Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54641.1

JCVISYN3A_0147

Cardiolipin synthase.
M. mycoides homolog: Q6MU83.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 53
Unique PROST Go: 10
Unique BLAST Go: 9
Unique Foldseek Go: 25

Total Homologs: 187
Unique PROST Homologs: 8
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 49

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: cls; Cardiolipin synthetase
Zhang et al. [4]: GO:0008808|cardiolipin synthase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B1ITK7 (Cardiolipin synthase A) with a FATCAT P-Value: 0 and RMSD of 2.74 angstrom. The sequence alignment identity is 24.8%.
Structural alignment shown in left. Query protein AVX54641.1 colored as red in alignment, homolog B1ITK7 colored as blue. Query protein AVX54641.1 is also shown in right top, homolog B1ITK7 showed in right bottom. They are colored based on secondary structures.

  AVX54641.1 MKKLIITVLSLIFMFGLTIFGLLLLNIYFFNW-PLIGFGIFHLLAIIWAFIVLADKKRRFETRIRWFCFIVCIPIIGVLSYLFFG-------RSYK---- 88
      B1ITK7 -------------M--TTVYTLV-------SWLAILGYWL--LIAGVTLRILM--KRRAVPSAMAWLLIIYILPLVGIIAYLAVGELHLGKRRAERARAM 74

  AVX54641.1 YKITKNYKFL-EIQN-KH---SENELEQIDQILTNQIPQFKRAFKTASIS--QTNNIFLNTKVEFLENGNQLFLNLFKDIKNAKHYILLNFYIFKDGKLL 181
      B1ITK7 WPSTA--KWLNDLKACKHIFAEEN-----SSVAA---PLFKLCERRQGIAGVKGNQLQLMT-----ES-DDVMQALIRDIQLARHNIEMVFYIWQPGGMA 158

  AVX54641.1 DELTNLLIKKLKENVKVYIIYDFAGSYTLFEEAKIKLLEY-GCQIVCYAPI---RFPFIKWTANYRDHRKDIIIDNKIGYIGGINIGD-EYINLDNKFGY 276
      B1ITK7 DQVAESLMAAARRGIHCRLMLDSAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRV-FLR-RMDLRQHRKMIMIDNYIAYTGSMNMVDPRYFKQDAGVGQ 256

  AVX54641.1 WNDCSLKITGNAVSEIQRIFISDYDFYKPSFKKNSIKQDLDLDNVYSV-KCKDQLVQIVSSGPNHEEPL-HLSIFINLINSAQKRIWISTPYFIPPQEIR 374
      B1ITK7 WIDLMARMEGPIATAMGIIYSCDWEI---ETGKRILPPPPDV-NIMPFEQASGHTIHTIASGPGFPEDLIHQAL-LTAAYSAREYLIMTTPYFVPSDDLL 351

  AVX54641.1 TALINAANSKLDVRILIPGLTDKAFLLDQTKQW-TR----ELYKAGVKIYSI-NNVFNHNKTYLFDDEITFIGSTNLDFRALFAD-QQTMGLIYSKSLNK 467
      B1ITK7 HAICTAAQRGVDVSIILPRKND-SMLVG----WASRAFFTELLAAGVKIYQFEGGLL-HTKSVLVDGELSLVGTVNLDMRSLWLNFEITLA-IDDKGFGA 444

  AVX54641.1 TISNKFEQDF-KNSYLYD-HLPNKNINWFRKIVIKIYNIIQPLL 509
      B1ITK7 DLA-AVQDDYISRSRLLDARLWLKRPLW-QRVAERLFYFFSPLL 486

