribosomal RNA small subunit methyltransferase B | 1.34e-03 | NA | NA | 0.4972 |
| 6. F | A1TI25 | Ribosomal RNA small subunit methyltransferase G | 2.28e-05 | NA | NA | 0.5908 |
| 6. F | B1MX30 | Ribosomal RNA small subunit methyltransferase G | 1.06e-06 | NA | NA | 0.526 |
| 6. F | Q89AI2 | Ribosomal RNA small subunit methyltransferase C | 1.06e-05 | NA | NA | 0.6824 |
| 6. F | Q16DL1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 1.04e-03 | NA | NA | 0.4694 |
| 6. F | B1KQ44 | Ribosomal RNA small subunit methyltransferase G | 1.69e-06 | NA | NA | 0.5052 |
| 6. F | Q31DK9 | Ribosomal RNA small subunit methyltransferase G | 7.96e-06 | NA | NA | 0.4773 |
| 6. F | Q9PL91 | tRNA (guanine-N(7)-)-methyltransferase | 3.19e-05 | NA | NA | 0.5771 |
| 6. F | C1EN10 | Demethylmenaquinone methyltransferase | 3.28e-04 | NA | NA | 0.5417 |
| 6. F | Q8ZJ81 | Ribosomal RNA small subunit methyltransferase B | 1.12e-03 | NA | NA | 0.4971 |
| 6. F | Q8PF23 | Ribosomal RNA small subunit methyltransferase G | 1.24e-06 | NA | NA | 0.5305 |
| 6. F | B1IWZ8 | Ribosomal RNA small subunit methyltransferase G | 1.31e-06 | NA | NA | 0.512 |
| 6. F | A5W6K7 | Ribosomal RNA large subunit methyltransferase K/L | 2.77e-03 | NA | NA | 0.5096 |
| 6. F | Q2JMA3 | Ribosomal RNA small subunit methyltransferase G | 1.22e-06 | NA | NA | 0.4827 |
| 6. F | Q5WGT4 | Demethylmenaquinone methyltransferase | 5.58e-06 | NA | NA | 0.5443 |
| 6. F | Q83PJ7 | Ribosomal RNA small subunit methyltransferase G | 1.43e-06 | NA | NA | 0.5027 |
| 6. F | Q0T014 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | Q30TL7 | Ribosomal RNA small subunit methyltransferase G | 1.02e-05 | NA | NA | 0.4875 |
| 6. F | A6TEU2 | Ribosomal RNA small subunit methyltransferase B | 1.33e-03 | NA | NA | 0.4991 |
| 6. F | B7USL2 | Ribosomal RNA small subunit methyltransferase F | 4.86e-03 | NA | NA | 0.5054 |
| 6. F | Q14HS5 | Ribosomal RNA large subunit methyltransferase K/L | 5.05e-03 | NA | NA | 0.4952 |
| 6. F | Q48V72 | Ribosomal RNA small subunit methyltransferase G | 4.09e-06 | NA | NA | 0.513 |
| 6. F | A3Q8S0 | Ribosomal RNA small subunit methyltransferase G | 2.47e-05 | NA | NA | 0.5866 |
| 6. F | Q883N9 | Ribosomal RNA large subunit methyltransferase K/L | 3.39e-03 | NA | NA | 0.4961 |
| 6. F | Q46EB1 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 7.05e-05 | NA | NA | 0.5081 |
| 6. F | Q8CMN7 | Ribosomal RNA small subunit methyltransferase G | 2.90e-07 | NA | NA | 0.5276 |
| 6. F | P74360 | Uncharacterized protein sll1526 | 2.15e-03 | NA | NA | 0.5287 |
| 6. F | Q6KZQ5 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 8.53e-05 | NA | NA | 0.5217 |
| 6. F | Q329S9 | Ribosomal RNA small subunit methyltransferase G | 1.33e-06 | NA | NA | 0.5105 |
| 6. F | B2TRH8 | Ribosomal RNA small subunit methyltransferase G | 2.31e-06 | NA | NA | 0.509 |
| 6. F | Q6D000 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.4967 |
| 6. F | Q8YR05 | Uncharacterized RNA methyltransferase alr3654 | 7.54e-06 | NA | NA | 0.5945 |
