Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54644.1
JCVISYN3A_0150

Translation elongation factor G.
M. mycoides homolog: Q6MU82.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 88
Unique PROST Go: 12
Unique BLAST Go: 24
Unique Foldseek Go: 1

Total Homologs: 4061
Unique PROST Homologs: 11
Unique BLAST Homologs: 1558
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: fusA; Elongation factor G
Zhang et al. [4]: GO:0006414|translational elongation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q2S3R7 (Elongation factor G) with a FATCAT P-Value: 0 and RMSD of 1.33 angstrom. The sequence alignment identity is 53.2%.
Structural alignment shown in left. Query protein AVX54644.1 colored as red in alignment, homolog Q2S3R7 colored as blue. Query protein AVX54644.1 is also shown in right top, homolog Q2S3R7 showed in right bottom. They are colored based on secondary structures. 

  AVX54644.1 MARE----YSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHEGASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSL 96
      Q2S3R7 MATQTNESFPLEKTRNIGIMAHIDAGKTTLTERILFYTGRLHRMGEVHEGAATMDFMEQEKERGITITSAATTCYWDDHRVNIIDTPGHVDFTVEVERSL 100

  AVX54644.1 RVLDGAVAVLDGQSGVEPQTETVWRQATNYKVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQLPIGAEENFTGIIDLVEMKA--YEFD---GKPE 191
      Q2S3R7 RVLDGAIALFCAVGGVEPQSETVWRQAEKYDVPRIGFVNKMDRTGADFENVLEMMEDRLSANPVPVQYPIGAGDMFRGVIDLIEGKAIIYD-DESQG--- 196

  AVX54644.1 ENYKEI-EIPTNLLEQAKELRAHLVEVAVEYDEELLMKFLD-GGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSPLDIPSIKG 289
      Q2S3R7 MQW-DVREIPDDLESKAEHWRINLLESVAEYDDELLMKYLDEDQEVEPEELHTVIRKATLNRDMTPMFCGSALKNTGVQRVLDGVTNYLPSPNDVPAITG 295

  AVX54644.1 ILPTG--EEVERHA-DDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVLNSTKQQKERVGRILQMHANNRTEIEEVYSGDIAAAVGLKNTTTGDT 386
      Q2S3R7 HHPQDKEEDITRHPRED-EPFSAVAFKITTDPYVGKLTFVRVYSGTLESGSRVYSPTRDEDERIGRMMFMHADSREDVDVIRAGDIAAVVGPKNLKTGDT 394

  AVX54644.1 LCDEKGEIILESMVFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDIIVDRMKREFNVATNVGAPQVSYRETIKL 486
      Q2S3R7 ICDPDHPVVLESMDFPEPVIRIAVEPRTKADRDKLTNGLTKLAEEDPTFNVRTDEETGQTIIAGMGELHLEIIIDRLKQEFKVEANVGQPQVAYREA--L 492

  AVX54644.1 PGKAEGKYI--KQSGGRGSYGHVVIEFEP-----NKDKG--FEWVDKITGGRVSKEYINSARVGLENALRNGVIAGYPMID-VKATIVDGSMHEVDSNEM 576
      Q2S3R7 TDMIDEHYVLKKQSGGRGQFAEVYMDVGPIPEEEEEESGLVFE--NEIKGGVIPKEFIPSVERGIESAMEDGPLAGYP-IEGVWVRLYDGDHHEVDSDQN 589

  AVX54644.1 AYKIAASMALKEASKKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGIIEGSE-QRGNAQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEA 675
      Q2S3R7 AFEIAGRLGFREAARHANPVLMEPVMEVEVVTPDDYMGDIIGDLNGRRGQI-GQMGQRNDAQVINAEVPLSEMFGYSTDLRSLSQGRAIYTMQFGSYEPV 688

  AVX54644.1 PKAIADEIIKKSGK---- 689
      Q2S3R7 PEEVASEIMDEQTMSATA 706

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0032543 mitochondrial translation
1. PBF GO:0005886 plasma membrane
1. PBF GO:0005759 mitochondrial matrix
1. PBF GO:0032790 ribosome disassembly
1. PBF GO:0006414 translational elongation
1. PBF GO:0003924 GTPase activity
1. PBF GO:0005739 mitochondrion
1. PBF GO:0005634 nucleus
1. PBF GO:0045727 positive regulation of translation
1. PBF GO:0051881 regulation of mitochondrial membrane potential
1. PBF GO:0005743 mitochondrial inner membrane
1. PBF GO:0005737 cytoplasm
1. PBF GO:0006449 regulation of translational termination
1. PBF GO:0000287 magnesium ion binding
1. PBF GO:0003746 translation elongation factor activity
1. PBF GO:0070125 mitochondrial translational elongation
1. PBF GO:0005525 GTP binding
1. PBF GO:0043022 ribosome binding
1. PBF GO:0016150 translation release factor activity, codon nonspecific
1. PBF GO:0006415 translational termination
1. PBF GO:0016149 translation release factor activity, codon specific
1. PBF GO:0019843 rRNA binding
2. PF GO:0000002 mitochondrial genome maintenance
2. PF GO:0046677 response to antibiotic
4. PB GO:0071364 cellular response to epidermal growth factor stimulus
4. PB GO:0003723 RNA binding
4. PB GO:0014009 glial cell proliferation
4. PB GO:0006364 rRNA processing
4. PB GO:0005615 extracellular space
4. PB GO:0030864 cortical actin cytoskeleton
4. PB GO:0005853 eukaryotic translation elongation factor 1 complex
4. PB GO:0004781 sulfate adenylyltransferase (ATP) activity
4. PB GO:1990904 ribonucleoprotein complex
4. PB GO:0030623 U5 snRNA binding
4. PB GO:0097177 mitochondrial ribosome binding
4. PB GO:0000049 tRNA binding
4. PB GO:0005524 ATP binding
4. PB GO:1904714 regulation of chaperone-mediated autophagy
4. PB GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
4. PB GO:0046540 U4/U6 x U5 tri-snRNP complex
4. PB GO:0042802 identical protein binding
4. PB GO:0051593 response to folic acid
4. PB GO:0005576 extracellular region
4. PB GO:0090218 positive regulation of lipid kinase activity
4. PB GO:1900022 regulation of D-erythro-sphingosine kinase activity
4. PB GO:0003743 translation initiation factor activity
4. PB GO:2000767 positive regulation of cytoplasmic translation
4. PB GO:0002182 cytoplasmic translational elongation
4. PB GO:0016020 membrane
4. PB GO:0005654 nucleoplasm
4. PB GO:0071007 U2-type catalytic step 2 spliceosome
5. P GO:0045694 regulation of embryo sac egg cell differentiation
5. P GO:0042256 mature ribosome assembly
5. P GO:0032587 ruffle membrane
5. P GO:0016259 selenocysteine metabolic process
5. P GO:0030445 yeast-form cell wall
5. P GO:0016235 aggresome
5. P GO:0035368 selenocysteine insertion sequence binding
5. P GO:0010035 response to inorganic substance
5. P GO:0071005 U2-type precatalytic spliceosome
5. P GO:0010446 response to alkaline pH
5. P GO:0001514 selenocysteine incorporation
5. P GO:0098574 cytoplasmic side of lysosomal membrane
6. F GO:0000027 ribosomal large subunit assembly
7. B GO:0008135 translation factor activity, RNA binding
7. B GO:0009986 cell surface
7. B GO:0016539 intein-mediated protein splicing
7. B GO:0009535 chloroplast thylakoid membrane
7. B GO:0005829 cytosol
7. B GO:0004020 adenylylsulfate kinase activity
7. B GO:0003747 translation release factor activity
7. B GO:0006413 translational initiation
7. B GO:0046872 metal ion binding
7. B GO:0020011 apicoplast
7. B GO:0000103 sulfate assimilation
7. B GO:0070814 hydrogen sulfide biosynthetic process
7. B GO:0006412 translation
7. B GO:0008270 zinc ion binding
7. B GO:0007165 signal transduction
7. B GO:0048471 perinuclear region of cytoplasm
7. B GO:0097216 guanosine tetraphosphate binding
7. B GO:0006314 intron homing
7. B GO:0006790 sulfur compound metabolic process
7. B GO:1990533 Dom34-Hbs1 complex
7. B GO:0070124 mitochondrial translational initiation
7. B GO:0002184 cytoplasmic translational termination
7. B GO:0007049 cell cycle
7. B GO:0018444 translation release factor complex

Uniprot GO Annotations

GO Description
GO:0006412 translation
GO:0006414 translational elongation
GO:0003924 GTPase activity
GO:0005737 cytoplasm
GO:0003746 translation elongation factor activity
GO:0000166 nucleotide binding
GO:0005525 GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q4L527 Peptide chain release factor 3 4.41e-14 5.46e-15 2.95e-54 0.7457
1. PBF Q726J1 Peptide chain release factor 3 4.38e-11 1.04e-11 9.61e-46 0.7035
1. PBF B1I9N0 Peptide chain release factor 3 3.95e-13 5.49e-14 2.06e-46 0.7492
1. PBF B8ELG6 Elongation factor G 0.00e+00 7.95e-81 0.0 0.7427
1. PBF B0SUQ6 Elongation factor G 0.00e+00 1.29e-80 0.0 0.7429
1. PBF Q5ZX60 Peptide chain release factor 3 6.00e-13 7.05e-14 2.60e-39 0.7568
1. PBF Q74GV6 Peptide chain release factor 3 1.28e-11 2.38e-14 1.73e-46 0.6918
1. PBF P57879 Peptide chain release factor 3 2.83e-13 2.51e-14 5.35e-38 0.7484
1. PBF Q3SK69 Peptide chain release factor 3 1.15e-11 7.81e-12 4.71e-43 0.7278
1. PBF Q4UXA5 Peptide chain release factor 3 1.54e-11 3.67e-14 4.61e-36 0.68
1. PBF A0LRL7 Elongation factor G 0.00e+00 3.18e-77 0.0 0.8374
1. PBF A6QFN0 Peptide chain release factor 3 2.20e-14 3.66e-15 1.96e-52 0.7597
1. PBF Q5X6N0 Peptide chain release factor 3 1.89e-11 7.05e-14 2.60e-39 0.7035
1. PBF Q31H08 Peptide chain release factor 3 3.19e-11 1.72e-14 2.24e-41 0.7026
1. PBF Q03GI2 Peptide chain release factor 3 2.17e-13 1.42e-12 1.29e-48 0.7364
1. PBF P68788 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7424
1. PBF C3P9Q2 Elongation factor G 0.00e+00 1.89e-92 0.0 0.7444
1. PBF B4U0V9 Elongation factor G 0.00e+00 7.40e-88 0.0 0.7463
1. PBF Q5B6J8 Elongation factor G, mitochondrial 0.00e+00 4.12e-19 0.0 0.7266
1. PBF B2UUV6 Elongation factor G 0.00e+00 1.70e-83 0.0 0.7401
1. PBF Q9KPM5 Elongation factor G 2 0.00e+00 2.87e-75 0.0 0.7422
1. PBF B2UYA7 Elongation factor G 0.00e+00 1.57e-87 0.0 0.9905
1. PBF B3M011 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.38e-44 2.04e-107 0.7996
1. PBF Q660H9 Elongation factor G 2 0.00e+00 7.68e-60 6.74e-169 0.9333
1. PBF Q2RQV7 Elongation factor G 0.00e+00 8.68e-84 0.0 0.7941
1. PBF A8GV17 Elongation factor G 0.00e+00 1.35e-82 0.0 0.735
1. PBF B4HEQ8 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.85e-40 1.75e-105 0.752
1. PBF B1ZLK1 Elongation factor G 0.00e+00 5.11e-78 0.0 0.8579
1. PBF B5BL11 Peptide chain release factor 3 7.54e-13 1.32e-14 9.24e-44 0.7671
1. PBF Q6A6L5 Elongation factor G 0.00e+00 1.45e-80 0.0 0.9698
1. PBF Q8XHS1 Elongation factor G 0.00e+00 6.51e-82 0.0 0.7452
1. PBF B9KFH1 Elongation factor G 0.00e+00 4.85e-84 0.0 0.9755
1. PBF Q9CIK7 Peptide chain release factor 3 1.94e-13 6.05e-14 3.35e-49 0.7474
1. PBF Q49V57 Elongation factor G 0.00e+00 1.15e-84 0.0 0.7436
1. PBF Q2YSB4 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7432
1. PBF B0JIY7 Peptide chain release factor 3 2.64e-13 2.83e-16 9.86e-49 0.7314
1. PBF A5WH45 Peptide chain release factor 3 2.10e-13 9.30e-14 1.82e-47 0.7776
1. PBF Q12QG7 Peptide chain release factor 3 7.07e-13 1.63e-14 1.23e-41 0.7688
1. PBF Q3A709 Peptide chain release factor 3 1.84e-11 2.94e-13 4.18e-46 0.7201
1. PBF A1CHC3 Elongation factor G, mitochondrial 0.00e+00 8.86e-20 6.97e-179 0.7274
1. PBF B7LEM0 Peptide chain release factor 3 6.55e-13 4.54e-13 4.17e-43 0.7517
1. PBF C1AYS4 Elongation factor G 0.00e+00 5.16e-85 0.0 0.7404
1. PBF A5DK38 Elongation factor G, mitochondrial 0.00e+00 3.19e-29 0.0 0.9347
1. PBF A7I3T6 Elongation factor G 0.00e+00 1.62e-86 0.0 0.9791
1. PBF A8PXR7 Elongation factor G, mitochondrial 0.00e+00 3.64e-43 0.0 0.9257
1. PBF P0DD97 Peptide chain release factor 3 9.67e-14 7.66e-14 4.66e-49 0.7628
1. PBF Q5FFE7 Elongation factor G 0.00e+00 7.95e-81 0.0 0.7959
1. PBF B6ENF7 Peptide chain release factor 3 3.52e-13 3.86e-16 3.61e-42 0.7581
1. PBF A4XI36 Elongation factor G 0.00e+00 2.01e-86 0.0 0.7432
1. PBF A5IG41 Peptide chain release factor 3 2.39e-11 5.12e-14 9.51e-40 0.7021
1. PBF B5R9U3 Peptide chain release factor 3 1.89e-14 9.77e-15 1.30e-43 0.7727
1. PBF A1KGG4 Elongation factor G 0.00e+00 4.16e-84 0.0 0.7394
1. PBF Q51238 Tetracycline resistance protein TetM 0.00e+00 1.24e-34 6.07e-61 0.8136
1. PBF Q0ADD1 Peptide chain release factor 3 7.73e-10 8.62e-16 2.28e-43 0.7181
1. PBF A5PKR8 Elongation factor G, mitochondrial 0.00e+00 9.04e-38 0.0 0.7315
1. PBF Q97EH4 Elongation factor G 0.00e+00 2.74e-86 0.0 0.7449
1. PBF A0ALY9 Elongation factor G 0.00e+00 4.81e-87 0.0 0.7466
1. PBF Q6AP74 Elongation factor G 2 0.00e+00 5.71e-79 0.0 0.7445
1. PBF C0R543 Elongation factor G 0.00e+00 8.19e-81 0.0 0.9708
1. PBF A8IAT3 Elongation factor G 0.00e+00 4.95e-80 0.0 0.7451
1. PBF C1DQ00 Peptide chain release factor 3 1.40e-12 2.72e-17 1.44e-50 0.7833
1. PBF A5UFG5 Peptide chain release factor 3 0.00e+00 5.79e-13 1.39e-41 0.7665
1. PBF A3GHT9 Elongation factor G, mitochondrial 0.00e+00 3.45e-26 2.53e-177 0.7257
1. PBF Q31PV4 Elongation factor G 0.00e+00 4.85e-85 0.0 0.7351
1. PBF A2RDW3 Peptide chain release factor 3 1.80e-13 8.21e-14 4.89e-49 0.7591
1. PBF A1WSZ8 Peptide chain release factor 3 4.49e-11 2.99e-15 2.14e-36 0.6946
1. PBF Q2SSW9 Elongation factor G 0.00e+00 3.80e-113 0.0 0.7514
1. PBF Q75CZ5 Elongation factor G, mitochondrial 0.00e+00 8.88e-31 3.79e-180 0.9389
1. PBF C5BNW9 Peptide chain release factor 3 1.09e-12 3.47e-14 6.08e-43 0.7647
1. PBF Q9PGX4 Peptide chain release factor 3 1.73e-11 1.20e-15 5.15e-40 0.7161
1. PBF Q253F1 Elongation factor G 0.00e+00 1.23e-82 0.0 0.9531
1. PBF Q1CS71 Elongation factor G 0.00e+00 2.45e-83 0.0 0.7416
1. PBF Q83P06 Peptide chain release factor 3 3.59e-13 6.63e-13 1.86e-42 0.7548
1. PBF C3LJ79 Elongation factor G 0.00e+00 5.99e-92 0.0 0.7431
1. PBF Q0SQE1 Elongation factor G 0.00e+00 6.51e-82 0.0 0.7453
1. PBF B7KCH0 Peptide chain release factor 3 2.63e-12 1.75e-15 4.08e-49 0.6996
