Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54637.1
JCVISYN3A_0143
Uncharacterized protein.
M. mycoides homolog: Q6MU87.
TIGRfam Classification: 1=Unknown.
Category: Essential.
Statistics
Total GO Annotation: 33
Unique PROST Go: 33
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 44
Unique PROST Homologs: 44
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
Q8VHK5
(Membrane protein MLC1) with a FATCAT P-Value: 2.73e-05 and RMSD of 3.92 angstrom. The sequence alignment identity is 18.2%.
Structural alignment shown in left. Query protein AVX54637.1 colored as red in alignment, homolog Q8VHK5 colored as blue.
Query protein AVX54637.1 is also shown in right top, homolog Q8VHK5 showed in right bottom. They are colored based on secondary structures.
AVX54637.1 MYKNKNFKIKIINNKF-SM---RIKDI---DPKIEQKNFSIYLKAILGLVVFLITLLPFYAYLHLIFKHESLSFYFANYSIISKYVDLP---S-KSQIWG 89 Q8VHK5 MTREGQFREELGYDRMPTLERGR-QDAGRQDP---------------G------SYTPDS-------KPKDLQ--------LSK--RLPPCFSYKT--W- 58 AVX54637.1 LAISALVFMAIVITMFISFKA-LVNISNNKR-YKQAIIALIIIFGILTILFQGISQYFYGYFQ-DFF-NYQVISGLDNKISDFKKITTQFIEF-EK---N 181 Q8VHK5 -VFSVLMGSCLLVTS--GFSLYLGNVFPSEMDY------LRCAAG--SCIPSAIVSFAVGRRNVSAIPNFQILF-----VSTFAVTTTCLIWFGCKLILN 142 AVX54637.1 TSSIYNWIDVN-NIWWIIFVQIFLMFVTSISLQNITFFEYEKNSEDKYINYFVQKNKVIYQNRIKLYVNNL--FSFTDKTLSNWLIILVLMICFPILIYI 278 Q8VHK5 PSAI-N---INFNLILLLLLEL-LMAATVI----IS----ARSSEEP-----CKKKK----GSISDGSNILDEVTFPARVLKSYSVVEVIAGVSAVLGGV 220 AVX54637.1 VAI----STRGSEKSL-IYWTHQLPNLLKDYQNWNTIFDQYKNQLNLTKSSP------LLI----LSSPIIFL--GITLS-TVLFLLTISIRGQ----KS 356 Q8VHK5 IALNVEEAVSGPHLSVTFFWI-----LVACFP--SAIAS------HVTAECPSKCLVEVLIAISSLTSPLLFTASGY-LSFSVMRVVEI-FKDYPPAIKS 305 AVX54637.1 SQLVLRTKFILLSILISLLI---LS--IFISQLELHKL---LVA--W--NTSNNEQIIGSNYIQAIKQITGQ-KVFENID-QKLF--LLNNIDQKIDSIF 440 Q8VHK5 YDVLL----LLL-LLL-LLLQGGLNTGTAIQCVSF-KVSARLQAASWDPQSCPQERPAG----EVVR---GPLKEF---DKEKAWRAVVVQMAQ------ 382 AVX54637.1 NDRYIISVCISFLVVSTITGFCIILKGMLDKRLAIDFVKNQFKNKKLFRK 490 Q8VHK5 -------------------------------------------------- 382
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:1901097 | negative regulation of autophagosome maturation |
| 5. P | GO:0055036 | virion membrane |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0033748 | hydrogenase (acceptor) activity |
| 5. P | GO:0070059 | intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress |
| 5. P | GO:0019033 | viral tegument |
| 5. P | GO:0071397 | cellular response to cholesterol |
| 5. P | GO:0047484 | regulation of response to osmotic stress |
| 5. P | GO:0005768 | endosome |
| 5. P | GO:0015867 | ATP transport |
| 5. P | GO:0015944 | formate oxidation |
| 5. P | GO:0005524 | ATP binding |
| 5. P | GO:0036397 | formate dehydrogenase (quinone) activity |
| 5. P | GO:0019062 | virion attachment to host cell |
| 5. P | GO:0031419 | cobalamin binding |
| 5. P | GO:0072584 | caveolin-mediated endocytosis |
| 5. P | GO:0032388 | positive regulation of intracellular transport |
| 5. P | GO:0046718 | viral entry into host cell |
| 5. P | GO:0005765 | lysosomal membrane |
| 5. P | GO:0006914 | autophagy |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0072665 | protein localization to vacuole |
| 5. P | GO:0097450 | astrocyte end-foot |
| 5. P | GO:0005471 | ATP:ADP antiporter activity |
| 5. P | GO:0020002 | host cell plasma membrane |
| 5. P | GO:0005783 | endoplasmic reticulum |
| 5. P | GO:0009326 | formate dehydrogenase complex |
| 5. P | GO:0045070 | positive regulation of viral genome replication |
| 5. P | GO:0044569 | [Ni-Fe] hydrogenase complex |
| 5. P | GO:0009061 | anaerobic respiration |
| 5. P | GO:0043328 | protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