| 6. F | A4YCI8 | Ribosomal RNA small subunit methyltransferase G | 2.04e-06 | NA | NA | 0.4917 |
| 6. F | A1KEG3 | Ribosomal RNA small subunit methyltransferase G | 2.88e-05 | NA | NA | 0.5815 |
| 6. F | Q8TTT4 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 7.77e-05 | NA | NA | 0.5305 |
| 6. F | Q4KFI6 | Ribosomal RNA large subunit methyltransferase K/L | 6.34e-03 | NA | NA | 0.5587 |
| 6. F | Q48CM0 | tRNA (guanine-N(7)-)-methyltransferase | 2.03e-04 | NA | NA | 0.5044 |
| 6. F | Q7M9J8 | Ribosomal RNA small subunit methyltransferase G | 5.54e-07 | NA | NA | 0.4518 |
| 6. F | A8LX88 | Ribosomal RNA small subunit methyltransferase H | 2.12e-03 | NA | NA | 0.4596 |
| 6. F | B8IMX2 | Ribosomal RNA small subunit methyltransferase H | 3.89e-04 | NA | NA | 0.4514 |
| 6. F | A7MEX5 | Ribosomal RNA large subunit methyltransferase K/L | 1.75e-03 | NA | NA | 0.6078 |
| 6. F | Q03W30 | Ribosomal RNA small subunit methyltransferase H | 7.81e-06 | NA | NA | 0.434 |
| 6. F | A0KR27 | Ribosomal RNA small subunit methyltransferase G | 2.21e-06 | NA | NA | 0.5216 |
| 6. F | A1V8U2 | Ribosomal RNA small subunit methyltransferase G | 3.49e-06 | NA | NA | 0.427 |
| 6. F | B5FJI4 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.4678 |
| 6. F | C3K3L6 | tRNA (guanine-N(7)-)-methyltransferase | 2.03e-05 | NA | NA | 0.4589 |
| 6. F | Q5PGN2 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.11e-05 | NA | NA | 0.6037 |
| 6. F | Q5R5T5 | 12S rRNA N4-methylcytidine methyltransferase | 9.35e-03 | NA | NA | 0.4422 |
| 6. F | Q0SYT6 | Ribosomal RNA small subunit methyltransferase G | 1.30e-06 | NA | NA | 0.5113 |
| 6. F | Q255M7 | tRNA (guanine-N(7)-)-methyltransferase | 3.40e-05 | NA | NA | 0.5023 |
| 6. F | A6VKU5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.62e-05 | NA | NA | 0.5903 |
| 6. F | B1WZ70 | Ribosomal RNA small subunit methyltransferase H | 1.09e-02 | NA | NA | 0.4563 |
| 6. F | Q8YSA7 | Ribosomal RNA small subunit methyltransferase G | 4.60e-06 | NA | NA | 0.4866 |
| 6. F | O84836 | tRNA (guanine-N(7)-)-methyltransferase | 4.36e-05 | NA | NA | 0.5577 |
| 6. F | Q2JD58 | Ribosomal RNA small subunit methyltransferase H | 3.66e-03 | NA | NA | 0.4693 |
| 6. F | B3DQM3 | Ribosomal RNA small subunit methyltransferase H | 6.14e-03 | NA | NA | 0.4328 |
| 6. F | A7FPL8 | Ribosomal RNA small subunit methyltransferase G | 2.03e-06 | NA | NA | 0.5008 |
| 6. F | Q5M1E6 | Ribosomal RNA small subunit methyltransferase G | 3.52e-06 | NA | NA | 0.4747 |
| 6. F | Q8FM11 | tRNA (guanine-N(7)-)-methyltransferase | 4.90e-05 | NA | NA | 0.4627 |
| 6. F | B5RL03 | Ribosomal RNA small subunit methyltransferase G | 6.00e-07 | NA | NA | 0.5811 |
| 6. F | B8CPH7 | Ribosomal RNA small subunit methyltransferase F | 2.56e-03 | NA | NA | 0.6009 |
| 6. F | Q1BFP0 | tRNA (guanine-N(7)-)-methyltransferase | 7.26e-05 | NA | NA | 0.5415 |
| 6. F | Q0TGZ7 | Ribosomal RNA small subunit methyltransferase F | 4.97e-03 | NA | NA | 0.5054 |
| 6. F | P35552 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 2.63e-04 | NA | NA | 0.5139 |
