Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54640.1
JCVISYN3A_0146
Uncharacterized protein.
M. mycoides homolog: Q6MU84.
TIGRfam Classification: 1=Unknown.
Category: Essential.
Statistics
Total GO Annotation: 35
Unique PROST Go: 35
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 80
Unique PROST Homologs: 80
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Literature
Danchin and Fang [1]: NA
Yang and Tsui [2]: Glycerol uptake facilitator protein GlpF
Antczak et al. [3]: Transmembrane protein, not a transporter
Zhang et al. [4]: GO:0005576|extracellular region
Bianchi et al. [5]: "possible ywnG-like, genome locality to acetyltranferase and structure similarity"
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
B7NZC7
(Tumor necrosis factor alpha-induced protein 8-like protein 2) with a FATCAT P-Value: 5.44e-05 and RMSD of 2.21 angstrom. The sequence alignment identity is 16.2%.
Structural alignment shown in left. Query protein AVX54640.1 colored as red in alignment, homolog B7NZC7 colored as blue.
Query protein AVX54640.1 is also shown in right top, homolog B7NZC7 showed in right bottom. They are colored based on secondary structures.
AVX54640.1 MKRKIIKKNLAL-VKKK-------R----LFLDFLKNNQLEDIY-L-KN-TDFNKKSNILLNNFI-IILKINNLNYKNFWANISFINFCIYYLYHKFYKS 84 B7NZC7 M-ESFSSKSLALQAEKKLLSKMVGRSAAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAVKVAVLHRSG----------C-------FGPS 82 AVX54640.1 -LS-----EQKLNQINLTIKKIATNRKYNSLDINYEKQLIE--IAKQYDIKFSTDFINTYF--NNH-QIYHYISNSFS---L---MFEND-KKMLAYSYC 166 B7NZC7 ELALATRFRQKLRQGAMT----ALS--FGEVDFTFEAAVLAGLLTECRDVLL--ELVENHLTPKSHGRIRH-VFDHFSDPGLLTALYGPDFTQHLG-KIC 172 AVX54640.1 YWLILFIYIKKYL---SLQLNYKYSYSLFNLEMICNENYIKNIKQLTPIFFNLLIMKNNKWISKLDIKRKKK 235 B7NZC7 DGL------RKLLEEGKL------------------------------------------------------ 184
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0006744 | ubiquinone biosynthetic process |
| 5. P | GO:0000002 | mitochondrial genome maintenance |
| 5. P | GO:0016817 | hydrolase activity, acting on acid anhydrides |
| 5. P | GO:0031314 | extrinsic component of mitochondrial inner membrane |
| 5. P | GO:0044201 | host cell nuclear inner membrane |
| 5. P | GO:0070402 | NADPH binding |
| 5. P | GO:0039695 | DNA-templated viral transcription |
| 5. P | GO:0051259 | protein complex oligomerization |
| 5. P | GO:0050868 | negative regulation of T cell activation |
| 5. P | GO:0045087 | innate immune response |
| 5. P | GO:0010024 | phytochromobilin biosynthetic process |
| 5. P | GO:0050797 | thymidylate synthase (FAD) activity |
| 5. P | GO:0005739 | mitochondrion |
| 5. P | GO:0006235 | dTTP biosynthetic process |
| 5. P | GO:0050660 | flavin adenine dinucleotide binding |
| 5. P | GO:0050728 | negative regulation of inflammatory response |
| 5. P | GO:0046765 | viral budding from nuclear membrane |
| 5. P | GO:0039660 | structural constituent of virion |
| 5. P | GO:0099617 | matrix side of mitochondrial inner membrane |
| 5. P | GO:0042981 | regulation of apoptotic process |
| 5. P | GO:0043093 | FtsZ-dependent cytokinesis |
| 5. P | GO:0005198 | structural molecule activity |
| 5. P | GO:0006457 | protein folding |
| 5. P | GO:0039679 | viral occlusion body |
| 5. P | GO:0039686 | bidirectional double-stranded viral DNA replication |
| 5. P | GO:0032259 | methylation |
| 5. P | GO:0019069 | viral capsid assembly |
| 5. P | GO:0042410 | 6-carboxyhexanoate-CoA ligase activity |
| 5. P | GO:0006231 | dTMP biosynthetic process |
