Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54639.1
JCVISYN3A_0145
Uncharacterized acetyltransferase.
M. mycoides homolog: Q6MU85.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 66
Unique PROST Go: 14
Unique BLAST Go: 0
Unique Foldseek Go: 37
Total Homologs: 188
Unique PROST Homologs: 50
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 101
Structures and Sequence Alignment
The best structural homolog that predicted by 6. F was
O05517
(Putative [ribosomal protein S18]-alanine N-acetyltransferase) with a FATCAT P-Value: 1.71e-05 and RMSD of 3.14 angstrom. The sequence alignment identity is 16.1%.
Structural alignment shown in left. Query protein AVX54639.1 colored as red in alignment, homolog O05517 colored as blue.
Query protein AVX54639.1 is also shown in right top, homolog O05517 showed in right bottom. They are colored based on secondary structures.
AVX54639.1 MNSHSLVFNYR--DNKHFLQEMH----TIIKKRGP--K-TFEEWMVNNNFDSAYIPVTIVNERNGVLAVSGFIKSKAI-INKTVLNTILLTNTFTKAKES 90 O05517 MKTKAAVRNMRLEDIDH-VYEIEASSFT-----SPWTKDSFYHELLENPY-AHYL---VI-EKDGHLA--GYC---GIWI---VMDDAQITNIAIK---- 77 AVX54639.1 NPLMVNELIQGVVKKYENISDFIYTFSNVENDDVLIRNGFKKIKEYTYFMQWDPNKEAKLSVLKRLDLDTNQADFEFVKDELFHSSKNNSLFYIREDGAL 190 O05517 -P----E-YRG-----QSLGE---T---------LFRSAVELCKE----------KDA-----RRLSLEVR------VSN---HPA--QGL-Y-KKFGMQ 126 AVX54639.1 PIYSLLK-YYRNNVFYISNLDAIVIF-SINNKTFQLIGLYSKNEIDVLELLDAIVPKGISLIEFYFVPNIKSKFVVKELRKVMAADCQHRSFLYVRQSTT 288 O05517 P-GGIRKNYYTDN-----GEDALIMWVTINE--------------------------------------------------------------------- 151 AVX54639.1 NLEASKFVVPLLNRLK 304 O05517 ---------------- 151
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 2. PF | GO:0043655 | host extracellular space |
| 2. PF | GO:0008999 | ribosomal protein S5-alanine N-acetyltransferase activity |
| 2. PF | GO:0035447 | mycothiol synthase activity |
| 2. PF | GO:0004379 | glycylpeptide N-tetradecanoyltransferase activity |
| 2. PF | GO:0097691 | bacterial extracellular vesicle |
| 2. PF | GO:0010125 | mycothiol biosynthetic process |
| 2. PF | GO:0019473 | L-lysine catabolic process to glutarate, by acetylation |
| 2. PF | GO:0034069 | aminoglycoside N-acetyltransferase activity |
| 2. PF | GO:0030649 | aminoglycoside antibiotic catabolic process |
| 2. PF | GO:0047981 | histidine N-acetyltransferase activity |
| 2. PF | GO:0008080 | N-acetyltransferase activity |
| 2. PF | GO:0044161 | host cell cytoplasmic vesicle |
| 2. PF | GO:0004468 | lysine N-acetyltransferase activity, acting on acetyl phosphate as donor |
| 2. PF | GO:0017189 | N-terminal peptidyl-alanine acetylation |
| 2. PF | GO:0006499 | N-terminal protein myristoylation |