| 6. F | Q28FI7 | Methyltransferase-like 26 | 6.69e-09 | NA | NA | 0.5818 |
| 6. F | A0A142C7A1 | O-methyltransferase phnC | 4.95e-03 | NA | NA | 0.4859 |
| 6. F | A7MPE7 | Ribosomal RNA small subunit methyltransferase B | 1.37e-03 | NA | NA | 0.4915 |
| 6. F | A3DAS4 | Ribosomal RNA small subunit methyltransferase G | 2.23e-06 | NA | NA | 0.5038 |
| 6. F | B2V5J5 | Ribosomal RNA small subunit methyltransferase H | 2.33e-04 | NA | NA | 0.449 |
| 6. F | B1IWR3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.00e-05 | NA | NA | 0.4979 |
| 6. F | Q9KCC4 | Demethylmenaquinone methyltransferase | 5.79e-06 | NA | NA | 0.5404 |
| 6. F | Q9CCZ9 | tRNA (guanine-N(7)-)-methyltransferase | 2.89e-05 | NA | NA | 0.5484 |
| 6. F | Q3IHA0 | Ribosomal RNA small subunit methyltransferase F | 5.82e-04 | NA | NA | 0.5925 |
| 6. F | A1AV41 | Ribosomal RNA small subunit methyltransferase G | 4.60e-07 | NA | NA | 0.5239 |
| 6. F | Q040U0 | Ribosomal RNA small subunit methyltransferase G | 1.64e-07 | NA | NA | 0.4952 |
| 6. F | P08442 | Uncharacterized protein syc1184_c | 1.25e-02 | NA | NA | 0.4815 |
| 6. F | Q4A6Q0 | Ribosomal RNA small subunit methyltransferase G | 3.39e-06 | NA | NA | 0.5519 |
| 6. F | Q71VW1 | Ribosomal RNA small subunit methyltransferase G | 3.05e-07 | NA | NA | 0.5236 |
| 6. F | B5QYK4 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.40e-05 | NA | NA | 0.594 |
| 6. F | Q6NET4 | tRNA (guanine-N(7)-)-methyltransferase | 6.10e-05 | NA | NA | 0.4456 |
| 6. F | Q5C9L6 | (S)-coclaurine N-methyltransferase | 3.64e-03 | NA | NA | 0.3872 |
| 6. F | C0PZV1 | Ribosomal RNA small subunit methyltransferase B | 1.40e-03 | NA | NA | 0.4783 |
| 6. F | C1C7R5 | Ribosomal RNA small subunit methyltransferase G | 3.14e-06 | NA | NA | 0.4771 |
| 6. F | Q66CN7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 3.88e-05 | NA | NA | 0.6048 |
| 6. F | B4U4T4 | Ribosomal RNA small subunit methyltransferase G | 2.94e-06 | NA | NA | 0.4737 |
| 6. F | B2I4Q1 | Ribosomal RNA small subunit methyltransferase G | 3.20e-05 | NA | NA | 0.5352 |
| 6. F | A8AQI3 | Ribosomal RNA small subunit methyltransferase B | 1.29e-03 | NA | NA | 0.5972 |
| 6. F | Q9PC50 | Ribosomal RNA small subunit methyltransferase G | 3.67e-07 | NA | NA | 0.5102 |
| 6. F | B7NR42 | Ribosomal RNA small subunit methyltransferase G | 1.28e-06 | NA | NA | 0.5092 |
| 6. F | P0CS09 | tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61 | 2.55e-04 | NA | NA | 0.5862 |
| 6. F | O05972 | Uncharacterized protein RP028 | 2.64e-03 | NA | NA | 0.5094 |
| 6. F | B5E522 | Ribosomal RNA small subunit methyltransferase G | 3.16e-06 | NA | NA | 0.4767 |
| 6. F | P35553 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase | 3.23e-04 | NA | NA | 0.5189 |
| 6. F | Q7XB08 | (S)-coclaurine N-methyltransferase | 8.94e-04 | NA | NA | 0.4153 |
| 6. F | A8G1X5 | Ribosomal RNA small subunit methyltransferase G | 1.60e-06 | NA | NA | 0.4926 |
| 6. F | A3MQI8 | Ribosomal RNA small subunit methyltransferase G | 2.84e-06 | NA | NA | 0.4387 |