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0008808	cardiolipin synthase activity
1. PBF	GO:0004630	phospholipase D activity
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0032049	cardiolipin biosynthetic process
1. PBF	GO:0043934	sporulation
2. PF	GO:0008444	CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity
3. BF	GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity
4. PB	GO:0008654	phospholipid biosynthetic process
5. P	GO:0046339	diacylglycerol metabolic process
5. P	GO:0005783	endoplasmic reticulum
5. P	GO:0045335	phagocytic vesicle
5. P	GO:0045145	single-stranded DNA 5'-3' exodeoxyribonuclease activity
5. P	GO:0032588	trans-Golgi network membrane
5. P	GO:1900015	regulation of cytokine production involved in inflammatory response
5. P	GO:0002244	hematopoietic progenitor cell differentiation
5. P	GO:0006909	phagocytosis
5. P	GO:0008484	sulfuric ester hydrolase activity
5. P	GO:0006655	phosphatidylglycerol biosynthetic process
6. F	GO:0048017	inositol lipid-mediated signaling
6. F	GO:0006793	phosphorus metabolic process
6. F	GO:0006654	phosphatidic acid biosynthetic process
6. F	GO:1902808	positive regulation of cell cycle G1/S phase transition
6. F	GO:0007286	spermatid development
6. F	GO:0051321	meiotic cell cycle
6. F	GO:0006799	polyphosphate biosynthetic process
6. F	GO:0008053	mitochondrial fusion
6. F	GO:0051310	metaphase plate congression
6. F	GO:0046872	metal ion binding
6. F	GO:0003882	CDP-diacylglycerol-serine O-phosphatidyltransferase activity
6. F	GO:0016042	lipid catabolic process
6. F	GO:0043046	DNA methylation involved in gamete generation
6. F	GO:0005737	cytoplasm
6. F	GO:0008976	polyphosphate kinase activity
6. F	GO:0030719	P granule organization
6. F	GO:0034587	piRNA metabolic process
6. F	GO:0009358	polyphosphate kinase complex
6. F	GO:1902480	protein localization to mitotic spindle
6. F	GO:0035755	cardiolipin hydrolase activity
6. F	GO:0035091	phosphatidylinositol binding
6. F	GO:0004519	endonuclease activity
6. F	GO:0005741	mitochondrial outer membrane
6. F	GO:0046475	glycerophospholipid catabolic process
6. F	GO:0010636	positive regulation of mitochondrial fusion
7. B	GO:0016020	membrane
7. B	GO:0060176	regulation of aggregation involved in sorocarp development
7. B	GO:1901263	positive regulation of sorocarp spore cell differentiation
7. B	GO:0043327	chemotaxis to cAMP
7. B	GO:0090483	phosphatidylglycerol-phosphatidylethanolamine phosphatidyltransferase activity
7. B	GO:0048837	sorocarp sorus development
7. B	GO:0031941	filamentous actin
7. B	GO:0045921	positive regulation of exocytosis
7. B	GO:2000249	regulation of actin cytoskeleton reorganization