| 5. P | GO:0052167 | modulation by symbiont of host innate immune response |
| 5. P | GO:0009826 | unidimensional cell growth |
| 5. P | GO:0052040 | modulation by symbiont of host programmed cell death |
| 5. P | GO:0009723 | response to ethylene |
| 5. P | GO:0008361 | regulation of cell size |
| 5. P | GO:0010126 | mycothiol metabolic process |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0052032 | modulation by symbiont of host inflammatory response |
| 5. P | GO:0034054 | suppression by symbiont of host defense-related programmed cell death |
| 5. P | GO:0071468 | cellular response to acidic pH |
| 5. P | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups |
| 5. P | GO:0033661 | effector-mediated defense to host-produced reactive oxygen species |
| 5. P | GO:0051701 | biological process involved in interaction with host |
| 5. P | GO:0009640 | photomorphogenesis |
| 6. F | GO:0009252 | peptidoglycan biosynthetic process |
| 6. F | GO:0043993 | histone acetyltransferase activity (H3-K18 specific) |
| 6. F | GO:0005829 | cytosol |
| 6. F | GO:0006598 | polyamine catabolic process |
| 6. F | GO:1905533 | negative regulation of leucine import across plasma membrane |
| 6. F | GO:0006338 | chromatin remodeling |
| 6. F | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 6. F | GO:0046677 | response to antibiotic |
| 6. F | GO:0031975 | envelope |
| 6. F | GO:0036408 | histone acetyltransferase activity (H3-K14 specific) |
| 6. F | GO:0070577 | lysine-acetylated histone binding |
| 6. F | GO:0002101 | tRNA wobble cytosine modification |
| 6. F | GO:2000617 | positive regulation of histone H3-K9 acetylation |
| 6. F | GO:0004145 | diamine N-acetyltransferase activity |
| 6. F | GO:0007131 | reciprocal meiotic recombination |
| 6. F | GO:0010515 | negative regulation of induction of conjugation with cellular fusion |
| 6. F | GO:0016755 | aminoacyltransferase activity |
| 6. F | GO:0051392 | tRNA N-acetyltransferase activity |
| 6. F | GO:0006474 | N-terminal protein amino acid acetylation |
| 6. F | GO:0008360 | regulation of cell shape |
| 6. F | GO:0046695 | SLIK (SAGA-like) complex |
| 6. F | GO:0005671 | obsolete Ada2/Gcn5/Ada3 transcription activator complex |
| 6. F | GO:0000775 | chromosome, centromeric region |
| 6. F | GO:0140068 | histone crotonyltransferase activity |
| 6. F | GO:0050071 | lysyltransferase activity |
| 6. F | GO:0047206 | UDP-N-acetylmuramoylpentapeptide-lysine N6-alanyltransferase activity |
| 6. F | GO:0071555 | cell wall organization |
| 6. F | GO:0016746 | acyltransferase activity |
| 6. F | GO:0000166 | nucleotide binding |
| 6. F | GO:0006629 | lipid metabolic process |