1. PBF Q1MPS9 Elongation factor G 0.00e+00 1.47e-81 0.0 0.7423
1. PBF C0QQM0 Elongation factor G 0.00e+00 3.15e-82 0.0 0.743
1. PBF P69946 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7475
1. PBF Q9Z802 Elongation factor G 0.00e+00 3.32e-81 0.0 0.9665
1. PBF C5M6K8 Translation factor GUF1, mitochondrial 2.79e-13 2.35e-11 1.21e-16 0.5537
1. PBF A1JJ92 Peptide chain release factor 3 2.04e-14 1.33e-12 1.31e-43 0.7657
1. PBF Q4KIC9 Peptide chain release factor 3 1.40e-12 6.32e-17 5.20e-50 0.7592
1. PBF A9NDA0 Peptide chain release factor 3 2.78e-13 1.05e-16 1.33e-44 0.7756
1. PBF Q5FM92 Elongation factor G 0.00e+00 1.68e-79 0.0 0.7423
1. PBF P74228 Elongation factor G 2 0.00e+00 5.77e-82 0.0 0.7395
1. PBF Q606M6 Peptide chain release factor 3 2.36e-11 2.27e-13 7.38e-44 0.7062
1. PBF B1AJG4 Elongation factor G 0.00e+00 1.04e-85 0.0 0.7408
1. PBF B8FGS8 Peptide chain release factor 3 2.10e-11 4.98e-14 1.39e-46 0.7112
1. PBF Q2P4Q8 Peptide chain release factor 3 1.71e-11 2.77e-14 3.76e-37 0.6751
1. PBF Q890N8 Elongation factor G 0.00e+00 5.12e-87 0.0 0.7449
1. PBF Q83FP1 Elongation factor G 0.00e+00 3.15e-82 0.0 0.985
1. PBF A8G9G8 Peptide chain release factor 3 1.18e-14 3.02e-14 1.95e-42 0.7821
1. PBF B3PLU0 Elongation factor 4 1.91e-14 1.24e-16 4.13e-21 0.6918
1. PBF A1D5Z0 Translation factor guf1, mitochondrial 1.74e-09 3.08e-11 1.77e-14 0.5891
1. PBF A5EVN8 Peptide chain release factor 3 6.39e-12 2.39e-12 5.32e-34 0.7239
1. PBF A1AME1 Peptide chain release factor 3 1.53e-11 7.25e-14 1.01e-43 0.7262
1. PBF Q87M18 Peptide chain release factor 3 4.73e-13 6.58e-14 4.81e-44 0.77
1. PBF B3E7T2 Elongation factor G 0.00e+00 2.80e-80 0.0 0.7462
1. PBF C3KVQ4 Elongation factor G 0.00e+00 3.96e-88 0.0 0.7433
1. PBF Q6MP77 Elongation factor G 2 0.00e+00 1.03e-62 0.0 0.7375
1. PBF Q4A8T7 Elongation factor G 0.00e+00 7.40e-88 0.0 0.7428
1. PBF Q9PI16 Elongation factor G 0.00e+00 6.30e-83 0.0 0.742
1. PBF A4VYX6 Elongation factor G 0.00e+00 7.05e-90 0.0 0.7462
1. PBF P9WNM8 Elongation factor G-like protein 0.00e+00 1.91e-39 4.00e-116 0.7087
1. PBF A0LLL8 Peptide chain release factor 3 1.06e-11 3.06e-14 1.61e-49 0.6835
1. PBF Q3M7Y0 Peptide chain release factor 3 1.67e-15 1.89e-15 1.81e-47 0.7076
1. PBF B0KCJ7 Elongation factor G 0.00e+00 1.04e-83 0.0 0.7432
1. PBF Q9ZK24 Elongation factor G 0.00e+00 1.04e-83 0.0 0.7456
1. PBF Q2A1V8 Peptide chain release factor 3 3.40e-12 6.66e-15 1.48e-40 0.7185
1. PBF B8HY03 Peptide chain release factor 3 2.88e-12 4.40e-15 1.42e-47 0.7116
1. PBF Q5NIF4 Peptide chain release factor 3 1.21e-13 4.40e-15 5.02e-41 0.7777
1. PBF Q7SH14 Elongation factor G, mitochondrial 0.00e+00 8.85e-18 0.0 0.7263
1. PBF Q2NJ19 Elongation factor G 0.00e+00 1.95e-87 0.0 0.7464
1. PBF A6RGX9 Translation factor GUF1, mitochondrial 1.19e-09 4.47e-10 1.33e-14 0.6159
1. PBF Q6C9Y6 Elongation factor G, mitochondrial 0.00e+00 7.62e-34 2.65e-171 0.7275
1. PBF C1C5H4 Peptide chain release factor 3 4.67e-13 9.15e-13 7.26e-48 0.7477
1. PBF Q03JD8 Peptide chain release factor 3 2.02e-13 2.70e-14 1.55e-50 0.7567
1. PBF A9N7C9 Peptide chain release factor 3 2.51e-13 1.32e-14 9.24e-44 0.7662
1. PBF Q2IXR3 Elongation factor G 0.00e+00 3.75e-83 0.0 0.8014
1. PBF B6H2S6 Translation factor guf1, mitochondrial 6.79e-14 3.15e-09 4.72e-15 0.6058
1. PBF Q48SQ1 Peptide chain release factor 3 2.35e-13 8.32e-14 7.35e-49 0.7596
1. PBF P38525 Elongation factor G 0.00e+00 3.32e-83 0.0 0.973
1. PBF Q8KTA8 Elongation factor G 0.00e+00 1.23e-81 0.0 0.7366
1. PBF Q8KTB2 Elongation factor G 0.00e+00 1.21e-80 0.0 0.7419
1. PBF Q932I8 Tetracycline resistance protein TetM 0.00e+00 2.47e-35 3.91e-60 0.8129
1. PBF Q9ZEU4 Elongation factor G 0.00e+00 2.92e-86 0.0 0.7421
1. PBF P0A7I6 Peptide chain release factor 3 0.00e+00 4.54e-13 4.17e-43 0.7749
1. PBF Q3JZB5 Elongation factor G 0.00e+00 1.24e-88 0.0 0.7458
1. PBF Q2W2I8 Elongation factor G 0.00e+00 1.87e-81 0.0 0.7944
1. PBF Q1D9P5 Elongation factor G 1 0.00e+00 2.84e-65 0.0 0.9583
1. PBF Q6MU82 Elongation factor G 0.00e+00 5.56e-118 0.0 0.7524
1. PBF B0B809 Elongation factor G 0.00e+00 4.56e-84 0.0 0.973
1. PBF A4W2D1 Peptide chain release factor 3 2.31e-13 7.88e-14 2.90e-50 0.7538
1. PBF C6DJU6 Peptide chain release factor 3 2.36e-13 5.46e-15 1.08e-41 0.7725
1. PBF A4VSN3 Elongation factor G 0.00e+00 7.05e-90 0.0 0.7465
1. PBF Q8F983 Elongation factor G 0.00e+00 2.05e-62 0.0 0.946
1. PBF B1LBP3 Elongation factor G 0.00e+00 4.77e-81 0.0 0.9793
1. PBF B0K5P0 Elongation factor G 0.00e+00 1.04e-83 0.0 0.7639
1. PBF B7GJ64 Elongation factor G 0.00e+00 1.45e-90 0.0 0.7488
1. PBF A1SNN6 Elongation factor G 0.00e+00 1.93e-81 0.0 0.9856
1. PBF B4LS49 Elongation factor G, mitochondrial 0.00e+00 6.93e-41 0.0 0.7332
1. PBF Q52360 Tetracycline resistance protein TetQ 0.00e+00 2.06e-37 9.83e-62 0.8517
1. PBF Q250N5 Elongation factor G 0.00e+00 8.19e-85 0.0 0.7461
1. PBF B4Q5D5 Elongation factor G, mitochondrial 0.00e+00 4.26e-43 0.0 0.7333
1. PBF Q8KTB0 Elongation factor G 0.00e+00 1.35e-82 0.0 0.7369
1. PBF O51634 Elongation factor G 2 0.00e+00 2.28e-62 1.65e-169 0.9353
1. PBF B9KHV3 Elongation factor G 0.00e+00 4.80e-80 0.0 0.7964
1. PBF Q56121 Peptide chain release factor 3 2.20e-14 1.32e-14 9.24e-44 0.7732
1. PBF P41084 Elongation factor G 0.00e+00 4.52e-80 0.0 0.7427
1. PBF B0XZZ2 Translation factor guf1, mitochondrial 1.33e-09 6.86e-11 2.07e-14 0.5891
1. PBF A8EXK1 Elongation factor G 0.00e+00 3.78e-80 0.0 0.8035
1. PBF C0ZIH5 Elongation factor G 0.00e+00 3.43e-83 0.0 0.7332
1. PBF Q2G8Y3 Elongation factor G 0.00e+00 1.52e-77 0.0 0.7424
1. PBF Q49WE9 Peptide chain release factor 3 5.68e-14 1.19e-14 1.11e-50 0.747
1. PBF P69948 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7418
1. PBF O05197 Tetracycline resistance protein TetQ 0.00e+00 2.53e-35 3.26e-60 0.832
1. PBF A2RCI2 Elongation factor G 0.00e+00 1.38e-87 0.0 0.7479
1. PBF B9MQH0 Elongation factor G 0.00e+00 7.62e-86 0.0 0.7443
1. PBF B2K3I2 Peptide chain release factor 3 1.78e-15 1.82e-13 5.05e-44 0.7813
1. PBF Q2UGQ2 Elongation factor G, mitochondrial 0.00e+00 9.44e-19 0.0 0.7263
1. PBF B1GZ80 Elongation factor G 0.00e+00 5.32e-85 0.0 0.9873
1. PBF P18667 Elongation factor G 0.00e+00 4.85e-85 0.0 0.9728
1. PBF Q1CMZ7 Peptide chain release factor 3 1.25e-13 8.44e-14 5.96e-44 0.7678
1. PBF Q9CDG1 Elongation factor G 0.00e+00 9.22e-84 0.0 0.7426
1. PBF Q99V72 Peptide chain release factor 3 1.06e-13 6.03e-15 1.52e-52 0.7546
1. PBF Q65SF0 Peptide chain release factor 3 0.00e+00 4.10e-14 5.76e-41 0.7782
1. PBF Q086G5 Peptide chain release factor 3 8.94e-13 1.39e-15 2.38e-41 0.7489
1. PBF A6Q6I6 Elongation factor G 0.00e+00 5.00e-84 0.0 0.7447
1. PBF A7A0X4 Elongation factor G, mitochondrial 0.00e+00 1.41e-30 0.0 0.9415
1. PBF A4IJI6 Elongation factor G 0.00e+00 2.22e-91 0.0 0.748
1. PBF A7ZVR5 Peptide chain release factor 3 5.90e-13 7.19e-13 2.59e-43 0.7548
1. PBF Q72VM5 Elongation factor G 0.00e+00 2.05e-62 0.0 0.953
1. PBF Q16S14 Elongation factor G, mitochondrial 0.00e+00 4.26e-43 0.0 0.7306
1. PBF A7MUW8 Peptide chain release factor 3 5.67e-13 5.73e-14 5.79e-44 0.7615
1. PBF Q2YX08 Peptide chain release factor 3 1.46e-13 2.31e-15 3.82e-53 0.7581
1. PBF Q73F99 Elongation factor G 0.00e+00 2.78e-92 0.0 0.7441
1. PBF Q82S73 Peptide chain release factor 3 8.20e-10 7.03e-16 1.10e-41 0.6851
1. PBF B8D0C1 Elongation factor G 0.00e+00 8.81e-82 0.0 0.7431
1. PBF B2SF23 Peptide chain release factor 3 2.36e-13 5.15e-15 1.10e-40 0.7732
1. PBF Q1JIM6 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7485
1. PBF A6LLL0 Elongation factor G 0.00e+00 6.92e-82 0.0 0.7257
1. PBF Q0ID58 Elongation factor G 0.00e+00 7.21e-87 0.0 0.7413
1. PBF Q5N192 Peptide chain release factor 3 5.47e-13 2.04e-14 1.94e-45 0.7193
1. PBF B0RB35 Elongation factor G 0.00e+00 3.22e-83 0.0 0.7375
1. PBF Q2NW08 Peptide chain release factor 3 2.60e-13 1.24e-14 5.88e-41 0.7758
1. PBF A9W4P8 Elongation factor G 0.00e+00 3.46e-80 0.0 0.7426
1. PBF C1CIF3 Elongation factor G 0.00e+00 5.24e-91 0.0 0.7461
1. PBF Q9HXB0 Peptide chain release factor 3 1.10e-12 8.85e-18 5.57e-50 0.7717
1. PBF C1F645 Elongation factor G 0.00e+00 9.81e-81 0.0 0.9743
1. PBF Q6KHS5 Elongation factor G 0.00e+00 2.05e-88 0.0 0.7432
1. PBF Q8K9C8 50S ribosomal subunit assembly factor BipA 4.32e-08 1.49e-14 3.79e-24 0.6501
1. PBF B5Z4Q6 Peptide chain release factor 3 1.11e-16 4.54e-13 4.17e-43 0.7756
1. PBF Q71WB8 Elongation factor G 0.00e+00 5.28e-87 0.0 0.747
1. PBF Q5E7K1 Peptide chain release factor 3 7.13e-13 3.03e-15 4.64e-42 0.7574
1. PBF Q65PB0 Elongation factor G 0.00e+00 6.39e-92 0.0 0.7481
1. PBF P66021 Peptide chain release factor 3 1.48e-13 7.66e-14 4.66e-49 0.7605
1. PBF H9L427 50S ribosomal subunit assembly factor BipA 5.07e-08 1.19e-15 2.09e-24 0.6667
1. PBF B0W010 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.42e-39 9.46e-115 0.6912
1. PBF Q6MER8 Elongation factor G 0.00e+00 1.25e-80 0.0 0.7362
1. PBF B0C6Z1 Peptide chain release factor 3 2.76e-12 1.94e-15 2.73e-54 0.6891
1. PBF C4YIT6 Translation factor GUF1, mitochondrial 1.38e-13 2.33e-12 9.42e-17 0.5588
1. PBF Q5WLR5 Elongation factor G 0.00e+00 8.52e-92 0.0 0.749
1. PBF Q89AC9 50S ribosomal subunit assembly factor BipA 5.18e-08 4.10e-15 2.05e-24 0.6539
1. PBF Q6ACY9 Elongation factor G 0.00e+00 9.76e-86 0.0 0.7367
1. PBF A2QU25 Translation factor guf1, mitochondrial 5.96e-14 2.50e-10 4.44e-15 0.5989
1. PBF Q2KTQ5 Peptide chain release factor 3 9.00e-12 7.45e-16 2.84e-44 0.6876
1. PBF A8FYR3 Peptide chain release factor 3 2.59e-13 1.50e-15 1.71e-38 0.76
1. PBF Q4ZNI9 Peptide chain release factor 3 1.09e-12 1.55e-17 1.46e-49 0.769
1. PBF Q4A703 Elongation factor G 0.00e+00 1.32e-88 0.0 0.9907
1. PBF B3CLA3 Elongation factor G 0.00e+00 2.17e-83 0.0 0.9811
1. PBF Q60BD3 Elongation factor G 1 0.00e+00 1.83e-74 0.0 0.7466
1. PBF B3N6A5 Elongation factor G, mitochondrial 0.00e+00 6.74e-44 0.0 0.7321
1. PBF Q5QXU1 Peptide chain release factor 3 5.46e-13 1.05e-14 3.47e-45 0.7645
1. PBF Q9K0H6 Peptide chain release factor 3 6.60e-13 1.77e-13 6.26e-42 0.7742
1. PBF Q6N4T4 Elongation factor G 0.00e+00 9.07e-83 0.0 0.7923
1. PBF Q0JY21 Peptide chain release factor 3 1.93e-11 5.86e-12 1.96e-40 0.6993
1. PBF Q7URV2 Elongation factor G 0.00e+00 2.88e-70 0.0 0.7267
1. PBF O25225 50S ribosomal subunit assembly factor BipA 1.72e-07 3.64e-16 1.85e-27 0.5935
1. PBF C8VPJ1 Translation factor guf1, mitochondrial 5.60e-14 7.79e-11 1.41e-14 0.6052
1. PBF P75544 Elongation factor G 0.00e+00 2.22e-92 0.0 0.7464
1. PBF Q1ISC5 Elongation factor G 0.00e+00 7.22e-84 0.0 0.8469
1. PBF B2ISJ9 Elongation factor G 0.00e+00 8.00e-90 0.0 0.7459
1. PBF Q9PPW7 Elongation factor G 0.00e+00 1.04e-85 0.0 0.7402
1. PBF Q55002 Oxytetracycline resistance protein 0.00e+00 2.47e-32 1.00e-50 0.7749
1. PBF B3GZM0 Peptide chain release factor 3 5.79e-13 6.76e-14 3.28e-43 0.768
1. PBF A8FKR7 Elongation factor G 0.00e+00 6.30e-83 0.0 0.7738
1. PBF A0Q892 Peptide chain release factor 3 4.28e-12 3.76e-15 3.29e-40 0.7241
1. PBF Q9A3K4 Elongation factor G 0.00e+00 9.84e-80 0.0 0.7936
1. PBF Q0HXQ8 Peptide chain release factor 3 1.04e-12 9.00e-16 9.07e-40 0.7521
1. PBF A1W018 Elongation factor 4 0.00e+00 1.24e-19 1.28e-20 0.6821
1. PBF C5CC67 Elongation factor G 0.00e+00 5.88e-81 0.0 0.7334
1. PBF Q6GI64 Peptide chain release factor 3 4.80e-14 2.31e-15 3.82e-53 0.7515
1. PBF A8Z6I6 Elongation factor G 0.00e+00 3.62e-86 0.0 0.8015
1. PBF A5G9T7 Peptide chain release factor 3 1.06e-11 4.92e-13 4.31e-41 0.6961
1. PBF B5FTB7 Peptide chain release factor 3 3.63e-14 1.32e-14 9.24e-44 0.7732
1. PBF A3MYA2 Peptide chain release factor 3 1.53e-14 3.93e-14 9.27e-43 0.7677
1. PBF Q7NVF7 Peptide chain release factor 3 4.90e-14 4.16e-14 9.04e-41 0.8057
1. PBF Q04BM6 Peptide chain release factor 3 1.11e-13 1.47e-14 7.59e-48 0.7459
1. PBF P43928 Peptide chain release factor 3 1.55e-13 3.97e-13 2.49e-41 0.7629
1. PBF Q5PK12 Peptide chain release factor 3 6.57e-13 1.32e-14 9.24e-44 0.7625
1. PBF Q31SW4 Peptide chain release factor 3 6.61e-13 7.19e-13 2.59e-43 0.7495
1. PBF B1I8Z9 Elongation factor G 0.00e+00 2.86e-91 0.0 0.7462
1. PBF Q5FA25 Peptide chain release factor 3 6.13e-13 2.46e-13 8.37e-42 0.7732
1. PBF B0RQB0 Peptide chain release factor 3 3.12e-11 3.67e-14 4.61e-36 0.6789
1. PBF B9DVS2 Elongation factor G 0.00e+00 4.78e-88 0.0 0.7455
1. PBF P0DA84 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7478
1. PBF A5IQA1 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7471
1. PBF Q4FLL6 Elongation factor G 0.00e+00 8.15e-79 0.0 0.7406
1. PBF Q601W8 Elongation factor G 0.00e+00 7.40e-88 0.0 0.7417