| 6. F | Q4JSC5 | Ribosomal RNA small subunit methyltransferase G | 4.27e-05 | NA | NA | 0.5596 |
| 6. F | A1JRZ3 | Ribosomal RNA small subunit methyltransferase B | 1.37e-03 | NA | NA | 0.4829 |
| 6. F | Q2NJ22 | Ribosomal RNA small subunit methyltransferase G | 2.02e-07 | NA | NA | 0.5721 |
| 6. F | Q643C8 | Phenylpyruvate C(3)-methyltransferase | 3.62e-04 | NA | NA | 0.5062 |
| 6. F | C4ZZ18 | Ribosomal RNA small subunit methyltransferase G | 1.35e-06 | NA | NA | 0.5081 |
| 6. F | B1YGA6 | Ribosomal RNA small subunit methyltransferase G | 2.49e-06 | NA | NA | 0.4754 |
| 6. F | A1S4D3 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | 7.17e-06 | NA | NA | 0.6065 |
| 6. F | Q8PHF4 | tRNA (guanine-N(7)-)-methyltransferase | 2.49e-05 | NA | NA | 0.4777 |
| 6. F | B1AI25 | Ribosomal RNA small subunit methyltransferase G | 1.01e-07 | NA | NA | 0.5228 |
| 6. F | Q03NV0 | Ribosomal RNA small subunit methyltransferase G | 9.77e-08 | NA | NA | 0.5326 |
| 6. F | A6LNR5 | Ribosomal RNA small subunit methyltransferase H | 6.52e-07 | NA | NA | 0.4637 |
| 6. F | P59964 | Ribosomal RNA small subunit methyltransferase G | 2.92e-05 | NA | NA | 0.5807 |
| 6. F | Q1WUP5 | tRNA (guanine-N(7)-)-methyltransferase | 1.33e-05 | NA | NA | 0.5639 |
| 6. F | Q2NI56 | tRNA (guanine(26)-N(2))-dimethyltransferase | 4.80e-05 | NA | NA | 0.5226 |
| 6. F | Q5N2N4 | Ribosomal RNA small subunit methyltransferase G | 5.10e-06 | NA | NA | 0.4712 |
| 6. F | Q9KX67 | Ribosomal RNA small subunit methyltransferase G | 1.26e-06 | NA | NA | 0.4993 |
| 6. F | B9KQJ8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 3.10e-04 | NA | NA | 0.4746 |
| 6. F | Q3IK40 | Ribosomal RNA small subunit methyltransferase G | 2.56e-06 | NA | NA | 0.514 |
| 6. F | Q5SHW1 | tRNA (guanine-N(7)-)-methyltransferase | 2.01e-06 | NA | NA | 0.6129 |
| 6. F | Q1C087 | Ribosomal RNA small subunit methyltransferase G | 1.54e-06 | NA | NA | 0.466 |
| 6. F | Q6D3S2 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.01e-05 | NA | NA | 0.6001 |
| 6. F | B1JR33 | Ribosomal RNA small subunit methyltransferase G | 1.22e-06 | NA | NA | 0.5175 |
| 6. F | A7GVP5 | Ribosomal RNA small subunit methyltransferase G | 2.87e-06 | NA | NA | 0.4738 |
| 6. F | Q7N6G6 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.96e-05 | NA | NA | 0.5128 |
| 6. F | A6QKK0 | Ribosomal RNA small subunit methyltransferase G | 2.10e-06 | NA | NA | 0.5414 |
| 6. F | B6I3X7 | Ribosomal RNA small subunit methyltransferase G | 1.27e-06 | NA | NA | 0.5103 |
| 6. F | Q7VDU8 | tRNA (guanine-N(7)-)-methyltransferase | 1.33e-06 | NA | NA | 0.4975 |
| 6. F | Q96ZL5 | Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) | 1.13e-09 | NA | NA | 0.6193 |
| 6. F | Q5LDN0 | Ribosomal RNA small subunit methyltransferase G | 8.99e-06 | NA | NA | 0.5415 |
| 6. F | Q47QX7 | Ribosomal RNA small subunit methyltransferase H | 1.01e-03 | NA | NA | 0.4617 |
| 6. F | Q73AY2 | Demethylmenaquinone methyltransferase | 3.32e-04 | NA | NA | 0.5415 |