| 6. F | GO:0018008 | N-terminal peptidyl-glycine N-myristoylation |
| 6. F | GO:0000124 | SAGA complex |
| 6. F | GO:0043992 | histone acetyltransferase activity (H3-K9 specific) |
| 6. F | GO:0051391 | tRNA acetylation |
| 6. F | GO:0047921 | aminoglycoside 2'-N-acetyltransferase activity |
| 6. F | GO:0043939 | negative regulation of sporulation |
| 6. F | GO:0000785 | chromatin |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 2. PF | A1KLA8 | N-acetyltransferase Eis | 5.67e-04 | 3.38e-02 | NA | 0.4846 |
| 2. PF | P39624 | Spore coat polysaccharide biosynthesis protein SpsD | 7.82e-04 | 7.06e-03 | NA | 0.3545 |
| 2. PF | A4X1M6 | Mycothiol acetyltransferase | 5.58e-04 | 3.31e-04 | NA | 0.425 |
| 2. PF | A8LYQ4 | Mycothiol acetyltransferase | 4.54e-04 | 1.77e-03 | NA | 0.3872 |
| 2. PF | C7MRC4 | Mycothiol acetyltransferase | 1.32e-03 | 2.58e-05 | NA | 0.3973 |
| 2. PF | C0ZP17 | Mycothiol acetyltransferase | 2.76e-04 | 3.84e-03 | NA | 0.388 |
| 2. PF | C1ALF4 | Mycothiol acetyltransferase | 2.18e-03 | 2.33e-05 | NA | 0.4509 |
| 2. PF | P41929 | Lysine acetyltransferase | 3.93e-04 | 1.59e-10 | NA | 0.383 |
| 2. PF | Q9CBC9 | Mycothiol acetyltransferase | 2.35e-03 | 7.52e-04 | NA | 0.3796 |
| 2. PF | U3U715 | Histidine N-acetyltransferase | 5.69e-03 | 6.35e-13 | NA | 0.353 |
| 2. PF | C6DVC4 | Mycothiol acetyltransferase | 2.23e-03 | 2.33e-05 | NA | 0.4425 |
| 2. PF | A0QAU8 | Mycothiol acetyltransferase | 2.10e-03 | 3.01e-04 | NA | 0.398 |
| 2. PF | D7AWZ7 | Mycothiol acetyltransferase | 4.13e-03 | 1.55e-04 | NA | 0.4835 |
| 2. PF | P9WFK6 | N-acetyltransferase Eis | 5.77e-04 | 3.38e-02 | NA | 0.4907 |
| 2. PF | A0PLC7 | Mycothiol acetyltransferase | 8.94e-03 | 4.74e-03 | NA | 0.4609 |
| 2. PF | C5CC88 | Mycothiol acetyltransferase | 2.49e-03 | 3.42e-02 | NA | 0.3953 |
| 2. PF | A5WKI8 | Mycothiol acetyltransferase | 2.19e-03 | 2.33e-05 | NA | 0.437 |
| 2. PF | Q0S740 | Mycothiol acetyltransferase | 1.35e-03 | 2.10e-05 | NA | 0.4232 |
| 2. PF | C1AQY1 | N-acetyltransferase Eis | 6.00e-04 | 3.38e-02 | NA | 0.4883 |
| 2. PF | B8ZSU0 | Mycothiol acetyltransferase | 2.90e-03 | 7.52e-04 | NA | 0.38 |
| 2. PF | O06743 | Uncharacterized N-acetyltransferase YitH | 6.90e-05 | 3.11e-16 | NA | 0.4645 |
| 2. PF | C7M077 | Mycothiol acetyltransferase | 3.74e-05 | 1.70e-03 | NA | 0.3862 |
| 2. PF | D3Q4A8 | Mycothiol acetyltransferase | 1.16e-04 | 1.33e-04 | NA | 0.4435 |
| 2. PF | P9WJM6 | Mycothiol acetyltransferase | 2.24e-03 | 2.33e-05 | NA | 0.4427 |
| 2. PF | A1KGV2 | Mycothiol acetyltransferase | 2.21e-03 | 2.33e-05 | NA | 0.4431 |
| 2. PF | A0JZC2 | Mycothiol acetyltransferase | 1.80e-03 | 3.43e-03 | NA | 0.4299 |