1. PBF B3WAM2 Elongation factor G 0.00e+00 2.00e-82 0.0 0.8064
1. PBF Q7V501 Elongation factor G 0.00e+00 1.86e-83 0.0 0.9846
1. PBF Q3SSW9 Elongation factor G 0.00e+00 4.37e-83 0.0 0.7452
1. PBF A8ALY7 Peptide chain release factor 3 1.11e-16 7.57e-15 2.88e-43 0.7729
1. PBF Q5L6S5 Elongation factor G 0.00e+00 8.54e-83 0.0 0.972
1. PBF A2RI79 Peptide chain release factor 3 2.71e-13 1.48e-13 3.25e-49 0.7341
1. PBF Q48791 Tetracycline resistance protein TetS 0.00e+00 1.24e-34 2.66e-63 0.7988
1. PBF A5GW13 Elongation factor G 0.00e+00 2.06e-84 0.0 0.9798
1. PBF B5RUN4 Ribosome-releasing factor 2, mitochondrial 0.00e+00 6.78e-39 3.08e-104 0.8626
1. PBF Q1GBM0 Elongation factor G 0.00e+00 1.15e-86 0.0 0.7426
1. PBF Q1JAY1 Peptide chain release factor 3 2.01e-13 7.66e-14 4.66e-49 0.7577
1. PBF A7FMI1 Peptide chain release factor 3 0.00e+00 1.82e-13 5.05e-44 0.7694
1. PBF Q8EIJ7 Elongation factor G 2 0.00e+00 1.20e-70 0.0 0.9586
1. PBF B2I6P5 Peptide chain release factor 3 3.94e-12 7.24e-16 1.26e-39 0.7245
1. PBF C0MF25 Elongation factor G 0.00e+00 2.72e-88 0.0 0.7473
1. PBF Q318N4 Elongation factor G 0.00e+00 3.68e-85 0.0 0.7363
1. PBF Q3ZZM6 Elongation factor G 0.00e+00 4.91e-81 0.0 0.7364
1. PBF Q5HU70 Elongation factor 4 4.60e-14 1.55e-19 1.30e-20 0.6816
1. PBF Q1C156 Peptide chain release factor 3 1.42e-12 8.44e-14 5.96e-44 0.7334
1. PBF C0Q7L6 Peptide chain release factor 3 1.85e-14 1.32e-14 9.24e-44 0.7704
1. PBF Q3A6Q0 Elongation factor G 2 0.00e+00 1.54e-79 0.0 0.9887
1. PBF A7GZJ4 Elongation factor G 0.00e+00 6.51e-82 0.0 0.8141
1. PBF P68789 Elongation factor G 0.00e+00 6.53e-86 0.0 0.743
1. PBF O84444 Elongation factor G 0.00e+00 1.92e-85 0.0 0.9705
1. PBF A7GJ77 Elongation factor G 0.00e+00 1.75e-88 0.0 0.7426
1. PBF C3PKP1 Elongation factor G 0.00e+00 2.87e-82 0.0 0.9773
1. PBF C5GRI9 Translation factor GUF1, mitochondrial 1.27e-09 3.16e-11 1.15e-14 0.6122
1. PBF A7H311 Elongation factor 4 4.98e-14 2.34e-20 2.12e-20 0.673
1. PBF Q927I5 Elongation factor G 0.00e+00 1.22e-86 0.0 0.7478
1. PBF Q74IG8 Peptide chain release factor 3 2.39e-13 2.24e-13 1.59e-47 0.7373
1. PBF A1KSN4 Peptide chain release factor 3 7.75e-13 1.16e-13 6.96e-42 0.8027
1. PBF B9IZJ1 Elongation factor G 0.00e+00 1.21e-92 0.0 0.7441
1. PBF Q7W455 Elongation factor G 2 0.00e+00 6.25e-77 0.0 0.7925
1. PBF Q72CI3 Elongation factor G 0.00e+00 1.50e-83 0.0 0.7443
1. PBF A5V605 Elongation factor G 0.00e+00 8.48e-80 0.0 0.7413
1. PBF Q660Y4 Elongation factor G 1 0.00e+00 1.64e-70 0.0 0.7477
1. PBF P09757 Tetracycline resistance protein TetM 0.00e+00 7.01e-35 3.03e-61 0.816
1. PBF A0QL36 Elongation factor G 0.00e+00 9.94e-82 0.0 0.9755
1. PBF B8DN94 Elongation factor G 0.00e+00 2.94e-83 0.0 0.7438
1. PBF Q1IEF7 Peptide chain release factor 3 9.56e-13 3.57e-17 6.10e-50 0.7594
1. PBF B1WUP2 Peptide chain release factor 3 2.45e-12 3.87e-15 2.63e-49 0.6954
1. PBF B0UHX2 Elongation factor G 0.00e+00 2.98e-80 0.0 0.7437
1. PBF Q92D33 Peptide chain release factor 3 1.54e-13 3.50e-15 9.70e-47 0.7586
1. PBF A7IFX8 Elongation factor G 0.00e+00 1.29e-80 0.0 0.7446
1. PBF Q824G0 Elongation factor G 0.00e+00 1.18e-83 0.0 0.9602
1. PBF P80868 Elongation factor G 0.00e+00 1.81e-88 0.0 0.7491
1. PBF B9EAS8 Peptide chain release factor 3 2.01e-13 2.55e-14 6.60e-51 0.7439
1. PBF A9WSW6 Elongation factor G 0.00e+00 4.71e-85 0.0 0.9681
1. PBF A6TWI5 Elongation factor G 0.00e+00 3.41e-86 0.0 0.7468
1. PBF Q15YP4 Elongation factor G 1 0.00e+00 2.74e-73 0.0 0.748
1. PBF A6Q241 Elongation factor 4 0.00e+00 4.37e-18 1.21e-18 0.6677
1. PBF Q88XY8 Elongation factor G 0.00e+00 7.17e-88 0.0 0.746
1. PBF B3QZH4 Elongation factor G 0.00e+00 6.57e-87 0.0 0.7454
1. PBF Q4AAQ6 Elongation factor G 0.00e+00 7.40e-88 0.0 0.975
1. PBF Q0AXN1 Elongation factor G 1 0.00e+00 1.18e-63 0.0 0.7277
1. PBF B8E6N9 Peptide chain release factor 3 9.86e-13 3.98e-15 1.31e-39 0.7487
1. PBF Q7NGL0 Peptide chain release factor 3 9.63e-13 2.78e-15 3.73e-49 0.6956
1. PBF A8F4Q8 Elongation factor G 0.00e+00 1.16e-81 0.0 0.9815
1. PBF B5FA93 Peptide chain release factor 3 3.52e-13 2.78e-15 2.77e-42 0.7605
1. PBF A1UBL0 Elongation factor G 0.00e+00 7.11e-83 0.0 0.7587
1. PBF Q839G9 Elongation factor G 0.00e+00 1.47e-91 0.0 0.7449
1. PBF A4W691 Peptide chain release factor 3 0.00e+00 9.23e-15 5.12e-43 0.7736
1. PBF B3P8M3 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.79e-44 1.34e-115 0.9177
1. PBF B7JYV9 Peptide chain release factor 3 9.42e-13 1.10e-15 9.16e-52 0.7031
1. PBF B7HJ45 Elongation factor G 0.00e+00 1.78e-92 0.0 0.7445
1. PBF Q2S204 Peptide chain release factor 3 1.23e-11 6.38e-15 3.90e-50 0.6891
1. PBF B9M7Q2 Peptide chain release factor 3 1.28e-11 1.82e-13 1.01e-39 0.6937
1. PBF B4RSU5 Elongation factor G 0.00e+00 4.21e-73 0.0 0.9466
1. PBF Q8FS85 Elongation factor G 0.00e+00 1.98e-83 0.0 0.7475
1. PBF P0A3B4 50S ribosomal subunit assembly factor BipA 4.55e-08 1.04e-15 1.44e-24 0.6648
1. PBF Q0HRE9 Elongation factor G 2 0.00e+00 7.25e-71 0.0 0.748
1. PBF A7Z0N4 Elongation factor G 0.00e+00 4.93e-88 0.0 0.7487
1. PBF Q04M39 Peptide chain release factor 3 3.94e-13 1.35e-12 1.04e-46 0.7495
1. PBF Q46QA5 Peptide chain release factor 3 5.91e-11 1.66e-11 9.53e-41 0.7026
1. PBF Q2IJ93 Elongation factor G 1 0.00e+00 2.62e-82 0.0 0.746
1. PBF Q04MH7 Elongation factor G 0.00e+00 1.94e-89 0.0 0.7463
1. PBF B4GNT0 Ribosome-releasing factor 2, mitochondrial 0.00e+00 7.99e-45 3.59e-108 0.7615
1. PBF Q8CPR1 Peptide chain release factor 3 2.14e-13 9.64e-15 6.79e-54 0.7494
1. PBF A0PXU3 Elongation factor G 0.00e+00 6.25e-81 0.0 0.7463
1. PBF B0DSK4 Elongation factor G, mitochondrial 0.00e+00 5.58e-46 4.01e-166 0.9319
1. PBF Q8YP62 Elongation factor G 0.00e+00 5.00e-84 0.0 0.7394
1. PBF A0AHA7 Peptide chain release factor 3 2.72e-13 3.82e-15 8.46e-45 0.759
1. PBF B2J5B0 Elongation factor G 0.00e+00 1.21e-85 0.0 0.7388
1. PBF B4KKD5 Elongation factor G, mitochondrial 0.00e+00 1.66e-40 0.0 0.7342
1. PBF B5Z8J0 Elongation factor G 0.00e+00 2.77e-83 0.0 0.7454
1. PBF A8F981 Elongation factor G 0.00e+00 4.33e-91 0.0 0.7483
1. PBF A5IM80 Elongation factor G 0.00e+00 5.38e-81 0.0 0.9821
1. PBF B5VN01 Elongation factor G, mitochondrial 0.00e+00 1.41e-30 0.0 0.7258
1. PBF Q8P6V6 Peptide chain release factor 3 3.91e-11 3.67e-14 4.61e-36 0.6745
1. PBF Q3A9R2 Elongation factor G 0.00e+00 1.08e-87 0.0 0.7433
1. PBF B4JQM7 Elongation factor G, mitochondrial 0.00e+00 7.73e-40 0.0 0.7308
1. PBF B5XJR1 Elongation factor G 0.00e+00 2.47e-88 0.0 0.7489
1. PBF B4SSC0 Peptide chain release factor 3 3.98e-12 2.55e-15 1.93e-36 0.7329
1. PBF Q5HVX6 Elongation factor G 0.00e+00 6.30e-83 0.0 0.9745
1. PBF B8GTY2 Peptide chain release factor 3 1.49e-11 1.13e-13 6.80e-43 0.6999
1. PBF B5F516 Peptide chain release factor 3 7.91e-13 1.32e-14 9.24e-44 0.7662
1. PBF Q7VA04 Elongation factor G 0.00e+00 1.47e-84 0.0 0.975
1. PBF B2VH43 Peptide chain release factor 3 3.44e-13 5.05e-14 1.92e-44 0.7753
1. PBF Q02652 Tetracycline resistance protein TetM 0.00e+00 1.84e-29 2.48e-39 0.8189
1. PBF A6Q1M7 Elongation factor G 0.00e+00 7.01e-84 0.0 0.7459
1. PBF C0M937 Elongation factor G 0.00e+00 2.72e-88 0.0 0.7468
1. PBF C5C0J4 Elongation factor G 0.00e+00 1.41e-85 0.0 0.9791
1. PBF A3PV95 Elongation factor G 0.00e+00 7.11e-83 0.0 0.7394
1. PBF A7NE28 Peptide chain release factor 3 5.51e-12 6.66e-15 1.48e-40 0.7103
1. PBF Q4A5S3 Elongation factor 4 1.11e-16 1.81e-18 7.27e-19 0.603
1. PBF A5CUB7 Elongation factor G 0.00e+00 1.18e-83 0.0 0.8063
1. PBF B7NH42 Peptide chain release factor 3 7.77e-13 4.54e-13 4.17e-43 0.7505
1. PBF B2A4D6 Elongation factor G 0.00e+00 3.45e-82 0.0 0.9811
1. PBF Q5M364 Peptide chain release factor 3 3.22e-13 2.62e-14 6.44e-50 0.7429
1. PBF Q748Y8 Elongation factor G 2 0.00e+00 1.55e-83 0.0 0.7421
1. PBF A6W5T4 Elongation factor G 0.00e+00 1.19e-82 0.0 0.978
1. PBF Q8KTC1 Elongation factor G 0.00e+00 1.30e-81 0.0 0.7392
1. PBF A1ST34 Peptide chain release factor 3 2.10e-12 1.02e-13 1.30e-40 0.762
1. PBF Q87WH1 Peptide chain release factor 3 9.86e-13 1.38e-17 3.23e-50 0.7599
1. PBF Q7MA53 Elongation factor G 0.00e+00 1.75e-85 0.0 0.7456
1. PBF Q8KTB6 Elongation factor G 0.00e+00 1.41e-80 0.0 0.7406
1. PBF Q8NXC0 Peptide chain release factor 3 3.05e-14 2.31e-15 3.82e-53 0.7494
1. PBF Q89A56 Peptide chain release factor 3 1.45e-12 6.29e-15 2.34e-44 0.7465
1. PBF B2J573 Peptide chain release factor 3 4.75e-12 2.38e-14 7.60e-46 0.6886
1. PBF P64022 Elongation factor G 0.00e+00 1.94e-89 0.0 0.7464
1. PBF Q1BDD4 Elongation factor G 0.00e+00 7.11e-83 0.0 0.7341
1. PBF Q08425 Tetracycline resistance protein TetQ 0.00e+00 1.41e-37 8.51e-61 0.8699
1. PBF B6J0P2 Peptide chain release factor 3 2.74e-11 1.69e-16 3.47e-45 0.7198
1. PBF C3K5A9 Peptide chain release factor 3 9.21e-13 1.08e-16 2.77e-52 0.759
1. PBF A8FM79 Elongation factor 4 6.02e-14 1.24e-19 1.28e-20 0.6691
1. PBF A8QCE7 Translation factor GUF1 homolog, mitochondrial 6.62e-14 3.90e-10 1.27e-19 0.6038
1. PBF B0TQ95 Peptide chain release factor 3 1.69e-13 5.08e-15 7.68e-39 0.7602
1. PBF Q4AAQ8 Elongation factor 4 1.11e-16 2.85e-17 1.38e-19 0.5975
1. PBF Q5M2M6 Elongation factor G 0.00e+00 1.24e-88 0.0 0.7419
1. PBF Q53770 Tetracycline resistance protein TetM 0.00e+00 3.23e-35 5.02e-59 0.8109
1. PBF A5N4P4 Elongation factor G 0.00e+00 3.99e-83 0.0 0.7431
1. PBF Q8YP23 Peptide chain release factor 3 2.44e-15 3.26e-15 1.25e-48 0.7063
1. PBF C4K1P6 Elongation factor G 0.00e+00 1.90e-80 0.0 0.7415
1. PBF C0ZVT6 Elongation factor G 0.00e+00 3.68e-85 0.0 0.7754
1. PBF Q8DI43 Elongation factor G 0.00e+00 3.26e-84 0.0 0.743
1. PBF Q8Y8C0 Peptide chain release factor 3 9.69e-14 3.98e-15 2.20e-46 0.7632
1. PBF P13551 Elongation factor G 0.00e+00 2.24e-83 0.0 0.7353
1. PBF Q92J93 Elongation factor G 0.00e+00 1.36e-80 0.0 0.7413
1. PBF B6H460 Elongation factor G, mitochondrial 0.00e+00 2.87e-19 3.40e-179 0.7279
1. PBF Q1JL31 Peptide chain release factor 3 2.15e-13 7.66e-14 4.66e-49 0.7508
1. PBF A7MGA3 Peptide chain release factor 3 3.60e-13 4.80e-15 9.06e-44 0.772
1. PBF B0BRI9 Peptide chain release factor 3 3.08e-13 3.72e-14 5.12e-43 0.7565
1. PBF Q83DC7 Peptide chain release factor 3 7.94e-13 1.05e-16 1.33e-44 0.7764
1. PBF Q2U3T4 Translation factor guf1, mitochondrial 9.60e-14 1.22e-09 5.59e-15 0.5974
1. PBF B6JET0 Elongation factor G 0.00e+00 1.52e-81 0.0 0.7425
1. PBF Q1DLM0 Elongation factor G, mitochondrial 0.00e+00 1.24e-15 1.06e-176 0.9225
1. PBF A6QNM2 Ribosome-releasing factor 2, mitochondrial 0.00e+00 9.15e-30 8.70e-151 0.9035
1. PBF B5ZC32 Elongation factor G 0.00e+00 6.73e-86 0.0 0.7391
1. PBF Q8DXS7 Elongation factor G 0.00e+00 1.24e-88 0.0 0.7471
1. PBF A0PM41 Elongation factor G 0.00e+00 3.66e-82 0.0 0.7387
1. PBF A4XBP9 Elongation factor G 0.00e+00 3.22e-81 0.0 0.7378
1. PBF A3D7J9 Peptide chain release factor 3 2.32e-13 4.47e-15 6.68e-41 0.7476
1. PBF A1CXG4 Elongation factor G, mitochondrial 0.00e+00 2.52e-17 6.15e-178 0.7624
1. PBF C6HPI9 Translation factor GUF1, mitochondrial 1.36e-09 2.90e-10 1.12e-14 0.6116
1. PBF Q3AMT5 Elongation factor G 0.00e+00 1.87e-85 0.0 0.7375
1. PBF Q6GBU0 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7429
1. PBF Q2S3R7 Elongation factor G 0.00e+00 7.05e-81 0.0 0.9827
1. PBF Q7VJZ1 Elongation factor 4 1.10e-14 3.63e-19 1.22e-18 0.669
1. PBF A2BT84 Elongation factor G 0.00e+00 4.36e-86 0.0 0.7402
1. PBF B8ZSC2 Elongation factor G 0.00e+00 5.95e-82 0.0 0.7335
1. PBF B7VBK5 Peptide chain release factor 3 1.24e-12 8.85e-18 5.57e-50 0.7712
1. PBF Q39SN2 Elongation factor G 2 0.00e+00 8.87e-73 0.0 0.9423
1. PBF P0DD96 Peptide chain release factor 3 2.81e-13 7.66e-14 4.66e-49 0.7472
1. PBF Q66EW6 Peptide chain release factor 3 1.60e-13 1.82e-13 5.05e-44 0.7579
1. PBF Q6ASC7 Elongation factor G 1 0.00e+00 1.89e-69 0.0 0.9561
1. PBF Q9PJV6 Elongation factor G 0.00e+00 3.35e-85 0.0 0.9707
1. PBF A9NEN3 Elongation factor G 0.00e+00 1.03e-91 0.0 0.7492
1. PBF B7MTC0 Peptide chain release factor 3 5.95e-13 4.54e-13 4.17e-43 0.7551
1. PBF A8MLD7 Elongation factor G 0.00e+00 7.45e-84 0.0 0.7461
1. PBF P13550 Elongation factor G 0.00e+00 2.80e-84 0.0 0.734
1. PBF B1HMZ1 Elongation factor G 0.00e+00 2.21e-86 0.0 0.746
1. PBF Q9X1Y4 Elongation factor G-like protein 0.00e+00 2.43e-42 2.82e-167 0.6877
1. PBF B3RDA4 Peptide chain release factor 3 1.86e-11 4.75e-12 1.30e-40 0.695
1. PBF Q0BSG5 Elongation factor G 0.00e+00 5.54e-79 0.0 0.9658
1. PBF Q8CQ82 Elongation factor G 0.00e+00 1.55e-83 0.0 0.7481
1. PBF Q97SE4 Peptide chain release factor 3 5.27e-13 1.09e-12 3.36e-47 0.7499
1. PBF Q6GAQ7 Peptide chain release factor 3 6.77e-14 2.31e-15 3.82e-53 0.7532