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0008808	cardiolipin synthase activity
GO:0006629	lipid metabolic process
GO:0016780	phosphotransferase activity, for other substituted phosphate groups
GO:0016021	integral component of membrane
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0032049	cardiolipin biosynthetic process
GO:0008654	phospholipid biosynthetic process
GO:0003824	catalytic activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	B0KR91	Cardiolipin synthase A	0.00e+00	3.42e-40	2.57e-59	0.8405
1. PBF	B2K3U5	Cardiolipin synthase A	0.00e+00	3.03e-32	2.50e-43	0.8234
1. PBF	P63802	Cardiolipin synthase	0.00e+00	6.90e-52	1.00e-59	0.8592
1. PBF	Q88C19	Cardiolipin synthase A	0.00e+00	1.07e-42	4.49e-59	0.8324
1. PBF	Q8EM16	Cardiolipin synthase	0.00e+00	3.12e-38	3.01e-61	0.8622
1. PBF	C3K1C4	Cardiolipin synthase A	0.00e+00	7.49e-40	6.83e-57	0.8372
1. PBF	Q5HMD3	Cardiolipin synthase 2	0.00e+00	7.74e-44	2.63e-60	0.8781
1. PBF	P57361	Cardiolipin synthase A	0.00e+00	1.21e-38	1.02e-41	0.7978
1. PBF	Q4K3D9	Cardiolipin synthase A	0.00e+00	4.90e-38	8.96e-57	0.8645
1. PBF	Q1C7R0	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.7973
1. PBF	Q81GK4	Cardiolipin synthase 2	0.00e+00	1.20e-63	2.79e-73	0.8543
1. PBF	B8D966	Cardiolipin synthase A	0.00e+00	7.50e-38	2.59e-41	0.8198
1. PBF	Q5HPM5	Cardiolipin synthase 1	0.00e+00	1.32e-48	2.02e-64	0.858
1. PBF	B5YYF4	Cardiolipin synthase A	0.00e+00	2.31e-31	1.26e-40	0.8166
1. PBF	P45865	Minor cardiolipin synthase ClsB	0.00e+00	5.15e-12	3.23e-41	0.8553
1. PBF	B1JKT9	Cardiolipin synthase A	0.00e+00	1.11e-32	2.34e-44	0.7996
1. PBF	B7LS29	Cardiolipin synthase A	0.00e+00	1.49e-33	3.36e-41	0.8236
1. PBF	Q83RM8	Cardiolipin synthase A	0.00e+00	1.41e-31	1.26e-40	0.8302
1. PBF	Q89AL5	Cardiolipin synthase A	0.00e+00	8.61e-35	5.16e-48	0.8198
1. PBF	Q9HTH0	Cardiolipin synthase A	0.00e+00	4.65e-36	5.42e-58	0.817
1. PBF	Q81I00	Cardiolipin synthase 1	0.00e+00	1.15e-58	1.08e-76	0.8349
1. PBF	B8DBK8	Cardiolipin synthase	0.00e+00	2.03e-38	4.68e-68	0.8866
1. PBF	Q02DW8	Cardiolipin synthase A	0.00e+00	4.65e-36	5.42e-58	0.8116
1. PBF	A8AG50	Cardiolipin synthase A	0.00e+00	4.87e-33	1.00e-40	0.8197
1. PBF	A9R8K8	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.82
1. PBF	B1XAT9	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.82
1. PBF	Q5HEB2	Cardiolipin synthase 2	0.00e+00	6.90e-52	1.00e-59	0.8649
1. PBF	P63801	Cardiolipin synthase	0.00e+00	6.90e-52	1.00e-59	0.8578
1. PBF	Q1CJ46	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.8304
1. PBF	B7MU36	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8178
1. PBF	Q8K9P9	Cardiolipin synthase A	0.00e+00	1.68e-37	4.37e-42	0.8222
1. PBF	C5D794	Cardiolipin synthase	0.00e+00	6.54e-60	2.02e-80	0.8304
1. PBF	C4ZTU1	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8233
1. PBF	A4WB84	Cardiolipin synthase A	0.00e+00	2.73e-32	1.16e-39	0.8355
1. PBF	C5BDA3	Cardiolipin synthase A	0.00e+00	5.77e-33	1.86e-38	0.814
1. PBF	Q8ZEI2	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.818
1. PBF	C1KYS0	Cardiolipin synthase	0.00e+00	2.67e-38	3.25e-67	0.8799
1. PBF	P34001	Uncharacterized protein SMU_988	0.00e+00	1.86e-23	1.49e-53	0.9006
1. PBF	A7ZL20	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8052
1. PBF	Q81TR2	Cardiolipin synthase 2	0.00e+00	1.58e-64	3.07e-73	0.8427