| 2. PF | Q743D5 | Mycothiol acetyltransferase | 2.24e-03 | 1.53e-04 | NA | 0.3877 |
| 2. PF | A5U0K8 | Mycothiol acetyltransferase | 2.26e-03 | 2.33e-05 | NA | 0.446 |
| 2. PF | A1R8Y2 | Mycothiol acetyltransferase | 5.55e-04 | 4.12e-03 | NA | 0.4375 |
| 2. PF | I3J7Q8 | Histidine N-acetyltransferase | 1.87e-03 | 4.92e-15 | NA | 0.3761 |
| 2. PF | Q9KZV0 | Mycothiol acetyltransferase | 1.18e-03 | 3.42e-02 | NA | 0.4913 |
| 2. PF | C4LH71 | Mycothiol acetyltransferase | 6.25e-05 | 4.20e-02 | NA | 0.389 |
| 2. PF | Q6NFH9 | Mycothiol acetyltransferase | 4.33e-05 | 4.20e-02 | NA | 0.4076 |
| 2. PF | B2GI63 | Mycothiol acetyltransferase | 1.15e-03 | 4.77e-04 | NA | 0.41 |
| 2. PF | B2HH13 | Mycothiol acetyltransferase | 3.95e-03 | 4.98e-03 | NA | 0.4554 |
| 2. PF | C1ATC6 | Mycothiol acetyltransferase | 8.68e-04 | 4.02e-05 | NA | 0.431 |
| 2. PF | P59772 | N-acetyltransferase Eis | 5.82e-04 | 3.65e-02 | NA | 0.4981 |
| 5. P | A9WNI5 | Mycothiol acetyltransferase | 1.63e-03 | 1.49e-02 | NA | NA |
| 5. P | D5UXA4 | Mycothiol acetyltransferase | 3.44e-03 | 1.49e-02 | NA | NA |
| 5. P | Q4JXC9 | Mycothiol acetyltransferase | 4.73e-04 | 4.01e-02 | NA | NA |
| 5. P | A1SPL0 | Mycothiol acetyltransferase | 2.06e-03 | 9.48e-04 | NA | NA |
| 5. P | A1ULU4 | Mycothiol acetyltransferase | 3.38e-03 | 1.98e-03 | NA | NA |
| 5. P | P9WFK7 | N-acetyltransferase Eis | 5.83e-04 | 3.38e-02 | NA | NA |
| 5. P | Q0P4Y1 | Histidine N-acetyltransferase | 7.85e-03 | 6.40e-22 | NA | NA |
| 5. P | D2B7W7 | Mycothiol acetyltransferase | 1.23e-03 | 3.93e-05 | NA | NA |
| 5. P | D1BE23 | Mycothiol acetyltransferase | 2.07e-03 | 6.29e-04 | NA | NA |
| 5. P | B1MI19 | Mycothiol acetyltransferase | 1.31e-03 | 1.85e-05 | NA | NA |
| 5. P | D0L3V5 | Mycothiol acetyltransferase | 4.48e-05 | 1.02e-02 | NA | NA |
| 5. P | Q0RS64 | Mycothiol acetyltransferase | 1.69e-03 | 5.62e-03 | NA | NA |
| 5. P | C7QKH8 | Mycothiol acetyltransferase | 7.92e-04 | 3.92e-03 | NA | NA |
| 5. P | A6W6C7 | Mycothiol acetyltransferase | 2.76e-04 | 4.16e-02 | NA | NA |
| 5. P | A3Q695 | Mycothiol acetyltransferase | 3.31e-03 | 1.41e-03 | NA | NA |
| 5. P | Q47LA0 | Mycothiol acetyltransferase | 1.17e-03 | 1.24e-02 | NA | NA |
| 5. P | Q82G40 | Mycothiol acetyltransferase | 1.35e-03 | 2.56e-04 | NA | NA |
| 5. P | D2Q187 | Mycothiol acetyltransferase | 2.32e-03 | 1.30e-02 | NA | NA |
| 5. P | B1VII5 | Mycothiol acetyltransferase | 2.35e-05 | 3.46e-04 | NA | NA |
| 5. P | Q2JFW4 | Mycothiol acetyltransferase | 1.85e-03 | 3.37e-03 | NA | NA |
| 5. P | A4T7H0 | Mycothiol acetyltransferase | 6.86e-04 | 8.95e-03 | NA | NA |
| 5. P | D6Y4C5 | Mycothiol acetyltransferase | 7.40e-04 | 2.46e-03 | NA | NA |