1. PBF Q6GJC1 Elongation factor G 0.00e+00 6.53e-86 0.0 0.743
1. PBF Q8DBT6 Peptide chain release factor 3 4.87e-13 7.35e-14 1.99e-42 0.7705
1. PBF A9VP74 Elongation factor G 0.00e+00 1.14e-91 0.0 0.7432
1. PBF B6JN34 Elongation factor G 0.00e+00 1.93e-84 0.0 0.745
1. PBF B1KSM8 Elongation factor G 0.00e+00 2.42e-89 0.0 0.7426
1. PBF Q6NJD6 Elongation factor G 0.00e+00 9.08e-82 0.0 0.7648
1. PBF Q2GJ60 Elongation factor G 0.00e+00 5.43e-82 0.0 0.7411
1. PBF Q0AUH7 Elongation factor G 2 0.00e+00 4.51e-83 0.0 0.8039
1. PBF Q5HQE4 Peptide chain release factor 3 9.36e-14 9.64e-15 6.79e-54 0.7503
1. PBF Q9JVH7 Peptide chain release factor 3 5.79e-13 3.10e-14 2.47e-41 0.796
1. PBF Q8Y421 Elongation factor G 0.00e+00 5.28e-87 0.0 0.7463
1. PBF Q8E3E7 Elongation factor G 0.00e+00 9.06e-89 0.0 0.7404
1. PBF Q46IW3 Elongation factor G 0.00e+00 1.11e-84 0.0 0.9752
1. PBF C0SHD5 Translation factor GUF1, mitochondrial 9.19e-14 2.44e-10 2.39e-15 0.613
1. PBF A6QEJ9 Elongation factor G 0.00e+00 3.36e-84 0.0 0.7432
1. PBF Q87M30 Elongation factor G 2 0.00e+00 4.69e-75 0.0 0.8147
1. PBF C5BHI4 Peptide chain release factor 3 2.70e-13 1.42e-13 4.79e-45 0.7777
1. PBF Q7MI34 Peptide chain release factor 3 3.36e-13 5.49e-14 5.12e-43 0.7757
1. PBF Q034X8 Elongation factor G 0.00e+00 6.90e-83 0.0 0.7495
1. PBF B0KQD8 Peptide chain release factor 3 7.70e-13 4.15e-17 1.51e-49 0.7589
1. PBF B2FR00 Peptide chain release factor 3 3.84e-12 2.48e-15 2.38e-38 0.7245
1. PBF A8F0P0 Elongation factor G 0.00e+00 3.64e-81 0.0 0.7999
1. PBF B2G8Y0 Elongation factor G 0.00e+00 5.31e-89 0.0 0.7437
1. PBF A4T1R3 Elongation factor G 0.00e+00 1.02e-81 0.0 0.9798
1. PBF B4R8L3 Elongation factor G 0.00e+00 1.32e-80 0.0 0.7982
1. PBF Q8PI56 Peptide chain release factor 3 5.06e-13 2.09e-14 7.58e-37 0.7174
1. PBF B1IS45 Peptide chain release factor 3 0.00e+00 7.19e-13 2.59e-43 0.7809
1. PBF B7HQU1 Elongation factor G 0.00e+00 1.21e-92 0.0 0.7442
1. PBF Q0CS42 Translation factor guf1, mitochondrial 1.37e-11 3.81e-10 8.95e-15 0.5959
1. PBF A2C4U6 Elongation factor G 0.00e+00 1.34e-84 0.0 0.7415
1. PBF P56002 Elongation factor G 0.00e+00 2.17e-83 0.0 0.7424
1. PBF Q67JU0 Elongation factor G 0.00e+00 5.41e-83 0.0 0.7459
1. PBF Q7MZN3 Peptide chain release factor 3 3.80e-13 6.49e-14 1.69e-41 0.7905
1. PBF B2SSM9 Peptide chain release factor 3 3.99e-11 2.15e-14 4.63e-37 0.6772
1. PBF B4MZW9 Elongation factor G, mitochondrial 0.00e+00 3.79e-42 0.0 0.7322
1. PBF Q7NAV3 Elongation factor G 0.00e+00 1.55e-88 0.0 0.7451
1. PBF Q0VRV7 Peptide chain release factor 3 4.88e-13 8.91e-17 1.06e-41 0.754
1. PBF B1YGU7 Elongation factor G 0.00e+00 4.25e-90 0.0 0.743
1. PBF A8M532 Elongation factor G 0.00e+00 7.75e-80 0.0 0.7373
1. PBF A7WYX4 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7433
1. PBF C4ZT56 Peptide chain release factor 3 5.67e-13 4.54e-13 4.17e-43 0.7545
1. PBF Q05FI2 Elongation factor G 0.00e+00 1.31e-69 0.0 0.9379
1. PBF P0A3B3 50S ribosomal subunit assembly factor BipA 3.84e-08 1.04e-15 1.44e-24 0.6687
1. PBF Q1J8I4 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7478
1. PBF A2CC86 Elongation factor G 0.00e+00 1.29e-83 0.0 0.7415
1. PBF A2QI77 Elongation factor G, mitochondrial 0.00e+00 2.85e-17 1.45e-177 0.936
1. PBF B1JBG6 Peptide chain release factor 3 2.43e-13 2.68e-17 1.12e-50 0.7787
1. PBF B4TU33 Peptide chain release factor 3 8.38e-13 1.32e-14 9.24e-44 0.7663
1. PBF Q046C7 Elongation factor G 0.00e+00 3.46e-80 0.0 0.7424
1. PBF Q55421 Elongation factor G-like protein 0.00e+00 6.79e-40 1.73e-98 0.6842
1. PBF P70882 Tetracycline resistance protein TetQ 0.00e+00 5.17e-37 7.61e-61 0.8374
1. PBF A7HWQ8 Elongation factor G 0.00e+00 5.66e-85 0.0 0.7961
1. PBF Q07KL5 Elongation factor G 0.00e+00 4.81e-82 0.0 0.7445
1. PBF A3LWR2 Ribosome-releasing factor 2, mitochondrial 0.00e+00 5.44e-41 1.49e-111 0.7191
1. PBF Q8K935 Peptide chain release factor 3 6.95e-13 4.22e-15 1.65e-40 0.7574
1. PBF Q3Z983 Elongation factor G 0.00e+00 9.45e-79 0.0 0.7381
1. PBF O83748 Elongation factor G 1 0.00e+00 3.48e-67 0.0 0.7313
1. PBF A8P1W0 Elongation factor G, mitochondrial 0.00e+00 2.07e-11 1.45e-166 0.9444
1. PBF B8MS24 Translation factor guf1, mitochondrial 9.59e-14 1.15e-10 2.97e-15 0.5992
1. PBF A7RR04 Elongation factor G, mitochondrial 0.00e+00 4.83e-42 0.0 0.9486
1. PBF Q5FLA9 Peptide chain release factor 3 1.21e-13 1.59e-13 2.00e-46 0.7331
1. PBF P46211 Elongation factor G 0.00e+00 7.24e-79 0.0 0.7207
1. PBF Q48DZ2 Peptide chain release factor 3 9.67e-13 2.68e-17 3.40e-49 0.7754
1. PBF A5UBE8 Peptide chain release factor 3 1.02e-13 1.28e-12 5.55e-42 0.7607
1. PBF Q4A8T9 Elongation factor 4 1.11e-16 1.34e-17 1.39e-19 0.5938
1. PBF Q5XB97 Peptide chain release factor 3 2.73e-13 1.04e-13 6.46e-49 0.75
1. PBF B4TGZ2 Peptide chain release factor 3 8.61e-13 1.32e-14 9.24e-44 0.7645
1. PBF O87844 Elongation factor G 2 0.00e+00 1.33e-60 0.0 0.9543
1. PBF P72533 Tetracycline resistance protein TetO 0.00e+00 2.33e-35 5.13e-60 0.8286
1. PBF Q1QN33 Elongation factor G 0.00e+00 3.26e-84 0.0 0.7396
1. PBF B4T4G3 Peptide chain release factor 3 7.66e-13 1.32e-14 9.24e-44 0.7658
1. PBF B2WBM8 Elongation factor G, mitochondrial 0.00e+00 2.31e-21 0.0 0.729
1. PBF A9MRB6 Peptide chain release factor 3 4.69e-13 2.12e-14 1.50e-43 0.7667
1. PBF Q211E5 Elongation factor G 0.00e+00 2.96e-82 0.0 0.7458
1. PBF B0WGM1 Elongation factor G, mitochondrial 0.00e+00 9.17e-42 0.0 0.7292
1. PBF A1AJU2 Peptide chain release factor 3 3.83e-13 8.56e-12 4.75e-43 0.7546
1. PBF P20174 Tetracycline resistance protein TetO 0.00e+00 1.94e-35 1.60e-60 0.8099
1. PBF C1CIU0 Peptide chain release factor 3 4.27e-13 4.02e-13 2.65e-47 0.7438
1. PBF Q4WYV0 Translation factor guf1, mitochondrial 1.63e-09 5.82e-11 2.06e-14 0.5892
1. PBF Q6AJD2 Peptide chain release factor 3 1.48e-11 9.56e-14 1.47e-45 0.7127
1. PBF Q8GCP5 Elongation factor 4 1.29e-14 1.73e-17 7.20e-20 0.6723
1. PBF Q7WDS1 Peptide chain release factor 3 1.05e-11 3.18e-16 1.23e-41 0.7419
1. PBF Q110K2 Peptide chain release factor 3 6.55e-15 1.34e-17 3.34e-53 0.7011
1. PBF A9BHA8 Elongation factor G 0.00e+00 1.62e-87 0.0 0.7378
1. PBF Q7Q3I6 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.76e-41 1.82e-112 0.8976
1. PBF A4TQJ9 Peptide chain release factor 3 1.74e-13 8.44e-14 5.96e-44 0.7651
1. PBF A5ELN0 Elongation factor G 0.00e+00 2.71e-82 0.0 0.7394
1. PBF B2HSL2 Elongation factor G 0.00e+00 1.35e-82 0.0 0.7408
1. PBF Q7U4D2 Elongation factor G 0.00e+00 2.50e-86 0.0 0.7375
1. PBF Q8KTB9 Elongation factor G 0.00e+00 1.90e-80 0.0 0.7911
1. PBF B2V7L6 Elongation factor G 0.00e+00 9.36e-82 0.0 0.7428
1. PBF C5D3R4 Elongation factor G 0.00e+00 3.36e-91 0.0 0.7487
1. PBF A5GIP1 Elongation factor G 0.00e+00 1.95e-86 0.0 0.7421
1. PBF B2G8K6 Peptide chain release factor 3 2.23e-13 7.48e-13 9.82e-47 0.7396
1. PBF P0A3B2 50S ribosomal subunit assembly factor BipA 3.67e-08 1.04e-15 1.44e-24 0.6661
1. PBF A4VI89 Peptide chain release factor 3 1.08e-12 6.22e-18 1.13e-49 0.7535
1. PBF Q39Z86 Peptide chain release factor 3 1.00e-11 4.92e-13 1.03e-45 0.7016
1. PBF B0S0I4 Elongation factor G 0.00e+00 7.94e-85 0.0 0.7435
1. PBF Q18CF4 Elongation factor G 0.00e+00 2.94e-83 0.0 0.8714
1. PBF Q3AW54 Elongation factor G 0.00e+00 3.10e-86 0.0 0.7413
1. PBF B0Y604 Elongation factor G, mitochondrial 0.00e+00 7.12e-17 5.07e-178 0.9332
1. PBF C1CPE5 Elongation factor G 0.00e+00 8.00e-90 0.0 0.7459
1. PBF B9W9T4 Elongation factor G, mitochondrial 0.00e+00 6.26e-29 0.0 0.7228
1. PBF C4JWU3 Translation factor GUF1, mitochondrial 0.00e+00 3.96e-09 1.94e-15 0.6028
1. PBF B8ZKU0 Elongation factor G 0.00e+00 1.95e-91 0.0 0.7458
1. PBF A8LC59 Elongation factor G 0.00e+00 6.20e-84 0.0 0.7292
1. PBF Q9KU64 Peptide chain release factor 3 5.73e-13 5.06e-13 1.85e-39 0.7482
1. PBF Q1QDP8 Peptide chain release factor 3 4.23e-14 3.46e-13 1.71e-43 0.7556
1. PBF Q8DR09 Peptide chain release factor 3 4.39e-13 1.35e-12 1.04e-46 0.7433
1. PBF B1VAM2 Elongation factor G 0.00e+00 2.66e-87 0.0 0.7473
1. PBF Q83NA0 Elongation factor G 0.00e+00 2.71e-82 0.0 0.9541
1. PBF B3QBY3 Elongation factor G 0.00e+00 9.07e-83 0.0 0.7394
1. PBF A5D5I7 Elongation factor G 0.00e+00 2.12e-84 0.0 0.7437
1. PBF Q3KI56 Peptide chain release factor 3 6.81e-13 6.32e-17 8.93e-51 0.7728
1. PBF A1VYJ8 Elongation factor G 0.00e+00 5.95e-82 0.0 0.9702
1. PBF B1MGH8 Elongation factor G 0.00e+00 1.48e-82 0.0 0.9794
1. PBF Q0HMD9 Elongation factor G 2 0.00e+00 1.14e-70 0.0 0.7338
1. PBF B8D867 Peptide chain release factor 3 8.47e-13 2.48e-14 1.55e-45 0.7674
1. PBF Q0TMP3 Elongation factor G 0.00e+00 4.67e-82 0.0 0.7451
1. PBF C1AL17 Elongation factor G 0.00e+00 4.16e-84 0.0 0.7385
1. PBF Q8EX19 Elongation factor G 0.00e+00 1.83e-87 0.0 0.7449
1. PBF Q2S6X1 Elongation factor G 2 0.00e+00 2.77e-71 0.0 0.9019
1. PBF A5IRJ6 Peptide chain release factor 3 5.45e-14 6.03e-15 1.52e-52 0.7616
1. PBF B2TZQ6 Peptide chain release factor 3 3.33e-13 7.19e-13 2.59e-43 0.7564
1. PBF A6TZ24 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7424
1. PBF Q5NQ66 Elongation factor G 0.00e+00 4.16e-84 0.0 0.7396
1. PBF B8G1W3 Elongation factor G 0.00e+00 2.80e-84 0.0 0.7453
1. PBF Q6MJ13 Elongation factor G 1 0.00e+00 5.07e-79 0.0 0.9585
1. PBF Q5HRK5 Elongation factor G 0.00e+00 1.55e-83 0.0 0.748
1. PBF P0A7I5 Peptide chain release factor 3 5.91e-13 4.54e-13 4.17e-43 0.7625
1. PBF A1RH82 Peptide chain release factor 3 1.15e-12 1.56e-14 8.08e-40 0.7404
1. PBF Q81VT3 Elongation factor G 0.00e+00 1.89e-92 0.0 0.7443
1. PBF A4XQE4 Peptide chain release factor 3 3.04e-13 1.06e-16 6.37e-48 0.7768
1. PBF P0A3B1 50S ribosomal subunit assembly factor BipA 4.24e-08 1.04e-15 1.44e-24 0.6646
1. PBF Q03EB4 Elongation factor G 0.00e+00 5.10e-86 0.0 0.7413
1. PBF P64023 Elongation factor G 0.00e+00 1.94e-89 0.0 0.7475
1. PBF B5E6U5 Elongation factor G 0.00e+00 1.94e-89 0.0 0.7467
1. PBF B4EWB0 Peptide chain release factor 3 7.68e-13 4.99e-13 4.66e-41 0.7504
1. PBF A9BCK1 Elongation factor G 0.00e+00 1.81e-83 0.0 0.9801
1. PBF Q2HEK0 Elongation factor G, mitochondrial 0.00e+00 1.68e-17 1.75e-180 0.7268
1. PBF A3QGT8 Peptide chain release factor 3 8.35e-14 2.31e-14 4.05e-38 0.759
1. PBF B1LWS3 Elongation factor G 0.00e+00 7.71e-81 0.0 0.7862
1. PBF Q327M2 Peptide chain release factor 3 2.85e-14 4.54e-13 4.17e-43 0.7654
1. PBF B8HD12 Elongation factor G 0.00e+00 4.94e-86 0.0 0.9803
1. PBF Q47CH1 Peptide chain release factor 3 1.13e-11 5.86e-15 7.70e-45 0.7363
1. PBF B7VJG2 Peptide chain release factor 3 7.65e-13 1.67e-14 2.70e-41 0.801
1. PBF Q5R9V1 Elongation factor G, mitochondrial 0.00e+00 1.37e-34 1.08e-178 0.7308
1. PBF Q6KHP1 Elongation factor 4 0.00e+00 3.46e-17 3.46e-20 0.6733
1. PBF B8D9W5 Peptide chain release factor 3 1.77e-11 4.04e-14 7.43e-46 0.7213
1. PBF Q134S6 Elongation factor G 0.00e+00 6.13e-82 0.0 0.7461
1. PBF Q1WVA0 Elongation factor G 0.00e+00 6.49e-83 0.0 0.7442
1. PBF Q1J5X1 Peptide chain release factor 3 9.53e-14 7.66e-14 4.66e-49 0.7539
1. PBF Q8Z0U8 Peptide chain release factor 3 0.00e+00 1.23e-14 1.29e-43 0.7812
1. PBF C5PCH4 Translation factor GUF1, mitochondrial 1.11e-16 7.13e-10 2.49e-15 0.6015
1. PBF Q0V3J4 Translation factor GUF1, mitochondrial 9.43e-14 6.30e-10 1.18e-14 0.6161
1. PBF Q6BPD3 Elongation factor G, mitochondrial 0.00e+00 1.19e-26 1.09e-176 0.9263
1. PBF Q8DVV4 Elongation factor G 0.00e+00 2.96e-92 0.0 0.7424
1. PBF B9K883 Elongation factor G 0.00e+00 1.77e-82 0.0 0.981
1. PBF P44910 50S ribosomal subunit assembly factor BipA 4.79e-08 1.61e-15 7.13e-24 0.663
1. PBF Q2LUL6 Elongation factor G 2 0.00e+00 1.07e-64 0.0 0.9753
1. PBF P68791 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7434
1. PBF Q21M87 Elongation factor G 2 0.00e+00 2.62e-71 0.0 0.7402
1. PBF C1KZK7 Elongation factor G 0.00e+00 5.28e-87 0.0 0.7474
1. PBF P30767 Elongation factor G 0.00e+00 5.95e-82 0.0 0.7469
1. PBF Q2JFH9 Elongation factor G 0.00e+00 1.06e-82 0.0 0.7312
1. PBF B4NZM7 Elongation factor G, mitochondrial 0.00e+00 3.87e-42 0.0 0.7323
1. PBF Q21HQ0 Peptide chain release factor 3 7.63e-14 6.38e-15 1.38e-41 0.7707
1. PBF Q814C5 Elongation factor G 0.00e+00 1.78e-92 0.0 0.7438
1. PBF Q3A834 Elongation factor G 1 0.00e+00 2.61e-64 0.0 0.9605
1. PBF Q03IS1 Elongation factor G 0.00e+00 1.24e-88 0.0 0.7458
1. PBF Q6YQV9 Elongation factor G 0.00e+00 6.94e-86 0.0 0.7453
1. PBF Q5P409 Peptide chain release factor 3 1.01e-11 1.80e-13 7.25e-42 0.7173
1. PBF B1IGF7 Elongation factor G 0.00e+00 1.75e-88 0.0 0.741
1. PBF A0L5X0 Elongation factor G 0.00e+00 3.78e-82 0.0 0.7437