1. PBF	B4TX53	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8225
1. PBF	Q1RCI7	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8009
1. PBF	Q5HGA3	Cardiolipin synthase 1	0.00e+00	2.64e-52	3.82e-64	0.8544
1. PBF	A9MPD5	Cardiolipin synthase A	0.00e+00	1.95e-32	1.63e-39	0.8186
1. PBF	Q1I2L0	Cardiolipin synthase A	0.00e+00	8.12e-44	5.21e-60	0.8418
1. PBF	B5R6L2	Cardiolipin synthase A	0.00e+00	1.18e-32	2.06e-39	0.8005
1. PBF	Q927Z0	Cardiolipin synthase	0.00e+00	3.34e-38	1.02e-66	0.8732
1. PBF	Q0TIC2	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8424
1. PBF	Q6G7M2	Cardiolipin synthase	0.00e+00	6.90e-52	1.00e-59	0.8502
1. PBF	Q31ZU1	Cardiolipin synthase A	0.00e+00	5.90e-32	1.18e-40	0.8018
1. PBF	Q71WS5	Cardiolipin synthase	0.00e+00	2.67e-38	3.25e-67	0.8887
1. PBF	B5XQA9	Cardiolipin synthase A	0.00e+00	6.28e-33	6.19e-43	0.8105
1. PBF	B7ML01	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8175
1. PBF	A8GFA0	Cardiolipin synthase A	0.00e+00	1.15e-33	1.42e-43	0.8296
1. PBF	P63800	Cardiolipin synthase	0.00e+00	6.90e-52	1.00e-59	0.8628
1. PBF	C0Q393	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8117
1. PBF	P31048	Cardiolipin synthase A	0.00e+00	2.33e-43	6.49e-62	0.8366
1. PBF	A1AAH3	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.829
1. PBF	B4EWI7	Cardiolipin synthase A	0.00e+00	1.62e-35	2.55e-43	0.7974
1. PBF	A9MWP9	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8256
1. PBF	A1JQ40	Cardiolipin synthase A	0.00e+00	4.99e-32	2.84e-41	0.8161
1. PBF	B1LH51	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8396
1. PBF	Q57NS0	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.82
1. PBF	Q6GEY7	Cardiolipin synthase 2	0.00e+00	4.33e-52	1.00e-59	0.8571
1. PBF	Q8XCC6	Cardiolipin synthase A	0.00e+00	2.31e-31	1.26e-40	0.8061
1. PBF	P71040	Major cardiolipin synthase ClsA	0.00e+00	3.19e-38	1.05e-66	0.8839
1. PBF	A0ALI7	Cardiolipin synthase	0.00e+00	7.85e-38	6.94e-67	0.8725
1. PBF	Q81V75	Cardiolipin synthase 1	0.00e+00	9.91e-60	6.51e-79	0.8051
1. PBF	B7N460	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8108
1. PBF	B6I9W2	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8357
1. PBF	P63798	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8059
1. PBF	Q0ST20	Cardiolipin synthase	0.00e+00	1.21e-38	8.59e-56	0.8901
1. PBF	B8D7H0	Cardiolipin synthase A	0.00e+00	7.50e-38	2.59e-41	0.8511
1. PBF	P63799	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8056
1. PBF	B1ITK7	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.822
1. PBF	B7V5T6	Cardiolipin synthase A	0.00e+00	4.65e-36	5.42e-58	0.8144
1. PBF	B4SUC9	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8237
1. PBF	B7UQD9	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8073
1. PBF	Q3Z0W3	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8243
1. PBF	B7LHJ4	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8187
1. PBF	B1JFN5	Cardiolipin synthase A	0.00e+00	3.84e-43	1.92e-59	0.8435
1. PBF	P0A6H9	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8209
1. PBF	A4IL76	Cardiolipin synthase	0.00e+00	5.05e-59	8.88e-69	0.8588
1. PBF	Q8D2I8	Cardiolipin synthase A	2.33e-15	1.79e-39	4.26e-41	0.8163
1. PBF	A6TAJ7	Cardiolipin synthase A	0.00e+00	3.94e-33	1.47e-42	0.8076
1. PBF	Q8Y4E3	Cardiolipin synthase	0.00e+00	2.67e-38	3.25e-67	0.8533