| 5. P | P53265 | Uncharacterized protein YGR111W | 5.10e-04 | 5.51e-15 | NA | NA |
| 5. P | C3PIU4 | Mycothiol acetyltransferase | 9.58e-05 | 3.69e-04 | NA | NA |
| 5. P | A8LDL3 | Mycothiol acetyltransferase | 9.26e-04 | 1.30e-04 | NA | NA |
| 5. P | Q8N8M0 | Probable N-acetyltransferase 16 | 6.01e-03 | 3.37e-06 | NA | NA |
| 5. P | D7C376 | Mycothiol acetyltransferase | 5.67e-04 | 3.17e-03 | NA | NA |
| 5. P | Q5EDG0 | Mycothiol acetyltransferase | 2.59e-03 | 1.17e-06 | NA | NA |
| 5. P | Q5UR64 | Putative glycylpeptide N-tetradecanoyltransferase | NA | 5.24e-12 | NA | NA |
| 5. P | C5C246 | Mycothiol acetyltransferase | 8.24e-05 | 3.17e-03 | NA | NA |
| 5. P | Q09318 | Uncharacterized protein F36G3.2 | 1.34e-04 | 1.12e-23 | NA | NA |
| 5. P | C9ZFL1 | Mycothiol acetyltransferase | 1.62e-03 | 5.90e-04 | NA | NA |
| 5. P | C7NK43 | Mycothiol acetyltransferase | 7.04e-04 | 2.50e-04 | NA | NA |
| 5. P | Q5Z297 | Mycothiol acetyltransferase | 1.81e-03 | 6.99e-03 | NA | NA |
| 5. P | D1A4F4 | Mycothiol acetyltransferase | 8.93e-04 | 9.40e-03 | NA | NA |
| 5. P | C6WPR7 | Mycothiol acetyltransferase | 1.23e-03 | 6.21e-03 | NA | NA |
| 5. P | C8XA55 | Mycothiol acetyltransferase | 5.91e-03 | 7.91e-06 | NA | NA |
| 5. P | P9WJM7 | Mycothiol acetyltransferase | 2.24e-03 | 2.33e-05 | NA | NA |
| 5. P | Q46840 | Protein YghO | 3.07e-03 | 3.97e-05 | NA | NA |
| 5. P | Q1B3A6 | Mycothiol acetyltransferase | 3.38e-03 | 1.98e-03 | NA | NA |
| 5. P | A0LWI8 | Mycothiol acetyltransferase | 7.14e-04 | 4.82e-05 | NA | NA |
| 5. P | D2NRH2 | Mycothiol acetyltransferase | 1.01e-02 | 9.77e-06 | NA | NA |
| 5. P | Q8FMN5 | Mycothiol acetyltransferase | 6.25e-04 | 1.95e-02 | NA | NA |
| 5. P | O64815 | Probable N-acetyltransferase HLS1-like | 1.45e-03 | 3.73e-15 | NA | NA |
| 5. P | Q42381 | Probable N-acetyltransferase HLS1 | 3.12e-03 | 9.49e-14 | NA | NA |
| 5. P | A4ZHT6 | Mycothiol acetyltransferase | 1.11e-03 | 4.83e-02 | NA | NA |
| 5. P | B1VS15 | Mycothiol acetyltransferase | 1.05e-03 | 2.29e-04 | NA | NA |
| 5. P | Q7U173 | Mycothiol acetyltransferase | 2.24e-03 | 2.33e-05 | NA | NA |
| 5. P | A4FQD4 | Mycothiol acetyltransferase | 1.81e-03 | 2.91e-04 | NA | NA |
| 5. P | B8HD44 | Mycothiol acetyltransferase | 1.96e-03 | 5.70e-05 | NA | NA |
| 6. F | P50348 | Nodulation protein A | 2.96e-02 | NA | NA | 0.5743 |
| 6. F | Q7A447 | Lipid II:glycine glycyltransferase | 1.37e-02 | NA | NA | 0.3237 |
| 6. F | Q6CMK4 | Glycylpeptide N-tetradecanoyltransferase | 2.44e-04 | NA | NA | 0.3963 |
| 6. F | O74234 | Glycylpeptide N-tetradecanoyltransferase | 2.99e-03 | NA | NA | 0.397 |