1. PBF B9L7K0 Elongation factor G 0.00e+00 5.25e-83 0.0 0.7462
1. PBF Q5L659 Elongation factor 4 5.06e-11 9.74e-17 1.48e-21 0.6634
1. PBF A8WTI8 Elongation factor G, mitochondrial 0.00e+00 8.43e-40 1.21e-163 0.7159
1. PBF B2IK59 Elongation factor G 0.00e+00 2.08e-80 0.0 0.7439
1. PBF Q1JG54 Peptide chain release factor 3 1.10e-13 5.12e-14 6.46e-49 0.7534
1. PBF Q03PV4 Elongation factor G 0.00e+00 2.80e-84 0.0 0.744
1. PBF Q5PBH2 Elongation factor G 0.00e+00 4.39e-80 0.0 0.7343
1. PBF Q57G48 Peptide chain release factor 3 7.73e-13 1.32e-14 9.24e-44 0.7644
1. PBF Q2LWC5 Peptide chain release factor 3 3.99e-11 1.32e-14 1.23e-47 0.7059
1. PBF B0BWA2 Elongation factor G 0.00e+00 2.56e-80 0.0 0.7989
1. PBF Q00937 Tetracycline resistance protein TetQ 0.00e+00 1.70e-37 4.71e-60 0.8496
1. PBF Q487Z1 Elongation factor G 1 0.00e+00 9.64e-70 0.0 0.9612
1. PBF B8ZLK3 Peptide chain release factor 3 2.13e-13 1.35e-12 1.04e-46 0.7545
1. PBF Q8E635 Peptide chain release factor 3 2.00e-13 1.53e-13 9.86e-48 0.7581
1. PBF Q0I2G9 Peptide chain release factor 3 1.94e-12 9.82e-16 1.53e-41 0.7291
1. PBF Q7VJ85 Elongation factor G 0.00e+00 1.29e-83 0.0 0.9915
1. PBF B5R2J0 Peptide chain release factor 3 6.12e-13 1.32e-14 9.24e-44 0.7641
1. PBF Q7RJ38 Translation factor GUF1 homolog, mitochondrial 8.85e-13 2.36e-02 4.77e-23 0.5754
1. PBF A5DTX8 Ribosome-releasing factor 2, mitochondrial 0.00e+00 4.46e-37 8.99e-110 0.802
1. PBF O07631 50S ribosomal subunit assembly factor BipA 1.85e-07 6.93e-16 7.08e-24 0.5658
1. PBF Q2GFN5 Elongation factor G 0.00e+00 3.03e-81 0.0 0.819
1. PBF Q1RHC3 Elongation factor G 0.00e+00 2.77e-81 0.0 0.741
1. PBF Q15W54 Peptide chain release factor 3 4.48e-13 7.25e-15 3.51e-42 0.7475
1. PBF Q73R08 Elongation factor G 1 0.00e+00 4.91e-72 0.0 0.9585
1. PBF Q74L90 Elongation factor G 0.00e+00 5.71e-81 0.0 0.7406
1. PBF Q3J9L6 Peptide chain release factor 3 2.64e-11 4.09e-16 2.59e-43 0.6954
1. PBF A9KFG7 Peptide chain release factor 3 1.11e-16 1.05e-16 1.33e-44 0.7754
1. PBF B6QHL4 Elongation factor G, mitochondrial 0.00e+00 9.82e-16 0.0 0.7277
1. PBF Q01W89 Elongation factor G 0.00e+00 7.92e-84 0.0 0.9822
1. PBF B4M416 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.45e-40 2.51e-107 0.6541
1. PBF Q7MI49 Elongation factor G 2 0.00e+00 1.03e-74 0.0 0.7459
1. PBF B9W892 Ribosome-releasing factor 2, mitochondrial 0.00e+00 5.28e-42 1.26e-116 0.7322
1. PBF A6U0C5 Peptide chain release factor 3 1.26e-13 6.03e-15 1.52e-52 0.7379
1. PBF Q1JNH7 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7494
1. PBF A4J108 Elongation factor G 0.00e+00 1.83e-86 0.0 0.7438
1. PBF Q8R7V1 Elongation factor G 0.00e+00 4.12e-87 0.0 0.7442
1. PBF B3LT39 Elongation factor G, mitochondrial 0.00e+00 1.41e-30 0.0 0.94
1. PBF Q5YPG3 Elongation factor G 0.00e+00 1.71e-84 0.0 0.9811
1. PBF P21598 Tetracycline resistance protein TetM from transposon Tn916 0.00e+00 2.96e-34 1.56e-61 0.8119
1. PBF A7TFN8 Elongation factor G, mitochondrial 0.00e+00 1.10e-21 0.0 0.7278
1. PBF B3WFB1 Peptide chain release factor 3 2.18e-13 2.12e-12 3.47e-44 0.7407
1. PBF Q8KTB4 Elongation factor G 0.00e+00 2.80e-80 0.0 0.7432
1. PBF B4JSI3 Ribosome-releasing factor 2, mitochondrial 0.00e+00 3.54e-48 5.38e-117 0.8002
1. PBF Q0HLF4 Peptide chain release factor 3 2.89e-12 9.00e-16 9.07e-40 0.7277
1. PBF Q88XF3 Peptide chain release factor 3 2.30e-13 4.98e-14 3.89e-46 0.7276
1. PBF C1FMV4 Elongation factor G 0.00e+00 2.42e-89 0.0 0.742
1. PBF Q54807 Tetracycline resistance protein TetM from transposon Tn5251 0.00e+00 2.91e-35 3.45e-62 0.8133
1. PBF B2GDX1 Elongation factor G 0.00e+00 6.57e-87 0.0 0.7434
1. PBF Q72I01 Elongation factor G 0.00e+00 7.79e-83 0.0 0.7391
1. PBF Q5HC12 Elongation factor G 0.00e+00 7.95e-81 0.0 0.8108
1. PBF Q6D9Z5 Peptide chain release factor 3 2.42e-14 7.46e-15 6.33e-40 0.7725
1. PBF A6THZ0 Peptide chain release factor 3 5.93e-13 1.60e-14 2.26e-43 0.7609
1. PBF P68790 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7426
1. PBF C4KZQ0 Elongation factor G 0.00e+00 1.60e-89 0.0 0.743
1. PBF Q2RFP4 Elongation factor G 0.00e+00 1.25e-85 0.0 0.8305
1. PBF Q0SMG2 Elongation factor G 2 0.00e+00 1.92e-60 1.11e-169 0.8829
1. PBF Q2FI57 Peptide chain release factor 3 8.87e-14 3.66e-15 1.96e-52 0.7526
1. PBF A5FRY7 Elongation factor G 0.00e+00 4.91e-81 0.0 0.7398
1. PBF Q73NV3 Elongation factor G 2 0.00e+00 4.01e-69 0.0 0.7313
1. PBF B8N9M2 Elongation factor G, mitochondrial 0.00e+00 9.44e-19 0.0 0.7268
1. PBF C0NZL9 Translation factor GUF1, mitochondrial 1.68e-09 3.36e-10 1.09e-14 0.6098
1. PBF Q5SHN5 Elongation factor G 0.00e+00 2.24e-83 0.0 0.7358
1. PBF B8MJJ5 Elongation factor G, mitochondrial 0.00e+00 2.59e-16 0.0 0.7263
1. PBF A5VLK8 Elongation factor G 0.00e+00 5.31e-89 0.0 0.74
1. PBF Q5E7H2 Elongation factor G 2 0.00e+00 2.18e-74 0.0 0.9497
1. PBF Q47LJ0 Elongation factor G 0.00e+00 2.06e-84 0.0 0.9851
1. PBF Q4JT40 Elongation factor G 0.00e+00 7.57e-82 0.0 0.7387
1. PBF B4PMC6 Ribosome-releasing factor 2, mitochondrial 0.00e+00 7.72e-44 6.87e-111 0.79
1. PBF B2ILY0 Peptide chain release factor 3 2.88e-13 8.91e-13 3.74e-47 0.7414
1. PBF Q3IJW9 Elongation factor G 2 0.00e+00 1.83e-74 0.0 0.7459
1. PBF B9E8Q1 Elongation factor G 0.00e+00 1.15e-87 0.0 0.7431
1. PBF B4HY41 Elongation factor G, mitochondrial 0.00e+00 4.26e-43 0.0 0.7327
1. PBF Q4L3K8 Elongation factor G 0.00e+00 2.47e-84 0.0 0.7424
1. PBF Q5GSU1 Elongation factor G 0.00e+00 1.52e-78 0.0 0.8347
1. PBF Q5LYK1 Peptide chain release factor 3 4.01e-13 2.62e-14 6.44e-50 0.7429
1. PBF P23835 Tetracycline resistance protein TetO 0.00e+00 1.09e-35 1.91e-59 0.8129
1. PBF A1VEB9 Elongation factor G 0.00e+00 1.50e-83 0.0 0.7435
1. PBF Q5R600 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.27e-28 6.17e-151 0.919
1. PBF Q74A61 Elongation factor G 1 0.00e+00 7.68e-75 0.0 0.9499
1. PBF A4IW75 Peptide chain release factor 3 2.96e-12 5.69e-15 1.45e-40 0.7253
1. PBF B8H414 Elongation factor G 0.00e+00 9.84e-80 0.0 0.7929
1. PBF Q7M8H5 Elongation factor 4 0.00e+00 2.22e-18 6.71e-19 0.6787
1. PBF P0CN32 Elongation factor G, mitochondrial 0.00e+00 1.22e-13 1.73e-177 0.7255
1. PBF B5Y282 Peptide chain release factor 3 6.15e-13 1.06e-14 2.20e-43 0.7672
1. PBF Q6LST1 Elongation factor G 2 0.00e+00 7.97e-74 0.0 0.9678
1. PBF Q29N77 Elongation factor G, mitochondrial 0.00e+00 4.08e-43 0.0 0.7321
1. PBF A8Z0C4 Peptide chain release factor 3 6.57e-13 3.66e-15 1.96e-52 0.751
1. PBF B6QW35 Translation factor guf1, mitochondrial 6.59e-14 2.96e-11 7.70e-15 0.6042
1. PBF B1I1I5 Elongation factor G 0.00e+00 8.03e-83 0.0 0.9749
1. PBF O83464 Elongation factor G 2 0.00e+00 2.34e-64 0.0 0.749
1. PBF Q8KTB8 Elongation factor G 0.00e+00 4.95e-80 0.0 0.8074
1. PBF A7EVV9 Elongation factor G, mitochondrial 0.00e+00 1.46e-18 0.0 0.9329
1. PBF B3MK91 Elongation factor G, mitochondrial 0.00e+00 2.45e-40 0.0 0.7317
1. PBF Q118Z3 Elongation factor G 1 0.00e+00 5.16e-84 0.0 0.7389
1. PBF A8YXK3 Elongation factor G 0.00e+00 9.81e-81 0.0 0.7428
1. PBF Q89J81 Elongation factor G 0.00e+00 2.63e-84 0.0 0.7448
1. PBF A2BYN5 Elongation factor G 0.00e+00 1.04e-85 0.0 0.9782
1. PBF A5DB27 Ribosome-releasing factor 2, mitochondrial 0.00e+00 5.33e-46 2.16e-115 0.8495
1. PBF C1CC62 Elongation factor G 0.00e+00 2.48e-90 0.0 0.7467
1. PBF A5IZ33 Elongation factor G 0.00e+00 2.32e-85 0.0 0.745
1. PBF Q5LY21 Elongation factor G 0.00e+00 1.24e-88 0.0 0.7417
1. PBF B6K286 Elongation factor G, mitochondrial 0.00e+00 3.84e-29 8.07e-178 0.9244
1. PBF A6V0K2 Peptide chain release factor 3 1.32e-12 1.11e-17 1.68e-49 0.7572
1. PBF A5F904 Peptide chain release factor 3 1.17e-12 7.00e-13 1.54e-39 0.7587
1. PBF Q6C255 Translation factor GUF1, mitochondrial 2.59e-13 6.67e-09 3.71e-16 0.6129
1. PBF Q87F03 Peptide chain release factor 3 4.62e-12 7.24e-16 1.26e-39 0.7253
1. PBF Q5XDW4 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7466
1. PBF B5EFP7 Elongation factor G 0.00e+00 1.60e-83 0.0 0.7457
1. PBF B4RU35 Peptide chain release factor 3 1.10e-12 2.01e-13 9.98e-41 0.7529
1. PBF A6VU13 Peptide chain release factor 3 7.32e-13 1.16e-14 1.65e-42 0.7586
1. PBF A1T4L5 Elongation factor G 0.00e+00 1.06e-82 0.0 0.74
1. PBF B7LXT6 Peptide chain release factor 3 6.25e-13 7.38e-13 1.94e-43 0.7658
1. PBF B0U262 Peptide chain release factor 3 2.29e-11 8.37e-16 6.18e-40 0.7134
1. PBF B0BC74 Elongation factor G 0.00e+00 1.82e-84 0.0 0.9714
1. PBF Q8E0G1 Peptide chain release factor 3 1.19e-13 1.53e-13 9.86e-48 0.7637
1. PBF A8XT37 Translation factor GUF1 homolog, mitochondrial 1.49e-14 5.77e-18 1.08e-19 0.6427
1. PBF A3PEZ8 Elongation factor G 0.00e+00 4.03e-85 0.0 0.7376
1. PBF A8GMA0 Elongation factor G 0.00e+00 6.10e-80 0.0 0.7932
1. PBF O86490 Peptide chain release factor 3 1.51e-13 3.66e-15 1.96e-52 0.7556
1. PBF Q6FUQ6 Elongation factor G, mitochondrial 0.00e+00 2.08e-31 0.0 0.9365
1. PBF Q721H8 Peptide chain release factor 3 5.83e-14 5.30e-15 5.26e-47 0.7601
1. PBF Q1H0I2 Peptide chain release factor 3 2.71e-11 4.10e-15 9.93e-46 0.7387
1. PBF P0DA85 Elongation factor G 0.00e+00 5.25e-88 0.0 0.747
1. PBF B7IHU3 Elongation factor G 0.00e+00 1.72e-82 0.0 0.7304
1. PBF B6J6N8 Peptide chain release factor 3 3.28e-11 1.18e-16 1.34e-44 0.728
1. PBF Q73SD2 Elongation factor G 0.00e+00 9.94e-82 0.0 0.7577
1. PBF Q0SX36 Peptide chain release factor 3 6.67e-13 1.48e-12 1.59e-42 0.7569
1. PBF B9DYA6 Elongation factor G 0.00e+00 3.99e-83 0.0 0.7432
1. PBF B8DIL5 Peptide chain release factor 3 2.88e-13 1.23e-10 6.22e-48 0.7259
1. PBF C1GGI6 Translation factor GUF1, mitochondrial 1.13e-13 2.26e-10 2.43e-15 0.6151
1. PBF Q98QD8 Elongation factor G 0.00e+00 2.20e-89 0.0 0.7429
1. PBF Q29BD5 Ribosome-releasing factor 2, mitochondrial 0.00e+00 4.49e-44 1.56e-108 0.7674
1. PBF P28371 Elongation factor G 1 0.00e+00 9.69e-75 0.0 0.755
1. PBF P10952 Tetracycline resistance protein TetO 0.00e+00 2.38e-35 1.01e-61 0.8265
1. PBF C1CPU9 Peptide chain release factor 3 2.35e-13 1.35e-12 1.04e-46 0.7545
1. PBF Q38VL2 Peptide chain release factor 3 1.33e-13 1.91e-12 2.51e-44 0.7395
1. PBF B1LEH8 Peptide chain release factor 3 4.62e-13 4.54e-13 4.17e-43 0.7544
1. PBF Q6F823 Peptide chain release factor 3 1.04e-13 5.32e-16 5.30e-44 0.7693
1. PBF Q1GB78 Peptide chain release factor 3 2.05e-13 1.47e-14 7.59e-48 0.7508
1. PBF B0TC53 Elongation factor G 0.00e+00 4.25e-87 0.0 0.9911
1. PBF Q9Z9L7 Elongation factor G 0.00e+00 1.61e-92 0.0 0.7486
1. PBF A7HM55 Elongation factor G 0.00e+00 6.06e-81 0.0 0.9731
1. PBF B8DEE7 Peptide chain release factor 3 9.28e-14 5.30e-15 5.26e-47 0.7628
1. PBF A8G709 Elongation factor G 0.00e+00 8.36e-86 0.0 0.7365
1. PBF C5JRK2 Translation factor GUF1, mitochondrial 8.90e-14 3.16e-11 1.15e-14 0.6103
1. PBF Q0SMX0 Elongation factor G 1 0.00e+00 3.89e-71 0.0 0.7333
1. PBF Q8P0C7 Peptide chain release factor 3 1.91e-13 1.04e-13 6.46e-49 0.7581
1. PBF A6LPQ8 Elongation factor G 0.00e+00 7.02e-85 0.0 0.7468
1. PBF Q30Z38 Elongation factor G 0.00e+00 6.02e-85 0.0 0.7433
1. PBF A3CQM2 Elongation factor G 0.00e+00 7.20e-91 0.0 0.7461
1. PBF O52836 Tetracycline resistance protein TetW 0.00e+00 2.96e-34 2.05e-67 0.809
1. PBF B5XM60 Peptide chain release factor 3 9.69e-14 1.24e-13 9.06e-49 0.7558
1. PBF B8DAY6 Elongation factor G 0.00e+00 5.28e-87 0.0 0.8023
1. PBF P57508 50S ribosomal subunit assembly factor BipA 4.05e-08 1.05e-13 2.12e-23 0.6666
1. PBF Q03Q83 Peptide chain release factor 3 2.71e-13 3.23e-14 2.42e-51 0.7483
1. PBF Q1R270 Peptide chain release factor 3 3.43e-13 8.56e-12 4.75e-43 0.754
1. PBF B0USE8 Peptide chain release factor 3 2.51e-14 2.55e-15 1.96e-41 0.7812
1. PBF A8YU90 Peptide chain release factor 3 2.48e-13 1.85e-13 3.46e-45 0.7333
1. PBF P73473 Peptide chain release factor 3 1.95e-10 5.56e-13 1.20e-44 0.6904
1. PBF P9WNM6 Elongation factor G 0.00e+00 4.16e-84 0.0 0.738
1. PBF Q7W0G3 Peptide chain release factor 3 1.02e-11 3.18e-16 1.23e-41 0.7219
1. PBF Q3YSU3 Elongation factor G 0.00e+00 1.17e-80 0.0 0.8084
1. PBF Q30Q17 Elongation factor 4 7.55e-15 4.03e-17 3.41e-19 0.6625
1. PBF A2RP72 Elongation factor G 0.00e+00 7.22e-84 0.0 0.9645
1. PBF C1ET36 Elongation factor G 0.00e+00 1.89e-92 0.0 0.7447
1. PBF P0A557 Elongation factor G 0.00e+00 4.16e-84 0.0 0.748
1. PBF A5U070 Elongation factor G 0.00e+00 4.16e-84 0.0 0.7456
1. PBF Q0ANP7 Elongation factor G 0.00e+00 4.11e-79 0.0 0.7452
1. PBF C1L1Q9 Peptide chain release factor 3 1.86e-13 2.55e-15 1.25e-46 0.7621
1. PBF Q088A4 Elongation factor G 2 0.00e+00 9.35e-71 0.0 0.9618
1. PBF B2TIH2 Elongation factor G 0.00e+00 1.19e-86 0.0 0.746
1. PBF A8AYN4 Peptide chain release factor 3 2.16e-13 9.92e-13 5.09e-49 0.7612