| 5. P | GO:1902902 | negative regulation of autophagosome assembly |
| 5. P | GO:0015931 | nucleobase-containing compound transport |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | O33683 | Uncharacterized protein RA0937 | 6.84e-05 | 4.88e-02 | NA | NA |
| 5. P | P34365 | Uncharacterized protein C48B4.11 | 3.27e-04 | 3.99e-03 | NA | NA |
| 5. P | Q92JI6 | ADP,ATP carrier protein 1 | 1.43e-04 | 9.71e-05 | NA | NA |
| 5. P | Q01053 | Gene 58 protein | NA | 1.71e-02 | NA | NA |
| 5. P | Q8VHK5 | Membrane protein MLC1 | 2.73e-05 | 1.48e-02 | NA | NA |
| 5. P | Q9UUJ8 | UPF0658 Golgi apparatus membrane protein C1952.10c | 2.51e-04 | 6.85e-04 | NA | NA |
| 5. P | Q5U2V9 | Transmembrane protein 39A | 3.05e-03 | 7.28e-03 | NA | NA |
| 5. P | Q4UN46 | ADP,ATP carrier protein 5 | 4.26e-04 | 7.83e-04 | NA | NA |
| 5. P | Q66660 | Gene 58 protein | NA | 6.44e-05 | NA | NA |
| 5. P | Q4UN85 | ADP,ATP carrier protein 1 | 6.32e-04 | 3.50e-04 | NA | NA |
| 5. P | Q9CYC3 | Transmembrane protein 39A | 2.70e-03 | 2.20e-02 | NA | NA |
| 5. P | Q8BH18 | Transmembrane protein 117 | 1.84e-03 | 3.78e-02 | NA | NA |
| 5. P | P19568 | ADP,ATP carrier protein 1 | 2.82e-04 | 9.92e-05 | NA | NA |
| 5. P | Q1HVH3 | Protein BMRF2 | NA | 4.95e-03 | NA | NA |
| 5. P | Q3KSU2 | Protein BMRF2 | NA | 6.48e-03 | NA | NA |
| 5. P | P75291 | Ascorbate-specific PTS system EIIC component | 1.77e-03 | 7.66e-05 | NA | NA |
| 5. P | P37180 | Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit | 2.62e-03 | 3.22e-04 | NA | NA |
| 5. P | Q1RGS8 | ADP,ATP carrier protein 1 | 3.48e-04 | 4.31e-04 | NA | NA |
| 5. P | Q92GI5 | ADP,ATP carrier protein 5 | 4.04e-04 | 4.19e-03 | NA | NA |
| 5. P | Q1RHU3 | ADP,ATP carrier protein 2 | 2.90e-04 | 2.30e-02 | NA | NA |
| 5. P | Q9PR97 | Uncharacterized protein UU048 | 2.11e-04 | 3.84e-04 | NA | NA |
| 5. P | P33390 | Protein DVU_0534 | 3.36e-03 | 1.14e-02 | NA | NA |
| 5. P | P03192 | Protein BMRF2 | NA | 2.50e-02 | NA | NA |
| 5. P | Q68XS7 | ADP,ATP carrier protein 1 | 3.97e-04 | 2.37e-04 | NA | NA |
| 5. P | P36034 | Protein COS9 | 9.30e-03 | 9.70e-04 | NA | NA |
| 5. P | O05962 | ADP,ATP carrier protein 5 | 1.19e-04 | 2.08e-03 | NA | NA |
| 5. P | Q9ZDF2 | ADP,ATP carrier protein 2 | 2.13e-03 | 4.58e-03 | NA | NA |
| 5. P | Q4ULJ8 | ADP,ATP carrier protein 4 | 6.72e-04 | 1.43e-02 | NA | NA |
| 5. P | A7RM45 | Probable lysosomal cobalamin transporter | 3.70e-04 | 4.83e-02 | NA | NA |
| 5. P | Q1RK92 | ADP,ATP carrier protein 5 | 5.20e-04 | 1.00e-03 | NA | NA |
| 5. P | Q92HV4 | ADP,ATP carrier protein 4 | 1.70e-03 | 3.85e-02 | NA | NA |
| 5. P | O29750 | Hdr-like menaquinol oxidoreductase integral membrane subunit | 2.54e-03 | 3.19e-03 | NA | NA |
| 5. P | Q72E86 | Menaquinone reductase, integral membrane subunit | 3.39e-03 | 1.53e-02 | NA | NA |
| 5. P | Q92I98 | ADP,ATP carrier protein 2 | 2.65e-04 | 3.52e-02 | NA | NA |
| 5. P | P10227 | Membrane protein UL43 | NA | 1.13e-03 | NA | NA |
| 5. P | Q9BZW5 | Transmembrane 6 superfamily member 1 | 2.61e-04 | 2.62e-03 | NA | NA |
| 5. P | Q5RBJ7 | Transmembrane 6 superfamily member 1 | 2.51e-04 | 3.09e-03 | NA | NA |
| 5. P | Q4ULY0 | ADP,ATP carrier protein 2 | 2.46e-04 | 1.98e-02 | NA | NA |
| 5. P | A6QL84 | Transmembrane 6 superfamily member 1 | 2.83e-04 | 1.97e-02 | NA | NA |
| 5. P | F5HAD1 | Protein ORF58 | NA | 1.08e-04 | NA | NA |
| 5. P | Q9HR72 | Putative dimethyl sulfoxide reductase membrane subunit C | 3.63e-03 | 2.88e-07 | NA | NA |
| 5. P | Q68WZ7 | ADP,ATP carrier protein 2 | 2.69e-04 | 1.22e-02 | NA | NA |
| 5. P | Q68W11 | ADP,ATP carrier protein 5 | 7.01e-05 | 1.61e-03 | NA | NA |
| 5. P | Q9H0C3 | Transmembrane protein 117 | 1.78e-03 | 4.18e-02 | NA | NA |