| 6. F | Q82CC3 | Uncharacterized N-acetyltransferase SAV_5428 | 9.15e-05 | NA | NA | 0.4496 |
| 6. F | Q54238 | Uncharacterized N-acetyltransferase ORF5 | 2.80e-04 | NA | NA | 0.3841 |
| 6. F | Q9AMZ0 | Nodulation protein A | 8.33e-03 | NA | NA | 0.4642 |
| 6. F | P02962 | Nodulation protein A | 3.62e-02 | NA | NA | 0.5591 |
| 6. F | Q6GH31 | Aminoacyltransferase FemA | 5.23e-03 | NA | NA | 0.2863 |
| 6. F | Q5HG44 | Aminoacyltransferase FemB | 2.59e-03 | NA | NA | 0.2727 |
| 6. F | Q2YXZ5 | Aminoacyltransferase FemA | 5.67e-03 | NA | NA | 0.2911 |
| 6. F | Q6GH30 | Aminoacyltransferase FemB | 2.61e-03 | NA | NA | 0.2729 |
| 6. F | Q53252 | Nodulation protein A | 1.13e-03 | NA | NA | 0.5896 |
| 6. F | Q99UA7 | Aminoacyltransferase FemA | 5.18e-03 | NA | NA | 0.2878 |
| 6. F | Q9KL03 | Spermidine N(1)-acetyltransferase | 2.75e-03 | NA | NA | 0.5552 |
| 6. F | Q52839 | Nodulation protein A | 4.89e-02 | NA | NA | 0.4603 |
| 6. F | P0A0A4 | Aminoacyltransferase FemA | 5.22e-03 | NA | NA | 0.336 |
| 6. F | B1VS51 | Uncharacterized N-acetyltransferase SGR_3976 | 2.81e-04 | NA | NA | 0.3808 |
| 6. F | D1BV84 | Mycothiol acetyltransferase | 1.70e-03 | NA | NA | 0.4248 |
| 6. F | Q5HG59 | Phosphatidylglycerol lysyltransferase | 9.46e-02 | NA | NA | 0.3071 |
| 6. F | Q99UB9 | Phosphatidylglycerol lysyltransferase | 9.75e-02 | NA | NA | 0.3323 |
| 6. F | Q9EY50 | UDP-N-acetylmuramoylpentapeptide-lysine N(6)-alanyltransferase | 2.95e-05 | NA | NA | 0.3644 |
| 6. F | P54564 | UPF0157 protein YqkA | 1.08e-02 | NA | NA | 0.4557 |
| 6. F | P0A0A6 | Aminoacyltransferase FemB | 7.09e-03 | NA | NA | 0.2733 |
| 6. F | Q8VVF0 | Nodulation protein A | 1.28e-03 | NA | NA | 0.6261 |
| 6. F | P0CP21 | Glycylpeptide N-tetradecanoyltransferase | 1.22e-02 | NA | NA | 0.4473 |
| 6. F | Q75EK2 | Glycylpeptide N-tetradecanoyltransferase | 1.73e-03 | NA | NA | 0.4044 |
| 6. F | Q8TYZ5 | tRNA(Met) cytidine acetyltransferase TmcA | 1.17e-01 | NA | NA | 0.4991 |
| 6. F | Q6GH45 | Phosphatidylglycerol lysyltransferase | 9.49e-02 | NA | NA | 0.3152 |
| 6. F | Q9K4F4 | Uncharacterized N-acetyltransferase SCO4186 | 2.78e-05 | NA | NA | 0.4928 |
| 6. F | Q6C7G2 | Glycylpeptide N-tetradecanoyltransferase | 4.19e-04 | NA | NA | 0.4272 |
| 6. F | Q756G9 | Histone acetyltransferase GCN5 | 2.07e-02 | NA | NA | 0.6322 |
| 6. F | P31717 | Glycylpeptide N-tetradecanoyltransferase 1 | 5.12e-03 | NA | NA | 0.4272 |
| 6. F | Q8ILW6 | Glycylpeptide N-tetradecanoyltransferase | 8.98e-04 | NA | NA | 0.4122 |
| 6. F | P63418 | Uncharacterized N-acetyltransferase YhbS | 9.01e-06 | NA | NA | 0.6211 |
| 6. F | P39152 | Uncharacterized protein YwlB | 1.03e-03 | NA | NA | 0.6358 |