1. PBF Q3YU19 Peptide chain release factor 3 0.00e+00 9.53e-13 1.38e-42 0.7639
1. PBF Q67MT5 Peptide chain release factor 3 2.23e-12 1.56e-14 2.66e-46 0.6809
1. PBF Q5U8S9 Elongation factor G 0.00e+00 1.50e-83 0.0 0.7426
1. PBF B4U741 Elongation factor G 0.00e+00 2.55e-82 0.0 0.7417
1. PBF B4RJN1 Peptide chain release factor 3 1.05e-12 1.46e-13 5.26e-42 0.7991
1. PBF B8I5N7 Elongation factor G 0.00e+00 3.22e-83 0.0 0.7982
1. PBF P47335 Elongation factor G 0.00e+00 6.83e-90 0.0 0.7477
1. PBF Q3K1T4 Peptide chain release factor 3 1.72e-13 1.53e-13 9.86e-48 0.7551
1. PBF Q8KTB7 Elongation factor G 0.00e+00 1.12e-81 0.0 0.7401
1. PBF Q47810 Tetracycline resistance protein TetM from transposon TnFO1 0.00e+00 3.34e-34 3.28e-61 0.8069
1. PBF C1CCK2 Peptide chain release factor 3 3.17e-13 1.35e-12 1.04e-46 0.7593
1. PBF Q6HPR1 Elongation factor G 0.00e+00 1.89e-92 0.0 0.7427
1. PBF Q0SFF3 Elongation factor G 0.00e+00 5.00e-85 0.0 0.9726
1. PBF Q0RRS4 Elongation factor G 0.00e+00 1.68e-80 0.0 0.9724
1. PBF A4QBG9 Elongation factor G 0.00e+00 4.16e-85 0.0 0.7362
1. PBF Q837X4 Peptide chain release factor 3 1.77e-13 1.57e-13 2.99e-46 0.7519
1. PBF Q4FUQ9 Peptide chain release factor 3 2.38e-12 4.39e-12 4.31e-43 0.751
1. PBF Q04Y01 Elongation factor G 0.00e+00 1.38e-62 0.0 0.942
1. PBF Q63H93 Elongation factor G 0.00e+00 6.78e-93 0.0 0.7436
1. PBF Q02S69 Peptide chain release factor 3 1.28e-12 8.85e-18 5.57e-50 0.7631
1. PBF P11131 Tetracycline resistance protein TetM from transposon Tn1545 0.00e+00 7.52e-36 1.09e-61 0.8168
1. PBF Q48712 Tetracycline resistance protein TetS 0.00e+00 6.45e-38 1.81e-63 0.7912
1. PBF Q7VNX4 Peptide chain release factor 3 2.12e-13 4.22e-15 5.33e-43 0.7541
1. PBF Q12JZ0 Elongation factor G 2 0.00e+00 7.21e-69 0.0 0.7428
1. PBF Q2S9X0 Peptide chain release factor 3 2.22e-16 8.10e-14 2.04e-44 0.7725
1. PBF B9DUR6 Peptide chain release factor 3 2.37e-13 5.73e-14 1.30e-47 0.7486
1. PBF Q031X0 Peptide chain release factor 3 4.31e-13 4.40e-14 1.77e-49 0.7388
1. PBF Q9PNR1 Elongation factor 4 0.00e+00 1.24e-19 1.28e-20 0.676
1. PBF A7H4P5 Elongation factor G 0.00e+00 1.07e-83 0.0 0.7868
1. PBF Q6CBI0 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.34e-49 4.44e-136 0.7344
1. PBF Q3IHI5 Peptide chain release factor 3 3.68e-13 2.44e-14 1.23e-38 0.7671
1. PBF Q3MDM4 Elongation factor G 0.00e+00 2.97e-84 0.0 0.7392
1. PBF B4NAU8 Ribosome-releasing factor 2, mitochondrial 0.00e+00 5.10e-43 3.63e-117 0.7762
1. PBF A3CLS9 Peptide chain release factor 3 1.10e-13 3.42e-14 1.91e-47 0.7581
1. PBF C1CB46 Elongation factor G 0.00e+00 1.94e-89 0.0 0.7466
1. PBF C3PMH0 Elongation factor G 0.00e+00 5.58e-80 0.0 0.7964
1. PBF Q6F0J4 Elongation factor G 0.00e+00 6.51e-107 0.0 0.7513
1. PBF Q5WY34 Peptide chain release factor 3 2.36e-11 1.05e-13 1.02e-39 0.7048
1. PBF A0RQX4 Elongation factor 4 8.88e-15 8.87e-19 3.88e-18 0.6721
1. PBF Q9ZHZ8 Elongation factor 4 0.00e+00 1.02e-17 1.52e-19 0.5889
1. PBF A8AUR6 Elongation factor G 0.00e+00 1.36e-90 0.0 0.7461
1. PBF Q98QW3 Elongation factor 4 0.00e+00 3.97e-17 9.27e-21 0.6708
1. PBF A6RLH0 Elongation factor G, mitochondrial 0.00e+00 1.12e-18 0.0 0.7312
1. PBF P47384 Elongation factor 4 0.00e+00 9.45e-17 1.02e-19 0.6969
1. PBF B9WBR8 Translation factor GUF1, mitochondrial 1.49e-13 5.35e-12 7.58e-17 0.6025
1. PBF A6VN03 Peptide chain release factor 3 3.11e-14 1.74e-14 1.90e-42 0.7745
1. PBF O30913 Elongation factor G 1 0.00e+00 1.71e-72 0.0 0.9492
1. PBF Q2IK81 Elongation factor G 2 0.00e+00 7.67e-63 0.0 0.9461
1. PBF A8A8A3 Peptide chain release factor 3 5.11e-13 7.19e-13 2.59e-43 0.7553
1. PBF Q14JV7 Peptide chain release factor 3 1.34e-13 4.40e-15 5.02e-41 0.766
1. PBF Q88PH8 Peptide chain release factor 3 2.21e-11 5.95e-17 3.90e-49 0.7153
1. PBF A8GQV7 Elongation factor G 0.00e+00 2.56e-80 0.0 0.7936
1. PBF Q0CLP3 Elongation factor G, mitochondrial 0.00e+00 5.40e-16 5.54e-179 0.7266
1. PBF Q7UZY6 Elongation factor G 0.00e+00 3.98e-86 0.0 0.7369
1. PBF B7L0Q8 Elongation factor G 0.00e+00 3.46e-80 0.0 0.7437
1. PBF A0KU03 Peptide chain release factor 3 2.55e-13 1.15e-15 2.09e-39 0.7489
1. PBF B1VET0 Elongation factor G 0.00e+00 2.94e-83 0.0 0.7392
1. PBF Q1WUZ8 Peptide chain release factor 3 2.12e-13 1.10e-13 8.00e-49 0.7407
1. PBF Q46306 Tetracycline resistance protein TetP 0.00e+00 2.27e-39 6.70e-69 0.8218
1. PBF B7UR02 Peptide chain release factor 3 6.53e-13 4.54e-13 4.17e-43 0.7513
1. PBF Q5FUP6 Elongation factor G 0.00e+00 5.54e-79 0.0 0.9621
1. PBF Q3KLR3 Elongation factor G 0.00e+00 1.92e-85 0.0 0.9732
1. PBF Q8DV91 Peptide chain release factor 3 9.55e-14 3.97e-13 7.70e-51 0.7699
1. PBF B9DKV7 Elongation factor G 0.00e+00 1.89e-86 0.0 0.7472
1. PBF A8H733 Peptide chain release factor 3 1.78e-13 8.24e-15 1.72e-40 0.7567
1. PBF A1R8V0 Elongation factor G 0.00e+00 9.54e-87 0.0 0.7378
1. PBF B7IT16 Elongation factor G 0.00e+00 7.49e-92 0.0 0.7445
1. PBF B8IS82 Elongation factor G 0.00e+00 4.77e-79 0.0 0.7429
1. PBF A3DIZ9 Elongation factor G 0.00e+00 1.38e-87 0.0 0.7457
1. PBF A5I7K9 Elongation factor G 0.00e+00 4.40e-89 0.0 0.7421
1. PBF Q8ZIR0 Peptide chain release factor 3 1.60e-13 8.44e-14 5.96e-44 0.7668
1. PBF Q5H1V2 Peptide chain release factor 3 3.47e-12 2.15e-14 4.63e-37 0.6934
1. PBF Q73IX7 Elongation factor G 0.00e+00 8.19e-81 0.0 0.8504
1. PBF Q487B0 Peptide chain release factor 3 5.14e-13 8.13e-15 1.24e-39 0.7601
1. PBF C1GX39 Translation factor GUF1, mitochondrial 8.64e-14 3.63e-11 2.79e-15 0.6144
1. PBF A5IYS0 Elongation factor 4 1.17e-14 6.13e-17 1.17e-19 0.6774
1. PBF B0TWY6 Peptide chain release factor 3 4.01e-12 1.92e-14 1.82e-41 0.7273
1. PBF B9DQA0 Peptide chain release factor 3 1.60e-13 2.25e-14 1.53e-50 0.7463
1. PBF Q8R602 Elongation factor G 0.00e+00 8.25e-89 0.0 0.9867
1. PBF A1CLD7 Translation factor guf1, mitochondrial 0.00e+00 2.69e-10 7.01e-15 0.6086
1. PBF Q30TP3 Elongation factor G 0.00e+00 2.98e-80 0.0 0.7502
1. PBF Q0BKK2 Peptide chain release factor 3 2.03e-13 6.66e-15 1.48e-40 0.7726
1. PBF Q8NT19 Elongation factor G 0.00e+00 1.11e-83 0.0 0.7373
1. PBF Q7Q1K8 Elongation factor G, mitochondrial 0.00e+00 5.89e-44 0.0 0.7304
1. PBF A5VL77 Peptide chain release factor 3 1.39e-13 7.48e-13 9.82e-47 0.7423
1. PBF B1XFI4 Peptide chain release factor 3 3.26e-13 4.54e-13 4.17e-43 0.7545
1. PBF Q7W2S3 Peptide chain release factor 3 1.09e-11 3.18e-16 1.06e-40 0.7056
1. PBF Q30V54 Peptide chain release factor 3 5.87e-11 3.14e-14 3.91e-48 0.7121
1. PBF C3LSR4 Peptide chain release factor 3 1.10e-12 5.06e-13 1.85e-39 0.7477
1. PBF Q6CRY5 Elongation factor G, mitochondrial 0.00e+00 4.37e-32 0.0 0.9466
1. PBF Q2FJ93 Elongation factor G 0.00e+00 6.53e-86 0.0 0.7481
1. PBF Q38UQ9 Elongation factor G 0.00e+00 2.92e-87 0.0 0.7473
1. PBF Q48VB6 Elongation factor G 0.00e+00 5.25e-88 0.0 0.7427
1. PBF Q9ZLZ3 50S ribosomal subunit assembly factor BipA 1.68e-07 3.23e-16 1.72e-27 0.5918
1. PBF A4Y9B3 Peptide chain release factor 3 1.27e-12 2.04e-14 6.06e-40 0.747
1. PBF P39883 Peptide chain release factor 3 6.28e-12 2.39e-12 5.32e-34 0.719
1. PBF Q4QJL3 Peptide chain release factor 3 6.02e-13 7.48e-13 2.69e-42 0.7586
1. PBF Q04VH3 Elongation factor G 0.00e+00 2.41e-62 0.0 0.9541
1. PBF C5FMX6 Translation factor GUF1, mitochondrial 4.25e-13 5.45e-09 2.02e-16 0.5816
1. PBF A7GK17 Elongation factor G 0.00e+00 8.44e-91 0.0 0.7439
1. PBF A1VA24 Peptide chain release factor 3 4.74e-11 1.04e-11 9.61e-46 0.7023
1. PBF B1KRQ3 Peptide chain release factor 3 1.41e-12 4.16e-15 1.97e-37 0.7497
1. PBF P0CN33 Elongation factor G, mitochondrial 0.00e+00 1.33e-13 2.00e-177 0.7263
1. PBF Q8ETY5 Elongation factor G 0.00e+00 7.03e-92 0.0 0.7474
1. PBF P57608 Peptide chain release factor 3 9.56e-13 2.44e-14 7.58e-46 0.7653
1. PBF Q037T6 Peptide chain release factor 3 1.84e-13 1.54e-12 1.97e-43 0.7453
1. PBF Q8XPH8 Peptide chain release factor 3 1.77e-11 1.08e-13 4.28e-41 0.7245
1. PBF Q31KM4 Peptide chain release factor 3 3.48e-12 1.45e-14 3.04e-45 0.7011
1. PBF A4FPM8 Elongation factor G 0.00e+00 5.93e-83 0.0 0.8578
1. PBF Q4WP57 Elongation factor G, mitochondrial 0.00e+00 7.12e-17 5.07e-178 0.7281
1. PBF A9R055 Peptide chain release factor 3 2.29e-14 8.44e-14 5.96e-44 0.7686
1. PBF Q5L400 Elongation factor G 0.00e+00 5.14e-89 0.0 0.7484
1. PBF B1JL43 Peptide chain release factor 3 1.15e-13 1.82e-13 5.05e-44 0.7744
1. PBF Q5HIC8 Elongation factor G 0.00e+00 6.53e-86 0.0 0.747
1. PBF A5FV42 Elongation factor G 0.00e+00 1.66e-78 0.0 0.9736
1. PBF Q17VN9 Elongation factor G 0.00e+00 2.77e-83 0.0 0.7424
1. PBF Q04C17 Elongation factor G 0.00e+00 2.01e-86 0.0 0.7424
1. PBF B2GIL1 Elongation factor G 0.00e+00 5.22e-81 0.0 0.7397
1. PBF P09952 Elongation factor G 0.00e+00 9.55e-80 0.0 0.9721
1. PBF Q041Z5 Peptide chain release factor 3 2.01e-13 4.91e-14 5.43e-48 0.7351
1. PBF P72749 50S ribosomal subunit assembly factor BipA 7.47e-08 2.93e-17 2.19e-22 0.6528
1. PBF B3PME9 Elongation factor G 0.00e+00 5.32e-84 0.0 0.7435
1. PBF A7FZ72 Elongation factor G 0.00e+00 4.40e-89 0.0 0.7423
1. PBF Q4P257 Elongation factor G, mitochondrial 0.00e+00 1.29e-15 4.18e-179 0.7203
1. PBF Q3BQQ3 Peptide chain release factor 3 2.06e-11 1.45e-14 1.04e-36 0.6787
1. PBF A0RQI0 Elongation factor G 0.00e+00 1.95e-87 0.0 0.7412
1. PBF B6I2Q6 Peptide chain release factor 3 2.56e-13 7.19e-13 2.59e-43 0.763
1. PBF A9HW20 Peptide chain release factor 3 8.88e-12 4.09e-16 3.59e-44 0.6973
1. PBF Q39Y09 Elongation factor G 1 0.00e+00 2.46e-81 0.0 0.9902
3. BF Q5PBH1 Elongation factor Tu 2.17e-05 NA 2.08e-04 0.5838
3. BF P0A559 Elongation factor Tu 2.36e-05 NA 4.26e-08 0.5622
3. BF A1UBL1 Elongation factor Tu 2.66e-05 NA 8.62e-08 0.5708
3. BF Q8EWU0 Translation initiation factor IF-2 7.81e-05 NA 1.75e-09 0.2222
3. BF Q8F7K1 Translation initiation factor IF-2 4.37e-04 NA 8.19e-05 0.3488
3. BF A3PV96 Elongation factor Tu 2.48e-05 NA 8.62e-08 0.5621
3. BF C0ZVT7 Elongation factor Tu 2.36e-05 NA 4.83e-04 0.5623
3. BF A0JZ88 Elongation factor Tu 1.21e-05 NA 4.68e-06 0.5703
3. BF Q0RRS3 Elongation factor Tu 1.60e-05 NA 1.53e-08 0.564
3. BF B2HSL3 Elongation factor Tu 2.32e-05 NA 1.27e-07 0.5632
3. BF P29542 Elongation factor Tu-1 1.18e-05 NA 1.76e-07 0.5689
3. BF B2GIL2 Elongation factor Tu 1.18e-05 NA 2.34e-05 0.5802
3. BF Q9XD38 Elongation factor Tu 1.68e-05 NA 6.05e-07 0.551
3. BF A8EW02 Elongation factor Tu 8.43e-06 NA 1.10e-07 0.5577
3. BF B8DTV7 Elongation factor Tu 1.35e-05 NA 2.80e-07 0.5542
3. BF A1KGG5 Elongation factor Tu 2.41e-05 NA 4.26e-08 0.5632
3. BF A5K6I6 Translation factor GUF1 homolog, mitochondrial 9.70e-11 NA 1.25e-21 0.5487
3. BF P17889 Translation initiation factor IF-2 1.90e-05 NA 7.02e-07 0.5643
3. BF Q8FS84 Elongation factor Tu 1.12e-05 NA 5.85e-04 0.5678
3. BF B0SAF6 Elongation factor Tu 1.64e-05 NA 4.19e-08 0.5525
3. BF B0SSH9 Elongation factor Tu 1.70e-05 NA 4.19e-08 0.5517
3. BF A6Q6H4 Elongation factor Tu 1.39e-05 NA 2.73e-07 0.5478
3. BF P50068 Elongation factor Tu 9.31e-06 NA 3.98e-10 0.5787
3. BF A5CCL4 Elongation factor Tu 2 1.50e-05 NA 2.71e-11 0.5715
3. BF A9ETD1 Elongation factor Tu 3.86e-05 NA 7.94e-05 0.5549
3. BF P72231 Elongation factor Tu 1.23e-05 NA 1.81e-07 0.5615
3. BF A1A0T1 Elongation factor Tu 1.12e-05 NA 1.41e-06 0.5547
3. BF B0BQZ3 Elongation factor Tu 1.86e-05 NA 6.88e-09 0.5582
3. BF Q82DQ0 Elongation factor Tu 1 1.23e-05 NA 1.14e-08 0.5651
3. BF Q2JFH8 Elongation factor Tu 1.65e-05 NA 6.03e-08 0.5622
3. BF A5U071 Elongation factor Tu 2.42e-05 NA 4.26e-08 0.5624
3. BF Q6NJD5 Elongation factor Tu 1.15e-05 NA 6.38e-04 0.5705
3. BF Q72NF9 Elongation factor Tu 1.70e-05 NA 6.05e-07 0.551
3. BF P95724 Elongation factor Tu 1.11e-05 NA 4.80e-07 0.5548
3. BF C5CC66 Elongation factor Tu 1.35e-05 NA 9.67e-06 0.5713
3. BF P9WNN0 Elongation factor Tu 2.64e-05 NA 4.26e-08 0.5718
3. BF A0QS98 Elongation factor Tu 2.28e-05 NA 2.73e-07 0.5606
3. BF B3L3C9 Translation factor GUF1 homolog, mitochondrial 3.53e-11 NA 5.62e-22 0.5749
3. BF B7GU46 Elongation factor Tu 1.12e-05 NA 2.05e-06 0.557
3. BF B8ZSC1 Elongation factor Tu 2.36e-05 NA 1.76e-07 0.5612
3. BF A6LSQ4 Translation initiation factor IF-2 9.28e-06 NA 3.09e-07 0.5481
3. BF A4YBY5 Elongation factor Tu 1.69e-05 NA 3.51e-10 0.5638
3. BF P42439 Elongation factor Tu 2.03e-05 NA 4.24e-04 0.5723
3. BF P30768 Elongation factor Tu 2.35e-05 NA 1.76e-07 0.5615
3. BF Q4JT41 Elongation factor Tu 1.34e-05 NA 5.65e-04 0.5652
3. BF Q1AW55 Translation initiation factor IF-2 3.95e-05 NA 3.16e-07 0.3557
3. BF A0LRL8 Elongation factor Tu 3.64e-05 NA 5.43e-08 0.5684
3. BF Q12AU7 Translation initiation factor IF-2 2.32e-03 NA 8.01e-05 0.5422