| 5. P | GO:0060153 | modulation by virus of host cell cycle |
| 5. P | GO:0033645 | host cell endomembrane system |
| 5. P | GO:0019031 | viral envelope |
| 5. P | GO:0097745 | mitochondrial tRNA 5'-end processing |
| 5. P | GO:0004799 | thymidylate synthase activity |
| 5. P | GO:0050620 | phycocyanobilin:ferredoxin oxidoreductase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | Q10082 | Uncharacterized protein C11D3.03c | 9.52e-01 | 1.61e-05 | NA | NA |
| 5. P | Q77D96 | Matrix protein | NA | 1.05e-02 | NA | NA |
| 5. P | P39267 | Uncharacterized protein YjcZ | 6.38e-03 | 3.20e-03 | NA | NA |
| 5. P | B1L944 | Flavin-dependent thymidylate synthase | 4.94e-02 | 9.41e-03 | NA | NA |
| 5. P | Q01032 | Uncharacterized gene 49 protein | NA | 1.46e-02 | NA | NA |
| 5. P | B5FEZ9 | Chaperone protein TorD | 1.81e-03 | 4.71e-02 | NA | NA |
| 5. P | P52548 | Protein U52 | NA | 3.32e-05 | NA | NA |
| 5. P | A3D7I1 | Chaperone protein TorD | 9.58e-04 | 6.99e-03 | NA | NA |
| 5. P | Q775T6 | 27 kDa core protein | NA | 4.51e-02 | NA | NA |
| 5. P | A6WTC8 | Cell division protein ZapD | 1.23e-02 | 1.47e-03 | NA | NA |
| 5. P | Q91B74 | Granulin | NA | 7.69e-03 | NA | NA |
| 5. P | P52349 | Triplex capsid protein 1 | NA | 2.16e-02 | NA | NA |
| 5. P | Q6P589 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 2.03e-04 | 8.47e-03 | NA | NA |
| 5. P | O41156 | Probable flavin-dependent thymidylate synthase | NA | 1.64e-02 | NA | NA |
| 5. P | Q9JAF2 | Granulin | NA | 4.01e-03 | NA | NA |
| 5. P | P21036 | Protein C1 | NA | 1.25e-03 | NA | NA |
| 5. P | B8E665 | Cell division protein ZapD | 1.23e-02 | 1.10e-03 | NA | NA |
| 5. P | P52361 | Nuclear egress protein 1 | NA | 2.62e-02 | NA | NA |
| 5. P | Q93TL5 | Phycocyanobilin:ferredoxin oxidoreductase | 3.37e-02 | 2.85e-02 | NA | NA |
| 5. P | B2KI57 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 6.68e-05 | 2.96e-02 | NA | NA |
| 5. P | Q9KRC2 | Chaperone protein TorD | 8.47e-04 | 2.30e-02 | NA | NA |
| 5. P | Q729U4 | Flavin-dependent thymidylate synthase | 2.66e-02 | 9.24e-04 | NA | NA |
| 5. P | P17368 | Protein C1 | NA | 5.76e-03 | NA | NA |
| 5. P | Q47CW9 | Perchlorate reductase assembly chaperone protein | 4.60e-04 | 1.06e-02 | NA | NA |
| 5. P | P41702 | Occlusion-derived virus envelope protein E27 | NA | 1.71e-03 | NA | NA |
| 5. P | Q09526 | Uncharacterized protein E02H1.5 | 8.02e-03 | 1.15e-02 | NA | NA |
| 5. P | P06503 | Granulin | NA | 2.90e-02 | NA | NA |
| 5. P | B0WH96 | Ubiquinone biosynthesis protein COQ4 homolog 1, mitochondrial | 6.30e-02 | 7.77e-03 | NA | NA |
| 5. P | O14106 | Protein rgg8 | 2.71e-02 | 1.15e-02 | NA | NA |
| 5. P | B7NZC7 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 5.44e-05 | 4.98e-02 | NA | NA |
| 5. P | O12705 | Granulin | NA | 3.89e-02 | NA | NA |
| 5. P | P33859 | Protein C1 | NA | 2.51e-05 | NA | NA |
| 5. P | Q4J6F2 | Flavin-dependent thymidylate synthase | 4.13e-02 | 2.85e-02 | NA | NA |
| 5. P | A5IJX2 | Flavin-dependent thymidylate synthase | 4.98e-02 | 9.14e-03 | NA | NA |
| 5. P | Q82K86 | Flavin-dependent thymidylate synthase | 5.41e-02 | 1.46e-06 | NA | NA |
| 5. P | Q45UF4 | Non-structural protein 2 | NA | 3.89e-02 | NA | NA |
| 5. P | P13342 | DNA helicase assembly protein | NA | 9.77e-06 | NA | NA |
| 5. P | P0DSQ0 | Intermediate transcription factor 3 small subunit | NA | 7.01e-04 | NA | NA |
| 5. P | O18559 | Granulin | NA | 3.46e-04 | NA | NA |
| 5. P | A9KZ67 | Chaperone protein TorD | 1.29e-03 | 3.49e-02 | NA | NA |