| 6. F | B7LN23 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 6.11e-05 | NA | NA | 0.6055 |
| 6. F | B7IST2 | Ribosomal RNA small subunit methyltransferase G | 3.22e-06 | NA | NA | 0.4623 |
| 6. F | A5F469 | Ribosomal RNA small subunit methyltransferase G | 1.82e-06 | NA | NA | 0.4458 |
| 6. F | A9IJ46 | Ribosomal RNA small subunit methyltransferase G | 1.40e-06 | NA | NA | 0.4828 |
| 6. F | O25443 | tRNA (guanine-N(7)-)-methyltransferase | 1.02e-03 | NA | NA | 0.5936 |
| 6. F | B7K9F0 | Ribosomal RNA small subunit methyltransferase H | 6.74e-03 | NA | NA | 0.4467 |
| 6. F | C4ZY31 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.36e-05 | NA | NA | 0.6068 |
| 6. F | Q8DY64 | Ribosomal RNA small subunit methyltransferase G | 3.69e-06 | NA | NA | 0.4499 |
| 6. F | Q64UQ5 | Ribosomal RNA small subunit methyltransferase G | 8.93e-06 | NA | NA | 0.5606 |
| 6. F | Q14FV3 | Ribosomal RNA small subunit methyltransferase G | 1.18e-06 | NA | NA | 0.5663 |
| 6. F | P64237 | Ribosomal RNA small subunit methyltransferase G | 1.47e-06 | NA | NA | 0.5063 |
| 6. F | A6Q3T0 | Ribosomal RNA small subunit methyltransferase H | 9.22e-05 | NA | NA | 0.4549 |
| 6. F | Q7N7H9 | tRNA (guanine-N(7)-)-methyltransferase | 9.83e-05 | NA | NA | 0.4792 |
| 6. F | C3KWJ3 | Ribosomal RNA small subunit methyltransferase G | 1.91e-06 | NA | NA | 0.4998 |
| 6. F | Q1C2X7 | Ribosomal RNA small subunit methyltransferase B | 1.11e-03 | NA | NA | 0.4829 |
| 6. F | Q3KKL0 | tRNA (guanine-N(7)-)-methyltransferase | 3.38e-05 | NA | NA | 0.5389 |
| 6. F | Q7MYI0 | Ribosomal RNA small subunit methyltransferase B | 9.35e-04 | NA | NA | 0.4697 |
| 6. F | B2G582 | Ribosomal RNA small subunit methyltransferase G | 1.09e-07 | NA | NA | 0.5161 |
| 6. F | Q9S2W4 | Ribosomal RNA small subunit methyltransferase H | 2.87e-06 | NA | NA | 0.4544 |
| 6. F | Q9RYD6 | Ribosomal RNA small subunit methyltransferase G | 2.59e-05 | NA | NA | 0.5206 |
| 6. F | Q9L7M3 | Ribosomal RNA small subunit methyltransferase G | 5.03e-05 | NA | NA | 0.5985 |
| 6. F | A5PKL6 | Glutathione S-transferase C-terminal domain-containing protein | 2.24e-02 | NA | NA | 0.4891 |
| 6. F | P31113 | Demethylmenaquinone methyltransferase | 4.33e-06 | NA | NA | 0.5226 |
| 6. F | B7H3N1 | Ribosomal RNA small subunit methyltransferase G | 1.95e-06 | NA | NA | 0.5327 |
| 6. F | Q73G71 | tRNA (guanine-N(7)-)-methyltransferase | 3.75e-05 | NA | NA | 0.4971 |
| 6. F | Q5FI43 | Ribosomal RNA small subunit methyltransferase G | 1.88e-06 | NA | NA | 0.5333 |
| 6. F | Q74HM3 | Ribosomal RNA small subunit methyltransferase G | 1.82e-06 | NA | NA | 0.5104 |
| 6. F | Q5HS34 | Ribosomal RNA small subunit methyltransferase G | 3.38e-07 | NA | NA | 0.5272 |
| 6. F | A4W8W0 | Ribosomal RNA large subunit methyltransferase K/L | 1.59e-03 | NA | NA | 0.5873 |
| 6. F | A4TH21 | Ribosomal RNA small subunit methyltransferase B | 1.40e-03 | NA | NA | 0.4798 |
| 6. F | A8MKR7 | Ribosomal RNA small subunit methyltransferase G | 3.18e-06 | NA | NA | 0.4739 |