1. PBF	A7MNA4	Cardiolipin synthase A	0.00e+00	7.27e-33	5.02e-41	0.8225
1. PBF	P0C2E2	Cardiolipin synthase	0.00e+00	1.52e-39	3.70e-56	0.8851
1. PBF	Q2NT72	Cardiolipin synthase A	0.00e+00	1.16e-34	4.03e-41	0.8209
1. PBF	B2VKV4	Cardiolipin synthase A	0.00e+00	6.68e-32	1.82e-41	0.8128
1. PBF	A5WB80	Cardiolipin synthase A	0.00e+00	3.55e-42	2.32e-62	0.8709
1. PBF	Q66AL9	Cardiolipin synthase A	0.00e+00	3.03e-32	2.50e-43	0.853
1. PBF	Q0TQG9	Cardiolipin synthase	0.00e+00	1.08e-38	3.86e-56	0.8948
1. PBF	B7NVL8	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8592
1. PBF	A7FI50	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.8037
1. PBF	Q5PCS9	Cardiolipin synthase A	0.00e+00	1.37e-33	1.81e-39	0.8127
1. PBF	B5BIA8	Cardiolipin synthase A	0.00e+00	1.37e-33	1.81e-39	0.823
1. PBF	O66043	Cardiolipin synthase	0.00e+00	2.73e-65	8.53e-82	0.8404
1. PBF	P45860	Probable cardiolipin synthase YwiE	0.00e+00	9.30e-63	3.11e-69	0.8421
1. PBF	B4TJM2	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8113
1. PBF	Q6D4S2	Cardiolipin synthase A	0.00e+00	6.50e-35	2.40e-46	0.7946
1. PBF	Q32GV1	Cardiolipin synthase A	0.00e+00	9.91e-32	4.11e-41	0.8141
1. PBF	B5F4L0	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8031
1. PBF	A4TJ85	Cardiolipin synthase A	0.00e+00	2.03e-32	2.21e-43	0.7981
1. PBF	B7LY04	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8192
1. PBF	C6DGY3	Cardiolipin synthase A	0.00e+00	5.67e-36	1.56e-47	0.8022
1. PBF	B2TZZ4	Cardiolipin synthase A	0.00e+00	6.54e-32	8.72e-41	0.8179
1. PBF	Q6GH88	Cardiolipin synthase 1	0.00e+00	4.00e-51	2.33e-64	0.8599
1. PBF	B5FU52	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8167
1. PBF	B5R3N1	Cardiolipin synthase A	0.00e+00	4.41e-32	2.25e-39	0.8276
1. PBF	A7ZZI5	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	0.8034
1. PBF	Q9K8Z4	Cardiolipin synthase	0.00e+00	7.94e-62	1.11e-84	0.8286
1. PBF	Q8CPD8	Cardiolipin synthase 1	0.00e+00	1.61e-48	1.26e-64	0.8698
1. PBF	Q8CNK3	Cardiolipin synthase 2	0.00e+00	7.74e-44	2.63e-60	0.8777
1. PBF	Q87TY7	Cardiolipin synthase A	0.00e+00	1.79e-40	1.18e-59	0.8411
1. PBF	Q4ZL66	Cardiolipin synthase A	0.00e+00	1.27e-39	5.82e-62	0.8705
1. PBF	Q5L1S5	Cardiolipin synthase	0.00e+00	2.26e-53	7.38e-77	0.831
2. PF	Q5R8K7	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	1.45e-07	3.23e-03	NA	0.5528
3. BF	P56117	Uncharacterized protein HP_0190	1.36e-09	NA	1.07e-09	0.6137
3. BF	P59715	Cardiolipin synthase B	3.23e-14	NA	1.76e-19	0.8088
3. BF	Q8Z883	Cardiolipin synthase B	3.15e-14	NA	1.34e-22	0.8442
3. BF	Q8FJN9	Cardiolipin synthase B	4.65e-14	NA	8.71e-19	0.8369
3. BF	P0AA85	Cardiolipin synthase B	3.75e-14	NA	8.87e-19	0.8362
3. BF	Q9ZMP2	Uncharacterized protein jhp_0176	4.50e-10	NA	6.88e-10	0.6114
3. BF	Q8ZQP4	Cardiolipin synthase B	3.09e-14	NA	1.01e-22	0.8264
4. PB	P0A6H8	Cardiolipin synthase A	0.00e+00	1.60e-31	9.64e-41	NA
4. PB	Q3UNN8	Inactive phospholipase D5	1.29e-07	2.83e-02	0.036	NA
5. P	Q52893	Nodulation protein NoeB	1.56e-01	2.69e-02	NA	NA
5. P	Q8N7P1	Inactive phospholipase D5	3.91e-09	2.74e-02	NA	NA
5. P	Q8BG07	5'-3' exonuclease PLD4	8.90e-09	2.31e-02	NA	NA
5. P	Q8BHF7	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	2.63e-09	1.50e-02	NA	NA
5. P	Q32NB8	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	2.11e-07	5.64e-03	NA	NA