| 6. F | P72329 | Nodulation protein A | 4.24e-02 | NA | NA | 0.5102 |
| 6. F | Q9AIV3 | Phosphatidylglycerol lysyltransferase | 9.45e-02 | NA | NA | 0.3379 |
| 6. F | P34809 | Glycylpeptide N-tetradecanoyltransferase | 1.06e-02 | NA | NA | 0.4517 |
| 6. F | P04338 | Nodulation protein A | 3.07e-02 | NA | NA | 0.6222 |
| 6. F | Q6G9I4 | Aminoacyltransferase FemB | 7.42e-03 | NA | NA | 0.2726 |
| 6. F | P95735 | Aminoacyltransferase FemB | 6.06e-03 | NA | NA | 0.2784 |
| 6. F | Q52424 | Aminoglycoside 2'-N-acetyltransferase | 4.41e-04 | NA | NA | 0.7442 |
| 6. F | P0A0A5 | Aminoacyltransferase FemA | 5.52e-03 | NA | NA | 0.3381 |
| 6. F | Q7S3C8 | Glycylpeptide N-tetradecanoyltransferase | 1.39e-02 | NA | NA | 0.3951 |
| 6. F | Q4L667 | Phosphatidylglycerol lysyltransferase | 9.96e-02 | NA | NA | 0.2755 |
| 6. F | Q8TFN1 | Glycylpeptide N-tetradecanoyltransferase | 1.71e-03 | NA | NA | 0.4215 |
| 6. F | Q7A5R3 | Aminoacyltransferase FemA | 5.56e-03 | NA | NA | 0.2894 |
| 6. F | Q6G9J9 | Phosphatidylglycerol lysyltransferase | 9.66e-02 | NA | NA | 0.336 |
| 6. F | Q5HG45 | Aminoacyltransferase FemA | 2.09e-04 | NA | NA | 0.3388 |
| 6. F | Q8WZM0 | Histone acetyltransferase GCN5 | 2.11e-02 | NA | NA | 0.6654 |
| 6. F | Q4PB56 | Glycylpeptide N-tetradecanoyltransferase | 2.46e-02 | NA | NA | 0.4386 |
| 6. F | Q93QY7 | Phosphatidylglycerol lysyltransferase | 9.63e-02 | NA | NA | 0.3351 |
| 6. F | Q6FTW5 | Histone acetyltransferase GCN5 | 6.99e-02 | NA | NA | 0.6609 |
| 6. F | Q2YXZ4 | Aminoacyltransferase FemB | 6.53e-03 | NA | NA | 0.2765 |
| 6. F | P34763 | Glycylpeptide N-tetradecanoyltransferase | 1.48e-03 | NA | NA | 0.4494 |
| 6. F | Q6BGW1 | Histone acetyltransferase GCN5 | 2.39e-02 | NA | NA | 0.6373 |
| 6. F | Q8VVH1 | Nodulation protein A | 3.77e-02 | NA | NA | 0.5607 |
| 6. F | Q9UVX3 | Glycylpeptide N-tetradecanoyltransferase | 7.84e-03 | NA | NA | 0.4401 |
| 6. F | D2S4P5 | Mycothiol acetyltransferase | 7.18e-04 | NA | NA | 0.468 |
| 6. F | Q5HPG5 | Aminoacyltransferase FemB | 6.54e-03 | NA | NA | 0.2771 |
| 6. F | B0RAV5 | Mycothiol acetyltransferase | 3.47e-04 | NA | NA | 0.4567 |
| 6. F | P95734 | Aminoacyltransferase FemA | 6.04e-03 | NA | NA | 0.3253 |
| 6. F | Q4I061 | Glycylpeptide N-tetradecanoyltransferase | 6.47e-03 | NA | NA | 0.453 |
| 6. F | Q5RAF3 | Glycylpeptide N-tetradecanoyltransferase 1 | 5.09e-03 | NA | NA | 0.4325 |
| 6. F | P50347 | Nodulation protein A | 9.33e-03 | NA | NA | 0.6239 |
| 6. F | Q6G9I5 | Aminoacyltransferase FemA | 5.42e-03 | NA | NA | 0.3338 |
| 6. F | Q7A2M4 | Lipid II:glycine glycyltransferase | 1.38e-02 | NA | NA | 0.3237 |
| 6. F | Q82G74 | Uncharacterized N-acetyltransferase SAV_4024 | 2.14e-04 | NA | NA | 0.4379 |