| 6. F | A0Q621 | Ribosomal RNA large subunit methyltransferase K/L | 5.19e-03 | NA | NA | 0.6247 |
| 6. F | Q97QD4 | Ribosomal RNA small subunit methyltransferase G | 3.09e-06 | NA | NA | 0.477 |
| 6. F | A0QND0 | Ribosomal RNA small subunit methyltransferase G | 4.81e-05 | NA | NA | 0.5995 |
| 6. F | B7GQ70 | Ribosomal RNA small subunit methyltransferase H | 1.33e-06 | NA | NA | 0.4442 |
| 6. F | B7MQW3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.25e-05 | NA | NA | 0.6073 |
| 6. F | A7GN50 | Demethylmenaquinone methyltransferase | 3.20e-04 | NA | NA | 0.4912 |
| 6. F | B1JJH6 | Ribosomal RNA small subunit methyltransferase B | 8.22e-04 | NA | NA | 0.497 |
| 6. F | D0JIM5 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.87e-05 | NA | NA | 0.5873 |
| 6. F | A4VZL7 | Ribosomal RNA small subunit methyltransferase G | 3.37e-06 | NA | NA | 0.4727 |
| 6. F | Q8FD12 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.5193 |
| 6. F | A8AID1 | Ribosomal RNA large subunit methyltransferase K/L | 1.90e-03 | NA | NA | 0.55 |
| 6. F | Q0K7S5 | tRNA (guanine-N(7)-)-methyltransferase | 2.19e-04 | NA | NA | 0.5001 |
| 6. F | D3VBF7 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.16e-05 | NA | NA | 0.4975 |
| 6. F | B2HNT4 | Ribosomal RNA small subunit methyltransferase G | 2.56e-05 | NA | NA | 0.5228 |
| 6. F | Q3YWX1 | Ribosomal RNA small subunit methyltransferase B | 1.30e-03 | NA | NA | 0.5193 |
| 6. F | Q7MV10 | Ribosomal RNA small subunit methyltransferase G | 5.97e-06 | NA | NA | 0.5096 |
| 6. F | P64238 | Ribosomal RNA small subunit methyltransferase G | 1.22e-06 | NA | NA | 0.5066 |
| 6. F | Q8XIK5 | Uncharacterized RNA methyltransferase CPE2114 | 6.66e-05 | NA | NA | 0.591 |
| 6. F | B8ZTN3 | Ribosomal RNA small subunit methyltransferase G | 2.09e-05 | NA | NA | 0.4892 |
| 6. F | Q0TLZ7 | Ribosomal RNA small subunit methyltransferase G | 1.56e-06 | NA | NA | 0.491 |
| 6. F | Q0BLC3 | Ribosomal RNA large subunit methyltransferase K/L | 5.11e-03 | NA | NA | 0.5055 |
| 6. F | Q72W15 | tRNA (guanine-N(7)-)-methyltransferase | 6.45e-06 | NA | NA | 0.5392 |
| 6. F | C0MG47 | Ribosomal RNA small subunit methyltransferase G | 3.21e-06 | NA | NA | 0.4883 |
| 6. F | A4WVR7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE | 8.42e-04 | NA | NA | 0.4713 |
| 6. F | A4FLX5 | Ribosomal RNA small subunit methyltransferase H | 7.09e-04 | NA | NA | 0.6556 |
| 6. F | A7GYX6 | Ribosomal RNA small subunit methyltransferase H | 1.30e-04 | NA | NA | 0.4413 |
| 6. F | B8F6X2 | Ribosomal RNA small subunit methyltransferase G | 2.61e-06 | NA | NA | 0.5031 |
| 6. F | B4TDY8 | Ribosomal RNA large subunit methyltransferase K/L | 2.06e-03 | NA | NA | 0.5763 |
| 6. F | Q1R4J2 | Ribosomal RNA small subunit methyltransferase G | 1.27e-06 | NA | NA | 0.5115 |
| 6. F | P64239 | Ribosomal RNA small subunit methyltransferase G | 2.18e-06 | NA | NA | 0.5215 |
| 6. F | Q5KXU0 | Demethylmenaquinone methyltransferase | 4.30e-06 | NA | NA | 0.4963 |
| 6. F | C5D9Y5 | Ribosomal RNA small subunit methyltransferase G | 2.94e-06 | NA | NA | 0.4694 |