3. BF Q0SFF4 Elongation factor Tu 2.45e-05 NA 7.96e-07 0.5586
3. BF A4FPM7 Elongation factor Tu 1.42e-05 NA 2.83e-07 0.5645
3. BF Q73SD1 Elongation factor Tu 2.25e-05 NA 3.91e-07 0.5618
3. BF A8F5A0 Translation initiation factor IF-2 5.20e-04 NA 2.14e-09 0.3929
3. BF P42471 Elongation factor Tu 1.17e-05 NA 8.96e-08 0.5654
3. BF A6W5T5 Elongation factor Tu 1.47e-05 NA 8.99e-09 0.5561
3. BF P40174 Elongation factor Tu-1 1.25e-05 NA 1.89e-08 0.5642
3. BF A0PM42 Elongation factor Tu 2.53e-05 NA 1.27e-07 0.5629
3. BF A5CCA0 Elongation factor Tu 1 1.44e-05 NA 2.01e-11 0.5716
3. BF A1SNN5 Elongation factor Tu 1.32e-05 NA 3.15e-07 0.5556
3. BF Q6A6L7 Elongation factor Tu 1.43e-05 NA 1.30e-08 0.5645
3. BF B1VET1 Elongation factor Tu 1.25e-05 NA 4.42e-04 0.559
3. BF Q53871 Elongation factor Tu-1 1.20e-05 NA 1.11e-08 0.5668
3. BF C3PKP2 Elongation factor Tu 1.07e-05 NA 7.47e-05 0.562
3. BF Q03YI2 Elongation factor Tu 1.58e-05 NA 1.11e-07 0.5585
3. BF Q7UMZ0 Elongation factor Tu 3.99e-05 NA 7.67e-06 0.5595
3. BF C1AYS3 Elongation factor Tu 2.47e-05 NA 7.96e-07 0.563
3. BF Q055E6 Elongation factor Tu 1.68e-05 NA 4.90e-07 0.5583
3. BF P35450 Elongation factor G, chloroplastic (Fragment) 3.69e-14 NA 6.38e-59 0.9829
3. BF C5C0J3 Elongation factor Tu 1.20e-05 NA 7.21e-05 0.5682
3. BF Q8G5B7 Elongation factor Tu 1.12e-05 NA 2.02e-06 0.5587
3. BF A4XBP8 Elongation factor Tu 1.47e-05 NA 6.08e-07 0.5597
3. BF Q1BDD3 Elongation factor Tu 2.64e-05 NA 8.62e-08 0.5708
3. BF A1T4L6 Elongation factor Tu 2.44e-05 NA 3.46e-07 0.5621
3. BF B8HD11 Elongation factor Tu 1.18e-05 NA 5.52e-06 0.5706
3. BF C1AL18 Elongation factor Tu 2.40e-05 NA 4.26e-08 0.5637
3. BF A9WSW5 Elongation factor Tu 1.26e-05 NA 5.15e-06 0.5696
3. BF A1R8U9 Elongation factor Tu 1.30e-05 NA 1.37e-05 0.5757
3. BF A0QL35 Elongation factor Tu 2.28e-05 NA 3.91e-07 0.5627
3. BF A4T1R2 Elongation factor Tu 2.64e-05 NA 5.09e-07 0.5617
3. BF Q2GJ61 Elongation factor Tu 1.74e-05 NA 1.66e-04 0.5771
3. BF Q47LJ1 Elongation factor Tu 1.40e-05 NA 1.10e-07 0.5575
3. BF A5UYI1 Elongation factor Tu 2 1.50e-05 NA 7.75e-08 0.5463
3. BF Q47D94 Translation initiation factor IF-2 1.72e-04 NA 6.87e-05 0.5719
3. BF C5CDZ4 Translation initiation factor IF-2 2.18e-04 NA 1.37e-09 0.383
3. BF A8LC58 Elongation factor Tu 1.52e-05 NA 2.17e-08 0.555
3. BF O33594 Elongation factor Tu 1.23e-05 NA 1.18e-08 0.5635
3. BF A4QBH0 Elongation factor Tu 1.98e-05 NA 4.66e-04 0.5713
3. BF P09953 Elongation factor Tu 1.33e-05 NA 1.28e-05 0.5705
3. BF Q04PT6 Elongation factor Tu 1.65e-05 NA 4.90e-07 0.5609
3. BF Q5YPG4 Elongation factor Tu 2.29e-05 NA 1.85e-06 0.5741
3. BF B1MGH7 Elongation factor Tu 1.38e-05 NA 2.67e-07 0.5644
3. BF A8M531 Elongation factor Tu 1.50e-05 NA 1.11e-07 0.5572
3. BF A5CW32 Elongation factor Tu 1.41e-05 NA 1.51e-07 0.5656
3. BF B3EP63 Elongation factor Tu 1.28e-05 NA 5.08e-11 0.5704
3. BF P42473 Elongation factor Tu 1.34e-05 NA 2.14e-11 0.5708
3. BF A8FDD1 Translation initiation factor IF-2 1.68e-05 NA 7.35e-07 0.5623
3. BF C4LL63 Elongation factor Tu 2.32e-05 NA 2.20e-04 0.5645
3. BF B3DT29 Elongation factor Tu 1.11e-05 NA 2.02e-06 0.5608
3. BF A7HN01 Translation initiation factor IF-2 8.33e-06 NA 7.67e-09 0.3822
4. PB A7ZQ13 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB P14864 Elongation factor 1-alpha 3.93e-05 2.12e-04 1.23e-06 NA
4. PB Q8DTF3 Elongation factor 4 2.55e-15 1.76e-16 2.89e-19 NA
4. PB Q1QX26 Elongation factor 4 0.00e+00 4.45e-19 5.24e-18 NA
4. PB C6DC02 Elongation factor 4 9.77e-15 1.05e-17 1.06e-19 NA
4. PB Q11AY3 Elongation factor 4 0.00e+00 1.21e-18 4.26e-17 NA
4. PB A2C0M8 Elongation factor 4 0.00e+00 5.85e-20 3.81e-19 NA
4. PB B7N6F7 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q9HDF6 Elongation factor 1-alpha 3.56e-05 4.51e-05 1.68e-06 NA
4. PB A4FWE9 Elongation factor 1-alpha 1.25e-05 9.14e-03 2.44e-12 NA
4. PB P17197 Elongation factor 1-alpha 1.99e-05 9.92e-04 2.45e-09 NA
4. PB Q6A9B2 Elongation factor 4 0.00e+00 2.69e-19 3.90e-20 NA
4. PB B4UDQ7 Elongation factor 4 0.00e+00 3.05e-16 1.99e-21 NA
4. PB Q823H7 Elongation factor 4 3.89e-13 5.77e-17 2.92e-21 NA
4. PB Q8DPN5 Elongation factor 4 2.55e-15 2.55e-16 2.13e-18 NA
4. PB A9KD34 Elongation factor G 0.00e+00 4.56e-75 0.0 NA
4. PB B1IGF6 Elongation factor Tu 1.69e-05 3.12e-02 4.07e-10 NA
4. PB Q0W8X2 Probable translation initiation factor IF-2 5.75e-04 1.15e-07 1.62e-04 NA
4. PB B1W417 Elongation factor G 0.00e+00 5.56e-77 0.0 NA
4. PB B1LHE0 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q4DKF7 Translation factor GUF1 homolog 1, mitochondrial 4.06e-09 6.37e-13 1.14e-15 NA
4. PB B9RHQ5 Translation factor GUF1 homolog, chloroplastic 1.11e-16 1.04e-08 1.96e-18 NA
4. PB C4K153 Elongation factor 4 0.00e+00 8.71e-18 7.23e-19 NA
4. PB C1F2I3 Elongation factor 4 5.94e-14 1.75e-17 5.67e-21 NA
4. PB B7KJX0 Elongation factor 4 0.00e+00 5.94e-18 2.54e-17 NA
4. PB Q21IH3 Elongation factor 4 6.22e-15 1.16e-19 2.01e-18 NA
4. PB A9A9U3 Elongation factor 1-alpha 1.27e-05 1.52e-02 2.72e-12 NA
4. PB Q0I0A7 Elongation factor Tu 2 1.63e-05 3.62e-02 3.98e-10 NA
4. PB B1IPV9 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A1R6W8 Elongation factor 4 2.05e-13 2.25e-18 9.73e-20 NA
4. PB Q27140 Elongation factor 1-alpha 2 2.85e-05 5.62e-04 2.28e-07 NA
4. PB C5DN84 Translation factor GUF1, mitochondrial 1.37e-09 5.56e-13 5.96e-19 NA
4. PB Q48TU0 Elongation factor 4 6.88e-15 6.71e-17 3.47e-18 NA
4. PB A3NBT1 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q1BRT3 Elongation factor Tu 1.28e-05 3.90e-02 1.82e-11 NA
4. PB B1KI55 Elongation factor 4 0.00e+00 3.53e-18 3.60e-19 NA
4. PB Q2P4M4 Elongation factor 4 0.00e+00 5.34e-18 1.18e-16 NA
4. PB Q3YSC2 Elongation factor 4 0.00e+00 3.26e-17 1.03e-16 NA
4. PB Q6LXI1 Elongation factor 1-alpha 1.25e-05 3.70e-03 1.07e-12 NA
4. PB B8I3E6 Elongation factor 4 8.89e-14 1.82e-16 4.52e-20 NA
4. PB Q5XCD2 Elongation factor 4 0.00e+00 6.04e-17 3.51e-18 NA
4. PB Q466D5 Probable translation initiation factor IF-2 6.65e-04 3.82e-08 8.90e-06 NA
4. PB Q59QD6 Elongation factor 1-alpha 2 5.75e-05 3.75e-04 1.32e-06 NA
4. PB A8GI27 Elongation factor 4 0.00e+00 5.85e-18 6.13e-20 NA
4. PB Q87XF8 Elongation factor 4 0.00e+00 1.05e-17 2.12e-19 NA
4. PB A1WVC5 Elongation factor G 0.00e+00 1.13e-78 0.0 NA
4. PB C8ZDQ3 Translation factor GUF1, mitochondrial 7.34e-09 2.29e-11 6.95e-18 NA
4. PB Q8XV10 Elongation factor G 1 0.00e+00 1.30e-76 0.0 NA
4. PB B7M8I2 Elongation factor 4 0.00e+00 1.26e-17 2.02e-19 NA
4. PB Q875S0 Elongation factor 2 2.24e-14 5.38e-31 6.91e-23 NA
4. PB B0RU85 Elongation factor G 0.00e+00 1.00e-78 0.0 NA
4. PB A9WH62 Elongation factor G 0.00e+00 1.54e-79 0.0 NA
4. PB Q15YA7 Elongation factor G 2 0.00e+00 1.69e-76 0.0 NA
4. PB C0Q0C2 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q5PIW3 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q8TYP6 Elongation factor 1-alpha 4.12e-05 1.88e-04 1.44e-12 NA
4. PB B3QZT9 Elongation factor 4 3.50e-13 8.64e-17 9.81e-18 NA
4. PB A6H1S4 Elongation factor 4 0.00e+00 3.52e-17 2.95e-17 NA
4. PB Q5PNC0 Elongation factor 4 0.00e+00 1.46e-18 2.97e-19 NA
4. PB Q0TNS2 Elongation factor 4 0.00e+00 2.48e-16 1.59e-19 NA
4. PB A1SSM6 Elongation factor 4 0.00e+00 5.28e-17 1.06e-19 NA
4. PB A5UJM9 Probable translation initiation factor IF-2 7.90e-04 1.21e-06 2.09e-07 NA
4. PB Q0SRD8 Elongation factor 4 0.00e+00 2.41e-16 1.57e-19 NA
4. PB A1KT27 Elongation factor 4 3.93e-14 2.63e-18 9.91e-20 NA
4. PB B8ENL1 Elongation factor 4 0.00e+00 3.58e-18 3.62e-16 NA
4. PB A9B746 Elongation factor G 0.00e+00 3.56e-80 0.0 NA
4. PB Q88T65 Elongation factor 4 2 4.44e-16 1.31e-18 1.76e-17 NA
4. PB Q8C3X4 Translation factor Guf1, mitochondrial 2.50e-14 2.03e-13 4.50e-20 NA
4. PB Q7N1X3 Elongation factor 4 0.00e+00 1.68e-17 2.82e-18 NA
4. PB B0KA85 Elongation factor 4 1.11e-16 4.75e-17 6.28e-19 NA
4. PB Q5H1R5 Elongation factor 4 0.00e+00 5.34e-18 1.18e-16 NA
4. PB P0DC22 Elongation factor 4 3.44e-15 5.20e-17 1.30e-18 NA
4. PB Q2W0F9 Elongation factor 4 7.33e-15 6.42e-18 1.22e-16 NA
4. PB Q3J5S5 Elongation factor G 0.00e+00 1.30e-73 0.0 NA
4. PB Q1LAN7 Elongation factor G 2 0.00e+00 1.20e-75 0.0 NA
4. PB Q1ACI3 Elongation factor Tu, chloroplastic 1.19e-05 3.42e-02 5.63e-09 NA
4. PB Q73HR8 Elongation factor 4 0.00e+00 1.84e-16 5.90e-17 NA
4. PB A4TKY0 Elongation factor 4 1.12e-14 4.65e-18 5.49e-19 NA
4. PB Q38BU9 Translation factor GUF1 homolog, mitochondrial 1.18e-09 1.02e-08 1.30e-16 NA
4. PB Q4QMT6 Elongation factor G 0.00e+00 1.24e-77 0.0 NA
4. PB C3L5S2 Elongation factor 4 3.22e-15 1.63e-17 1.29e-18 NA
4. PB A1KB30 Elongation factor G 0.00e+00 1.79e-79 0.0 NA
4. PB O74945 Ribosome assembly protein 1 2.12e-08 2.17e-21 2.92e-18 NA
4. PB B8AI54 Translation factor GUF1 homolog, chloroplastic 2.22e-16 3.87e-19 1.41e-18 NA
4. PB Q7U5L9 Elongation factor 4 1.11e-16 1.46e-18 1.95e-19 NA
4. PB A7GZW3 Elongation factor 4 0.00e+00 5.76e-20 9.71e-20 NA
4. PB B8F7Z4 Elongation factor G 0.00e+00 9.49e-76 0.0 NA
4. PB D0NKK0 Translation factor GUF1 homolog, mitochondrial 1.11e-16 3.67e-10 1.72e-17 NA
4. PB Q889X4 Elongation factor G 0.00e+00 1.73e-73 0.0 NA
4. PB P60790 Elongation factor 4 0.00e+00 3.02e-17 5.74e-16 NA
4. PB P61878 Elongation factor 2 0.00e+00 9.81e-40 3.67e-73 NA
4. PB Q3MG20 Elongation factor 4 0.00e+00 7.93e-20 1.90e-18 NA
4. PB Q97QK5 Elongation factor 4 2.11e-15 1.71e-16 1.80e-18 NA
4. PB B0TX03 Elongation factor Tu 1.60e-05 2.23e-02 3.25e-09 NA
4. PB C4KHE9 Elongation factor 2 1.68e-14 2.22e-39 4.70e-70 NA
4. PB B2JFK0 Elongation factor 4 1.48e-14 2.05e-16 2.68e-19 NA
4. PB P56893 Sulfate adenylyltransferase subunit 1 4.83e-05 1.38e-02 0.004 NA
4. PB O25122 Elongation factor 4 0.00e+00 2.54e-20 1.08e-17 NA
4. PB B0U0Z1 Elongation factor G 0.00e+00 6.10e-78 0.0 NA
4. PB A3MTU7 Probable translation initiation factor IF-2 3.11e-04 3.78e-08 1.69e-06 NA
4. PB A1BHJ8 Elongation factor 4 3.27e-13 7.95e-19 8.91e-20 NA
4. PB Q07803 Elongation factor G, mitochondrial 0.00e+00 1.07e-34 0.0 NA
4. PB A7HCF3 Elongation factor 4 0.00e+00 1.41e-16 6.88e-24 NA
4. PB A3DMV6 Elongation factor 2 0.00e+00 1.74e-37 1.75e-63 NA
4. PB Q9SI75 Elongation factor G, chloroplastic 0.00e+00 5.29e-19 0.0 NA
4. PB C4ZYJ2 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB O64937 Elongation factor 1-alpha 4.80e-05 5.13e-05 1.10e-06 NA
4. PB Q16BA3 Elongation factor 4 0.00e+00 4.18e-18 8.53e-17 NA
4. PB Q9KD76 Elongation factor 4 1.11e-16 5.18e-18 3.18e-18 NA
4. PB A2CBG9 Elongation factor 4 0.00e+00 1.96e-19 1.13e-18 NA
4. PB A1A0T0 Elongation factor G 0.00e+00 6.29e-78 0.0 NA
4. PB A5UBC2 Elongation factor 4 1.24e-14 1.32e-17 2.35e-19 NA
4. PB Q6FLG2 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.78e-42 1.95e-112 NA
4. PB Q9FNM5 Translation factor GUF1 homolog, chloroplastic 3.56e-13 4.87e-07 5.31e-19 NA
4. PB B4RVA8 Elongation factor 4 0.00e+00 5.85e-18 7.37e-19 NA
4. PB Q98DV1 Elongation factor 4 0.00e+00 1.55e-17 3.31e-17 NA
4. PB Q92BN4 Elongation factor 4 6.55e-15 6.22e-18 9.23e-20 NA
4. PB A5N4N1 Elongation factor Tu 1.77e-05 4.96e-02 9.69e-10 NA
4. PB B6J266 Elongation factor G 0.00e+00 1.16e-73 0.0 NA
4. PB P59451 Elongation factor G 0.00e+00 3.04e-75 0.0 NA
4. PB Q6AL53 Elongation factor 4 1.75e-14 2.80e-18 1.94e-17 NA
4. PB C1FVU4 Elongation factor 4 5.76e-14 6.51e-17 1.43e-18 NA
4. PB B9DNK4 Elongation factor 4 5.75e-14 5.06e-20 3.72e-19 NA
4. PB A6VIS4 Probable translation initiation factor IF-2 2.59e-04 6.99e-08 0.004 NA
4. PB P60789 Elongation factor 4 0.00e+00 8.71e-18 8.72e-18 NA
4. PB A4FUD3 116 kDa U5 small nuclear ribonucleoprotein component 5.87e-12 5.38e-15 4.00e-25 NA
4. PB B0U5X3 Elongation factor G 0.00e+00 2.71e-69 0.0 NA
4. PB Q3J4P0 Elongation factor 4 1.51e-14 1.29e-18 2.40e-18 NA
4. PB Q9CGI8 Elongation factor 4 2.44e-15 4.75e-17 6.82e-20 NA
4. PB P13549 Elongation factor 1-alpha, somatic form 3.85e-05 8.32e-05 1.62e-06 NA
4. PB P32186 Elongation factor 1-alpha 5.52e-05 9.93e-05 1.32e-05 NA
4. PB P39677 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.79e-39 9.85e-121 NA
4. PB P0A1H3 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB P29691 Elongation factor 2 7.21e-13 3.77e-29 1.03e-21 NA
4. PB A3Q980 Elongation factor Tu 2 1.74e-05 4.24e-02 1.98e-09 NA
4. PB A7TPD4 Translation factor GUF1, mitochondrial 1.50e-12 2.83e-10 1.45e-18 NA
4. PB Q6G1F5 Elongation factor 4 0.00e+00 6.93e-18 8.87e-19 NA
4. PB B3Q991 Elongation factor 4 0.00e+00 1.99e-18 2.68e-16 NA
4. PB C5CP58 Elongation factor G 0.00e+00 6.29e-80 0.0 NA
4. PB C0RJK4 Elongation factor G 0.00e+00 5.22e-81 0.0 NA