| 6. F | O05517 | Putative [ribosomal protein S18]-alanine N-acetyltransferase | 1.71e-05 | NA | NA | 0.6247 |
| 6. F | P04673 | Nodulation protein A | 3.62e-02 | NA | NA | 0.565 |
| 6. F | D6ZEJ5 | Mycothiol acetyltransferase | 2.55e-03 | NA | NA | 0.3498 |
| 6. F | P50349 | Nodulation protein A | 3.22e-02 | NA | NA | 0.6447 |
| 6. F | P0A0A7 | Aminoacyltransferase FemB | 2.15e-03 | NA | NA | 0.2716 |
| 6. F | Q8NWU7 | Phosphatidylglycerol lysyltransferase | 9.76e-02 | NA | NA | 0.3373 |
| 6. F | Q7A5R9 | Phosphatidylglycerol lysyltransferase | 9.47e-02 | NA | NA | 0.3054 |
| 6. F | P04674 | Nodulation protein A | 1.16e-03 | NA | NA | 0.6045 |
| 6. F | A1TFB7 | Mycothiol acetyltransferase | 1.78e-03 | NA | NA | 0.4197 |
| 6. F | Q8CNE9 | Lipid II:glycine glycyltransferase | 4.57e-03 | NA | NA | 0.3066 |
| 6. F | D0JFM7 | tRNA(Met) cytidine acetyltransferase TmcA | 3.47e-02 | NA | NA | 0.5129 |
| 6. F | Q9F309 | Uncharacterized N-acetyltransferase SCO2625 | 4.62e-04 | NA | NA | 0.4185 |
| 6. F | Q9RAN9 | Nodulation protein A | 1.44e-03 | NA | NA | 0.5663 |
| 6. F | Q6BJF4 | Glycylpeptide N-tetradecanoyltransferase | 2.66e-03 | NA | NA | 0.3812 |
| 6. F | Q9F0C9 | Nodulation protein A | 1.34e-03 | NA | NA | 0.6218 |
| 6. F | Q9N181 | Glycylpeptide N-tetradecanoyltransferase 2 | 6.19e-03 | NA | NA | 0.4159 |
| 6. F | Q8CPA9 | Aminoacyltransferase FemA | 5.16e-03 | NA | NA | 0.3296 |
| 6. F | P50326 | Nodulation protein A | 1.33e-03 | NA | NA | 0.6291 |
| 6. F | Q07739 | Nodulation protein A | 9.76e-03 | NA | NA | 0.5449 |
| 6. F | P9WQG8 | Aminoglycoside 2'-N-acetyltransferase | 3.82e-04 | NA | NA | 0.7404 |
| 6. F | A5CTZ8 | Mycothiol acetyltransferase | 5.06e-04 | NA | NA | 0.4328 |
| 6. F | Q49157 | Aminoglycoside 2'-N-acetyltransferase | 7.49e-04 | NA | NA | 0.7591 |
| 6. F | A1RY08 | tRNA(Met) cytidine acetyltransferase TmcA | 1.06e-01 | NA | NA | 0.3994 |
| 6. F | P0A5N1 | Aminoglycoside 2'-N-acetyltransferase | 3.82e-04 | NA | NA | 0.7402 |
| 6. F | P0CP20 | Glycylpeptide N-tetradecanoyltransferase | 1.23e-02 | NA | NA | 0.4468 |
| 6. F | Q5HPG6 | Aminoacyltransferase FemA | 4.44e-03 | NA | NA | 0.3214 |
| 6. F | Q8NWU0 | Aminoacyltransferase FemB | 6.94e-03 | NA | NA | 0.2769 |
| 6. F | P24154 | Nodulation protein A | 2.68e-03 | NA | NA | 0.489 |
| 6. F | P63419 | Uncharacterized N-acetyltransferase YhbS | 9.81e-06 | NA | NA | 0.6348 |
| 6. F | P21340 | Spermidine/spermine N(1)-acetyltransferase | 1.33e-03 | NA | NA | 0.508 |
| 6. F | P0A0A8 | Aminoacyltransferase FemB | 6.73e-03 | NA | NA | 0.2639 |
| 6. F | Q6CXW4 | Histone acetyltransferase GCN5 | 3.25e-02 | NA | NA | 0.6412 |