| 5. P | P68719 | Intermediate transcription factor 3 small subunit | NA | 3.65e-02 | NA | NA |
| 5. P | Q1HPV1 | Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial | 7.33e-03 | 4.80e-02 | NA | NA |
| 5. P | P87577 | Granulin | NA | 3.90e-03 | NA | NA |
| 5. P | Q66112 | Granulin | NA | 3.79e-03 | NA | NA |
| 5. P | Q5E4I0 | Chaperone protein TorD | 1.63e-03 | 1.57e-02 | NA | NA |
| 5. P | Q6BXG1 | Mediator of RNA polymerase II transcription subunit 20 | 5.47e-01 | 1.91e-02 | NA | NA |
| 5. P | A6LP90 | Flavin-dependent thymidylate synthase | 4.43e-02 | 1.12e-04 | NA | NA |
| 5. P | C8ZD61 | Genetic interactor of prohibitin 5, mitochondrial | 1.95e-02 | 2.37e-02 | NA | NA |
| 5. P | A9X192 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 2.27e-04 | 6.53e-03 | NA | NA |
| 5. P | C3LN43 | Chaperone protein TorD | 7.29e-04 | 2.82e-02 | NA | NA |
| 5. P | B0KWC3 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 1.44e-04 | 7.08e-04 | NA | NA |
| 5. P | Q9D8Y7 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 2.20e-04 | 7.55e-03 | NA | NA |
| 5. P | Q9P799 | Uncharacterized protein P35G2.04c | 1.50e-04 | 2.57e-06 | NA | NA |
| 5. P | B8CSN6 | Chaperone protein TorD | 7.01e-04 | 1.91e-02 | NA | NA |
| 5. P | B6EH87 | Chaperone protein TorD | 1.43e-03 | 1.55e-02 | NA | NA |
| 5. P | P0DSP9 | Intermediate transcription factor 3 small subunit | NA | 7.01e-04 | NA | NA |
| 5. P | A5WBY3 | Chaperone protein TorD | 6.05e-04 | 3.97e-02 | NA | NA |
| 5. P | P52469 | Protein U52 | NA | 1.31e-02 | NA | NA |
| 5. P | Q5CT19 | Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial | 1.08e-01 | 3.43e-02 | NA | NA |
| 5. P | B9KBK3 | Flavin-dependent thymidylate synthase | 6.10e-02 | 2.37e-02 | NA | NA |
| 5. P | A8F7Q7 | Flavin-dependent thymidylate synthase | 4.35e-02 | 8.07e-07 | NA | NA |
| 5. P | P26001 | Nucleoprotein | NA | 4.67e-02 | NA | NA |
| 5. P | P20986 | Intermediate transcription factor 3 small subunit | NA | 4.83e-04 | NA | NA |
| 5. P | O86840 | Flavin-dependent thymidylate synthase | 2.68e-02 | 8.02e-09 | NA | NA |
| 5. P | C7GQR4 | Genetic interactor of prohibitin 5, mitochondrial | 8.97e-03 | 2.37e-02 | NA | NA |
| 5. P | Q3ZBK5 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 7.61e-05 | 5.12e-03 | NA | NA |
| 5. P | Q9WYT0 | Flavin-dependent thymidylate synthase | 5.04e-02 | 6.85e-03 | NA | NA |
| 5. P | Q8GPG2 | Dimethyl sulfide dehydrogenase assembly chaperone protein | 1.87e-03 | 1.48e-02 | NA | NA |
| 5. P | Q8V2R6 | 27 kDa core protein | NA | 4.51e-02 | NA | NA |
| 5. P | Q5UR23 | Uncharacterized protein L361 | NA | 2.75e-02 | NA | NA |
| 5. P | O87949 | Chaperone protein TorD | 8.23e-04 | 9.41e-03 | NA | NA |
| 5. P | Q6E0W8 | Matrix protein | NA | 1.95e-02 | NA | NA |
| 5. P | P52470 | Protein U52 | NA | 3.48e-06 | NA | NA |
| 5. P | A0E513 | Ubiquinone biosynthesis protein COQ4 homolog 2, mitochondrial | 1.87e-02 | 2.99e-03 | NA | NA |
| 5. P | A1S487 | Chaperone protein TorD | 1.40e-03 | 3.55e-02 | NA | NA |
| 5. P | P68720 | Intermediate transcription factor 3 small subunit | NA | 3.65e-02 | NA | NA |
| 5. P | Q6AYJ8 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 2.16e-04 | 6.26e-04 | NA | NA |
| 5. P | Q3A3Z7 | 6-carboxyhexanoate--CoA ligase | 3.50e-01 | 2.43e-02 | NA | NA |
| 5. P | Q12393 | Genetic interactor of prohibitin 5, mitochondrial | 1.33e-02 | 4.30e-02 | NA | NA |
| 5. P | B3LT59 | Genetic interactor of prohibitin 5, mitochondrial | 9.71e-03 | 2.37e-02 | NA | NA |