5. P	Q2KJ28	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	1.29e-09	1.17e-02	NA	NA
5. P	Q96BZ4	5'-3' exonuclease PLD4	1.86e-07	5.14e-05	NA	NA
5. P	Q9Z2Z7	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	1.78e-09	1.37e-02	NA	NA
6. F	O08684	Phospholipase D1	1.15e-03	NA	NA	0.4995
6. F	B0V9M3	Polyphosphate kinase	1.84e-05	NA	NA	0.4829
6. F	A8FN39	Polyphosphate kinase	4.35e-05	NA	NA	0.4848
6. F	P79001	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	2.90e-07	NA	NA	0.5545
6. F	Q87S51	Polyphosphate kinase	3.33e-05	NA	NA	0.5666
6. F	Q9KU07	Polyphosphate kinase	3.33e-05	NA	NA	0.5651
6. F	O05405	Uncharacterized protein YrhO	3.12e-03	NA	NA	0.4958
6. F	Q8U3H1	Putative HTH-type transcriptional regulator TrmBL2	6.00e-04	NA	NA	0.428
6. F	Q1RK58	Phospholipase D	9.69e-06	NA	NA	0.6218
6. F	E2RD63	Mitochondrial cardiolipin hydrolase	2.48e-05	NA	NA	0.4711
6. F	B7GXW8	Polyphosphate kinase	4.72e-05	NA	NA	0.4831
6. F	P0A7B2	Polyphosphate kinase	2.08e-05	NA	NA	0.5548
6. F	Q88YD2	Polyphosphate kinase	1.31e-04	NA	NA	0.5956
6. F	B1YL94	Polyphosphate kinase	8.98e-05	NA	NA	0.484
6. F	Q9PMU0	Polyphosphate kinase	4.20e-05	NA	NA	0.5752
6. F	Q0V8L6	Phospholipase D2	1.79e-05	NA	NA	0.5231
6. F	B1JZG0	Polyphosphate kinase	3.91e-06	NA	NA	0.5381
6. F	Q39HM0	Polyphosphate kinase	5.11e-06	NA	NA	0.5295
6. F	Q8ZCX2	Polyphosphate kinase	7.60e-05	NA	NA	0.509
6. F	A8IW99	Mitochondrial cardiolipin hydrolase	5.92e-06	NA	NA	0.791
6. F	O86090	Polyphosphate kinase	2.63e-05	NA	NA	0.5366
6. F	Q53728	Phospholipase D	5.45e-08	NA	NA	0.5506
6. F	A0K6D2	Polyphosphate kinase	4.03e-06	NA	NA	0.5376
6. F	Q8DEW2	Polyphosphate kinase	3.38e-05	NA	NA	0.5625
6. F	Q28DT3	Mitochondrial cardiolipin hydrolase	1.92e-04	NA	NA	0.5475
6. F	P44704	CDP-diacylglycerol--serine O-phosphatidyltransferase	4.99e-11	NA	NA	0.6518
6. F	Q9JW42	Polyphosphate kinase	6.12e-05	NA	NA	0.5373
6. F	Q9HGZ9	HTH-type sugar sensing transcriptional regulator TrmB	4.60e-03	NA	NA	0.496
6. F	Q5FAJ0	Polyphosphate kinase	1.95e-05	NA	NA	0.5513
6. F	Q68VT0	Phospholipase D	1.26e-05	NA	NA	0.7739
6. F	Q4UJZ1	Phospholipase D	1.61e-05	NA	NA	0.7486
6. F	Q5JD67	HTH-type transcriptional regulator TrmBL2	1.21e-03	NA	NA	0.3951
6. F	A3M3C8	Polyphosphate kinase	2.70e-05	NA	NA	0.494
6. F	Q92G53	Phospholipase D	2.84e-05	NA	NA	0.6107
6. F	Q9X4M8	Polyphosphate kinase	2.07e-05	NA	NA	0.5094
6. F	A3KN19	Protein FAM83D	1.24e-02	NA	NA	0.584
6. F	E1BE10	Mitochondrial cardiolipin hydrolase	1.71e-05	NA	NA	0.7182
6. F	Q9ZCD8	Phospholipase D	6.18e-05	NA	NA	0.6469
6. F	Q0BGI1	Polyphosphate kinase	3.55e-06	NA	NA	0.5331
6. F	C4L3Y8	Polyphosphate kinase	4.82e-05	NA	NA	0.5147
6. F	Q5BMR2	Phospholipase D	1.09e-02	NA	NA	0.5092
6. F	Q8Z4R0	Polyphosphate kinase	2.59e-05	NA	NA	0.5366
6. F	Q8FF70	Polyphosphate kinase	2.67e-05	NA	NA	0.5312
6. F	Q7MNJ0	Polyphosphate kinase	3.45e-05	NA	NA	0.5656
6. F	Q07411	Polyphosphate kinase	7.05e-05	NA	NA	0.5105
6. F	Q8U4G4	HTH-type sugar sensing transcriptional regulator TrmBL1	5.89e-03	NA	NA	0.4006
6. F	Q88CG4	Polyphosphate kinase	3.16e-05	NA	NA	0.5283
6. F	A9M159	Polyphosphate kinase	7.90e-05	NA	NA	0.5074
6. F	Q5ZHN9	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial	2.88e-09	NA	NA	0.5609
7. B	P75919	Cardiolipin synthase C	1.34e-10	NA	7.64e-06	NA
7. B	Q54WR4	Phospholipase D B	6.91e-02	NA	8.67e-05	NA
7. B	P0AA84	Cardiolipin synthase B	2.21e-14	NA	8.87e-19	NA