| 6. F | B7HHR7 | Demethylmenaquinone methyltransferase | 3.28e-04 | NA | NA | 0.5415 |
| 6. F | Q62FS7 | Ribosomal RNA small subunit methyltransferase G | 3.02e-06 | NA | NA | 0.4272 |
| 6. F | A9R4V6 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.91e-05 | NA | NA | 0.5774 |
| 6. F | Q0SHR3 | Ribosomal RNA small subunit methyltransferase H | 2.00e-03 | NA | NA | 0.5616 |
| 6. F | P62472 | Ribosomal RNA small subunit methyltransferase H | 1.14e-04 | NA | NA | 0.4725 |
| 6. F | Q2STD8 | Ribosomal RNA small subunit methyltransferase G | 2.17e-06 | NA | NA | 0.4791 |
| 6. F | Q108P1 | (S)-tetrahydroprotoberberine N-methyltransferase | 3.87e-03 | NA | NA | 0.3863 |
| 6. F | C3P5A0 | Demethylmenaquinone methyltransferase | 3.32e-04 | NA | NA | 0.539 |
| 6. F | Q04V89 | Ribosomal RNA small subunit methyltransferase H | 4.46e-04 | NA | NA | 0.462 |
| 6. F | Q03ZA4 | Ribosomal RNA small subunit methyltransferase G | 9.47e-07 | NA | NA | 0.5134 |
| 6. F | B7MHG3 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 5.21e-05 | NA | NA | 0.5075 |
| 6. F | Q9Z6S3 | tRNA (guanine-N(7)-)-methyltransferase | 6.06e-05 | NA | NA | 0.5281 |
| 6. F | A7GJN7 | Ribosomal RNA small subunit methyltransferase G | 2.20e-06 | NA | NA | 0.4649 |
| 6. F | Q5L5A2 | tRNA (guanine-N(7)-)-methyltransferase | 3.97e-05 | NA | NA | 0.4932 |
| 6. F | Q29LW1 | eEF1A lysine and N-terminal methyltransferase homolog | 1.38e-02 | NA | NA | 0.542 |
| 6. F | A3N2V2 | Ribosomal RNA small subunit methyltransferase G | 2.19e-06 | NA | NA | 0.4962 |
| 6. F | B5YT08 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5193 |
| 6. F | Q5GXE4 | tRNA (guanine-N(7)-)-methyltransferase | 1.53e-05 | NA | NA | 0.4722 |
| 6. F | Q0T8K2 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | 4.88e-05 | NA | NA | 0.6076 |
| 6. F | C0Z787 | Malonyl-[acyl-carrier protein] O-methyltransferase | 3.15e-05 | NA | NA | 0.3974 |
| 6. F | B5RH47 | Ribosomal RNA small subunit methyltransferase B | 1.32e-03 | NA | NA | 0.4671 |
| 6. F | A7I1J3 | Ribosomal RNA small subunit methyltransferase H | 1.95e-04 | NA | NA | 0.4606 |
| 6. F | A6TXE3 | Ribosomal RNA small subunit methyltransferase G | 3.23e-06 | NA | NA | 0.5055 |
| 6. F | A8KZA9 | Ribosomal RNA small subunit methyltransferase H | 9.15e-04 | NA | NA | 0.461 |
| 6. F | A5UM08 | tRNA (guanine(26)-N(2))-dimethyltransferase | 3.14e-05 | NA | NA | 0.5533 |
| 6. F | A6M3M3 | Ribosomal RNA small subunit methyltransferase G | 1.85e-06 | NA | NA | 0.5173 |
| 6. F | Q081I3 | Ribosomal RNA small subunit methyltransferase F | 4.82e-03 | NA | NA | 0.4708 |
| 6. F | O25411 | Ribosomal RNA small subunit methyltransferase H | 2.09e-03 | NA | NA | 0.4423 |
| 6. F | A5IJ79 | Ribosomal RNA small subunit methyltransferase G | 4.68e-07 | NA | NA | 0.5199 |
| 6. F | B2U2Q6 | Ribosomal RNA small subunit methyltransferase B | 1.31e-03 | NA | NA | 0.5193 |
| 6. F | Q2JRH1 | tRNA (guanine-N(7)-)-methyltransferase | 3.09e-05 | NA | NA | 0.5001 |
| 7. B | Q7MNQ4 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 4.94e-10 | NA | 0.002 | NA |
| 7. B | Q6MAY1 | Uncharacterized RNA methyltransferase pc1544 | 4.95e-05 | NA | 7.56e-04 | NA |
| 7. B | A1SX22 | Ribosomal RNA large subunit methyltransferase G | 8.87e-05 | NA | 0.007 | NA |
| 7. B | Q9KPR9 | Ribosomal RNA large subunit methyltransferase G | 1.44e-04 | NA | 7.34e-04 | NA |
| 7. B | B4RZB4 | Ribosomal RNA large subunit methyltransferase G | 5.53e-05 | NA | 0.017 | NA |
| 7. B | A0Q1R2 | Ribosomal protein L11 methyltransferase | 1.77e-05 | NA | 8.48e-05 | NA |
| 7. B | A7GHH4 | Ribosomal protein L11 methyltransferase | 6.78e-08 | NA | 0.001 | NA |
| 7. B | B1KZN5 | Ribosomal protein L11 methyltransferase | 7.47e-08 | NA | 0.001 | NA |
| 7. B | Q5FKI8 | Ribosomal protein L11 methyltransferase | 1.88e-06 | NA | 0.010 | NA |
| 7. B | Q892R2 | Ribosomal protein L11 methyltransferase | 2.02e-06 | NA | 9.01e-05 | NA |
| 7. B | C1FVT8 | Ribosomal protein L11 methyltransferase | 2.62e-08 | NA | 0.001 | NA |
| 7. B | Q9NRN9 | rRNA N6-adenosine-methyltransferase METTL5 | 2.78e-07 | NA | 0.014 | NA |
| 7. B | Q9HVH4 | Ribosomal RNA large subunit methyltransferase G | 9.37e-05 | NA | 9.82e-05 | NA |
| 7. B | Q59043 | Putative ribosomal RNA large subunit methyltransferase MJ1649 | 3.55e-05 | NA | 0.025 | NA |
| 7. B | Q87SB8 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 4.61e-10 | NA | 1.65e-04 | NA |
| 7. B | Q65S65 | Ribosomal RNA small subunit methyltransferase C | 4.06e-05 | NA | 0.002 | NA |
| 7. B | A6VC08 | Ribosomal RNA large subunit methyltransferase G | 9.37e-05 | NA | 5.46e-05 | NA |
| 7. B | A5F5X3 | Ribosomal RNA large subunit methyltransferase G | 1.48e-04 | NA | 7.34e-04 | NA |
| 7. B | A4VI28 | Ribosomal RNA large subunit methyltransferase G | 1.42e-04 | NA | 0.007 | NA |
| 7. B | A7MXM2 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 1.93e-07 | NA | 5.36e-04 | NA |
| 7. B | B1ILM1 | Ribosomal protein L11 methyltransferase | 7.20e-08 | NA | 0.001 | NA |
| 7. B | C3L3G5 | Ribosomal protein L11 methyltransferase | 1.10e-05 | NA | 0.001 | NA |
| 7. B | A6LRN8 | Ribosomal protein L11 methyltransferase | 5.16e-07 | NA | 0.032 | NA |
| 7. B | Q02G60 | Ribosomal RNA large subunit methyltransferase G | 1.01e-04 | NA | 9.21e-05 | NA |
| 7. B | A6VMV4 | Ribosomal RNA small subunit methyltransferase C | 4.90e-05 | NA | 5.37e-04 | NA |
| 7. B | A7FXL3 | Ribosomal protein L11 methyltransferase | 2.62e-08 | NA | 0.001 | NA |
| 7. B | A5I638 | Ribosomal protein L11 methyltransferase | 7.49e-08 | NA | 0.001 | NA |
| 7. B | Q8DEQ3 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 5.87e-10 | NA | 0.016 | NA |
| 7. B | Q8K1A0 | rRNA N6-adenosine-methyltransferase METTL5 | 4.17e-07 | NA | 0.003 | NA |
| 7. B | B7VJ58 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | 5.94e-10 | NA | 0.040 | NA |
| 7. B | P45558 | Ribosomal protein L11 methyltransferase | 2.51e-06 | NA | 7.42e-06 | NA |
| 7. B | Q891A0 | Uncharacterized RNA methyltransferase CTC_02481 | 4.72e-06 | NA | 0.020 | NA |