4. PB Q9HJ60 Probable translation initiation factor IF-2 1.09e-03 1.78e-08 7.02e-04 NA
4. PB A1RUX2 Probable translation initiation factor IF-2 3.18e-04 2.10e-07 1.07e-06 NA
4. PB Q83MZ5 Elongation factor 4 5.07e-14 1.02e-16 4.43e-19 NA
4. PB Q83ES7 Elongation factor G 0.00e+00 8.20e-74 0.0 NA
4. PB Q0HG96 Elongation factor 4 0.00e+00 2.15e-18 9.79e-19 NA
4. PB A0Q4I1 Elongation factor G 0.00e+00 7.51e-76 0.0 NA
4. PB Q7MHN6 Elongation factor 4 0.00e+00 4.87e-18 7.72e-18 NA
4. PB Q6CUH2 Translation factor GUF1, mitochondrial 9.61e-10 2.57e-13 7.18e-17 NA
4. PB Q5AL45 Elongation factor G, mitochondrial 0.00e+00 1.44e-29 0.0 NA
4. PB B9LJC8 Elongation factor G 0.00e+00 1.54e-79 0.0 NA
4. PB B2VI44 Elongation factor 4 1.32e-14 3.12e-18 2.78e-18 NA
4. PB Q2YJP8 Elongation factor 4 0.00e+00 1.38e-17 3.98e-18 NA
4. PB A4JCQ9 Elongation factor 4 0.00e+00 3.85e-17 1.13e-18 NA
4. PB B7GKC4 Elongation factor 4 0.00e+00 6.51e-17 1.47e-19 NA
4. PB A0KGF0 Elongation factor 4 1.67e-14 6.34e-20 1.17e-17 NA
4. PB Q2JDK2 Elongation factor 4 8.18e-14 1.45e-19 2.11e-16 NA
4. PB A0Q453 Elongation factor 4 0.00e+00 3.91e-17 1.94e-17 NA
4. PB Q32B26 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB B3PYC6 Elongation factor 4 0.00e+00 4.18e-20 2.30e-17 NA
4. PB Q5JFZ4 Elongation factor 1-alpha 1.75e-05 1.56e-03 1.80e-09 NA
4. PB P15112 Elongation factor 2 9.21e-15 7.33e-31 8.49e-27 NA
4. PB B2HWQ2 Elongation factor 4 0.00e+00 1.09e-18 6.54e-19 NA
4. PB B0WXB8 Translation factor GUF1 homolog, mitochondrial 1.75e-09 1.12e-15 1.92e-17 NA
4. PB A3PBD8 Elongation factor 4 0.00e+00 7.13e-19 1.03e-19 NA
4. PB Q7W5J4 Elongation factor 4 9.44e-15 7.25e-18 1.08e-20 NA
4. PB B7GYS7 Elongation factor 4 6.99e-15 1.09e-18 6.54e-19 NA
4. PB C5CSF2 Elongation factor 4 0.00e+00 1.18e-17 2.22e-20 NA
4. PB Q5WZL5 Elongation factor G 0.00e+00 2.79e-79 0.0 NA
4. PB A5CF23 Elongation factor G 0.00e+00 3.71e-70 0.0 NA
4. PB B7MYK1 Elongation factor 4 0.00e+00 7.25e-18 2.24e-19 NA
4. PB Q9KUZ7 Elongation factor G 1 0.00e+00 1.20e-75 0.0 NA
4. PB D1ZET3 Translation factor GUF1, mitochondrial 2.75e-12 3.86e-08 3.04e-17 NA
4. PB Q32PH8 Elongation factor 1-alpha 2 3.09e-05 5.95e-05 4.26e-07 NA
4. PB P25698 Elongation factor 1-alpha 5.39e-05 2.87e-04 4.97e-06 NA
4. PB Q03033 Elongation factor 1-alpha 3.23e-05 5.95e-05 1.03e-06 NA
4. PB P29521 Elongation factor 1-alpha 4.16e-05 1.90e-04 4.02e-06 NA
4. PB Q39I75 Elongation factor 4 0.00e+00 4.58e-18 4.54e-19 NA
4. PB A6UQ14 Elongation factor 1-alpha 1.26e-05 1.79e-02 1.29e-11 NA
4. PB A5I644 Elongation factor 4 6.21e-14 7.33e-17 2.18e-18 NA
4. PB B7KR78 Elongation factor 4 0.00e+00 1.78e-17 8.50e-17 NA
4. PB P53530 Elongation factor 4 7.73e-14 2.51e-18 6.17e-18 NA
4. PB B8D953 Elongation factor 4 0.00e+00 1.87e-16 1.73e-19 NA
4. PB A9N944 Elongation factor 4 0.00e+00 7.90e-17 1.10e-19 NA
4. PB A4WMR8 Elongation factor 2 0.00e+00 6.07e-41 4.99e-61 NA
4. PB Q1CUF5 Elongation factor 4 0.00e+00 2.19e-20 1.07e-17 NA
4. PB Q3JQ75 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB B3DT30 Elongation factor G 0.00e+00 1.07e-80 0.0 NA
4. PB Q6FZB9 Elongation factor G 0.00e+00 1.59e-79 0.0 NA
4. PB Q47RQ0 Elongation factor 4 4.04e-14 2.96e-19 1.17e-18 NA
4. PB A4YCV9 Elongation factor 2 5.84e-13 2.11e-40 5.18e-74 NA
4. PB Q28UW8 Elongation factor G 0.00e+00 4.49e-71 0.0 NA
4. PB O24534 Elongation factor 1-alpha 4.81e-05 9.93e-05 2.73e-06 NA
4. PB Q5F3X4 116 kDa U5 small nuclear ribonucleoprotein component 5.96e-12 1.49e-14 1.69e-13 NA
4. PB Q07TF1 Elongation factor 4 0.00e+00 6.59e-19 2.37e-16 NA
4. PB A6U856 Elongation factor G 0.00e+00 3.88e-79 0.0 NA
4. PB Q9YC19 Elongation factor 2 1.38e-14 6.63e-41 1.13e-34 NA
4. PB A3DF29 Elongation factor 4 1.11e-16 8.25e-16 9.82e-19 NA
4. PB Q4FQG6 Elongation factor Tu 1.70e-05 1.83e-02 1.38e-05 NA
4. PB Q2SL35 Elongation factor 4 0.00e+00 3.68e-17 9.62e-19 NA
4. PB Q0HSI9 Elongation factor 4 9.00e-14 2.15e-18 9.79e-19 NA
4. PB Q6FYA7 Elongation factor 2 1.88e-14 1.09e-29 1.43e-25 NA
4. PB B0K3Y4 Elongation factor 4 5.08e-14 4.54e-17 6.33e-19 NA
4. PB A5DI11 Elongation factor 2 1.90e-14 1.55e-30 2.71e-25 NA
4. PB P0CT32 Elongation factor 1-alpha 5.27e-05 1.55e-06 3.87e-08 NA
4. PB O59153 Elongation factor 1-alpha 2.27e-05 8.02e-04 1.52e-08 NA
4. PB Q6CPQ9 Elongation factor 2 5.88e-14 4.18e-31 3.56e-23 NA
4. PB O93637 Elongation factor 2 1.11e-16 9.90e-44 8.05e-74 NA
4. PB B7J9J8 Elongation factor 4 0.00e+00 2.71e-18 1.58e-17 NA
4. PB Q0TER9 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q00251 Elongation factor 1-alpha 3.46e-05 1.03e-04 1.75e-06 NA
4. PB Q3J8R1 Elongation factor G 0.00e+00 1.87e-78 0.0 NA
4. PB B7J464 Elongation factor G 0.00e+00 2.06e-82 0.0 NA
4. PB P25039 Elongation factor G, mitochondrial 0.00e+00 3.74e-30 0.0 NA
4. PB A2R994 Ribosome-releasing factor 2, mitochondrial 0.00e+00 6.23e-34 3.02e-118 NA
4. PB Q7VRQ8 Elongation factor 4 0.00e+00 2.24e-16 1.28e-20 NA
4. PB A4IZT6 Elongation factor G 0.00e+00 1.39e-75 0.0 NA
4. PB B7M1P1 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q74ZG2 Translation factor GUF1, mitochondrial 9.88e-10 5.21e-12 1.32e-16 NA
4. PB Q8ZZC1 Elongation factor 2 0.00e+00 2.21e-41 2.79e-60 NA
4. PB Q9VM33 Elongation factor G, mitochondrial 0.00e+00 8.78e-42 0.0 NA
4. PB B3E9R0 Elongation factor 4 0.00e+00 2.55e-18 1.14e-17 NA
4. PB A9IW31 Elongation factor G 0.00e+00 2.27e-80 0.0 NA
4. PB A7MKJ6 Elongation factor G 0.00e+00 2.14e-79 0.0 NA
4. PB P60794 Elongation factor 4 1.62e-13 5.68e-18 4.84e-19 NA
4. PB Q4FNH3 Elongation factor 4 0.00e+00 5.13e-19 2.56e-19 NA
4. PB B1JYB1 Elongation factor 4 0.00e+00 1.92e-17 4.95e-19 NA
4. PB P57348 Elongation factor 4 0.00e+00 2.17e-16 1.79e-19 NA
4. PB A0PXT1 Elongation factor Tu 1.15e-05 2.80e-02 1.46e-07 NA
4. PB Q1MQF3 Elongation factor 4 0.00e+00 4.72e-18 1.04e-18 NA
4. PB B3PWR8 Elongation factor G 0.00e+00 1.45e-80 0.0 NA
4. PB A1RRJ3 Elongation factor 1-alpha 3.86e-05 2.46e-02 5.03e-06 NA
4. PB Q12SW1 Elongation factor Tu 1.75e-05 2.00e-02 1.67e-09 NA
4. PB Q48D33 Elongation factor G 0.00e+00 2.62e-72 0.0 NA
4. PB A9KW88 Elongation factor Tu 1 1.71e-05 3.87e-02 3.05e-10 NA
4. PB B1JRC5 Elongation factor 4 1.08e-14 6.13e-18 5.12e-19 NA
4. PB P19039 Elongation factor 1-alpha 1.02e-04 8.40e-05 7.67e-06 NA
4. PB Q87LN7 Elongation factor 4 0.00e+00 3.05e-19 2.15e-18 NA
4. PB Q3A445 Elongation factor 4 0.00e+00 9.01e-19 3.75e-18 NA
4. PB A5USJ2 Elongation factor G 0.00e+00 7.81e-82 0.0 NA
4. PB A0B8Q6 Probable translation initiation factor IF-2 2.70e-04 2.52e-08 3.12e-07 NA
4. PB Q5FJP6 Elongation factor 4 0.00e+00 3.79e-17 4.34e-17 NA
4. PB O27132 Elongation factor 1-alpha 1.04e-05 5.27e-03 9.59e-08 NA
4. PB B3CTE7 Elongation factor G 0.00e+00 1.08e-70 0.0 NA
4. PB Q4ZPD8 Elongation factor 4 0.00e+00 3.21e-18 2.59e-19 NA
4. PB Q5FHQ1 Elongation factor 4 0.00e+00 6.22e-18 1.16e-16 NA
4. PB P65271 Elongation factor 4 1.03e-14 2.57e-19 5.32e-21 NA
4. PB B3EP64 Elongation factor G 0.00e+00 1.17e-77 0.0 NA
4. PB B7L4L1 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q9PBA1 Elongation factor 4 1.11e-16 1.26e-17 7.14e-19 NA
4. PB B0V8Y3 Elongation factor G 0.00e+00 5.03e-68 0.0 NA
4. PB Q0ICF2 Elongation factor 4 0.00e+00 1.99e-18 3.85e-19 NA
4. PB Q2HJN9 Elongation factor 1-alpha 4 3.65e-05 5.95e-04 1.34e-06 NA
4. PB C3LR06 Elongation factor 4 8.77e-15 2.84e-18 4.77e-17 NA
4. PB C4LBZ6 Elongation factor 4 9.66e-15 3.85e-17 8.34e-19 NA
4. PB Q99ZV8 Elongation factor 4 3.11e-15 6.22e-17 3.86e-18 NA
4. PB P02994 Elongation factor 1-alpha 4.32e-05 1.26e-03 7.49e-07 NA
4. PB B1I6E0 Elongation factor 4 1.49e-14 2.98e-17 1.85e-19 NA
4. PB A5EX84 Elongation factor Tu 1.55e-05 2.19e-02 4.12e-09 NA
4. PB Q7MV56 Elongation factor 4 0.00e+00 1.51e-17 4.66e-17 NA
4. PB A7AQ93 Translation factor GUF1 homolog, mitochondrial 5.55e-16 5.02e-09 1.09e-16 NA
4. PB Q1D513 Elongation factor G 3 0.00e+00 4.76e-68 0.0 NA
4. PB A8G3D2 Elongation factor 4 0.00e+00 4.05e-19 9.81e-20 NA
4. PB A5U9R0 Elongation factor G 0.00e+00 1.44e-77 0.0 NA
4. PB Q83JC3 Elongation factor G 0.00e+00 9.74e-79 0.0 NA
4. PB Q0K8N0 Elongation factor 4 9.21e-15 1.06e-17 1.25e-19 NA
4. PB B5Z143 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q8PC52 Elongation factor G 0.00e+00 1.00e-78 0.0 NA
4. PB P60786 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB B4SBG4 Elongation factor 4 2.52e-13 1.18e-17 6.90e-20 NA
4. PB B5RD51 Elongation factor 4 0.00e+00 1.16e-18 3.02e-19 NA
4. PB Q1C2U0 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q9FE64 Elongation factor G, mitochondrial 0.00e+00 2.11e-27 0.0 NA
4. PB C6A4R7 Elongation factor 1-alpha 1.85e-05 5.17e-04 1.12e-11 NA
4. PB A8MFA6 Elongation factor 4 1.11e-16 9.41e-16 4.33e-19 NA
4. PB P42481 Elongation factor Tu 1.20e-05 4.35e-02 1.94e-11 NA
4. PB A7FNN9 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q17X87 Elongation factor 4 0.00e+00 2.45e-19 2.68e-18 NA
4. PB C3L3H1 Elongation factor 4 8.98e-14 1.61e-16 1.72e-18 NA
4. PB P57806 Elongation factor 4 1.24e-14 9.85e-18 1.78e-19 NA
4. PB Q0SZX7 Elongation factor G 0.00e+00 9.74e-79 0.0 NA
4. PB Q63S94 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q6FDS6 Elongation factor G 0.00e+00 5.16e-69 0.0 NA
4. PB B8D6B2 Elongation factor 2 0.00e+00 7.64e-38 1.19e-60 NA
4. PB Q2K9L9 Elongation factor G 0.00e+00 1.79e-80 0.0 NA
4. PB Q8CXD0 Elongation factor 4 7.67e-14 2.17e-17 1.72e-20 NA
4. PB Q72KV2 Elongation factor 4 1.16e-13 2.14e-16 1.88e-17 NA
4. PB B1V9C5 Elongation factor 4 1.11e-16 1.55e-17 5.80e-18 NA
4. PB Q5GRW9 Elongation factor 4 0.00e+00 2.68e-17 7.40e-17 NA
4. PB C1KVC6 Elongation factor 4 5.55e-15 8.07e-18 7.15e-20 NA
4. PB Q2JMX8 Elongation factor G 0.00e+00 1.73e-74 0.0 NA
4. PB Q3YYU7 Elongation factor 4 0.00e+00 8.98e-18 1.74e-19 NA
4. PB Q2LTN3 Elongation factor 4 9.09e-14 2.79e-16 6.13e-20 NA
4. PB Q47UU9 Elongation factor Tu 1.88e-05 3.44e-02 9.32e-10 NA
4. PB Q2G0N1 Elongation factor G 0.00e+00 6.53e-86 0.0 NA
4. PB Q11UD0 Elongation factor 4 1.30e-14 3.07e-18 4.39e-18 NA
4. PB A5F5G3 Elongation factor 4 6.77e-15 2.84e-18 4.77e-17 NA
4. PB Q3K5Y5 Elongation factor G 0.00e+00 2.28e-72 0.0 NA
4. PB A1U2V8 Elongation factor 4 1.21e-14 3.53e-18 3.60e-17 NA
4. PB A7N9A4 Elongation factor 4 0.00e+00 9.45e-17 1.85e-17 NA
4. PB Q831Z0 Elongation factor 4 2.22e-15 6.73e-16 7.40e-18 NA
4. PB Q5NHX0 Elongation factor G 0.00e+00 9.21e-76 0.0 NA
4. PB A9GWZ4 Elongation factor 4 0.00e+00 3.46e-17 1.15e-18 NA
4. PB B2S3A4 Elongation factor 4 1.11e-16 2.45e-17 4.38e-17 NA
4. PB Q6HDK2 Elongation factor 4 2.62e-14 7.23e-17 1.29e-18 NA
4. PB A3M1F6 Elongation factor Tu 1.59e-05 2.64e-02 2.84e-09 NA
4. PB A5W8F4 Elongation factor 4 0.00e+00 4.51e-18 4.55e-18 NA
4. PB A3MM44 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q12SW2 Elongation factor G 1 0.00e+00 2.95e-76 0.0 NA
4. PB Q04SN9 Elongation factor 4 0.00e+00 7.23e-17 2.62e-16 NA
4. PB P34824 Elongation factor 1-alpha 5.58e-05 1.19e-05 7.93e-07 NA
4. PB A6WKQ5 Elongation factor 4 0.00e+00 2.30e-17 1.93e-18 NA
4. PB B4TE17 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB A3CSP4 Probable translation initiation factor IF-2 1.23e-03 3.82e-08 7.33e-07 NA
4. PB P0CN31 Elongation factor 1-alpha 4.05e-05 3.22e-04 1.33e-04 NA
4. PB A8EY28 Elongation factor 4 1.49e-14 9.55e-18 1.08e-17 NA
4. PB Q820H8 Elongation factor 4 0.00e+00 3.81e-18 1.02e-19 NA
4. PB C4K4F9 Elongation factor G 0.00e+00 1.90e-76 0.0 NA
4. PB Q6FF97 Elongation factor Tu 1.69e-05 1.68e-02 9.36e-09 NA
4. PB B1WWD8 Elongation factor 4 0.00e+00 2.15e-18 5.81e-17 NA
4. PB Q6D217 Elongation factor 4 0.00e+00 3.53e-18 8.44e-20 NA
4. PB P41752 Elongation factor 1-alpha 8.75e-05 2.16e-04 1.26e-06 NA
4. PB Q3ATB2 Elongation factor 4 8.49e-14 2.69e-19 2.00e-19 NA
4. PB A9HG78 Elongation factor 4 0.00e+00 1.76e-19 7.54e-16 NA
4. PB Q3B6G4 Elongation factor G 0.00e+00 2.63e-75 0.0 NA
4. PB B0VTM2 Elongation factor 4 1.01e-14 2.40e-18 5.58e-19 NA
4. PB P56865 Elongation factor 4 3.06e-14 5.42e-18 2.74e-20 NA
4. PB C3N5S0 Elongation factor 2 0.00e+00 2.22e-39 4.70e-70 NA
4. PB B2GBR9 Elongation factor 4 1.33e-15 2.05e-18 7.83e-19 NA
4. PB Q3JMR0 Elongation factor G 2 0.00e+00 3.18e-77 0.0 NA
4. PB A3M7P5 Elongation factor 4 0.00e+00 1.09e-18 6.54e-19 NA
4. PB A5CE57 Elongation factor 4 0.00e+00 2.56e-17 4.41e-18 NA
4. PB P43925 Elongation factor G 0.00e+00 3.80e-78 0.0 NA
4. PB Q634M2 Elongation factor 4 5.11e-15 7.23e-17 1.29e-18 NA
4. PB A1ARG8 Elongation factor 4 0.00e+00 1.05e-17 7.67e-18 NA
4. PB P58252 Elongation factor 2 9.56e-14 5.56e-27 1.39e-22 NA
4. PB C1N1Y2 Translation factor GUF1 homolog, chloroplastic 1.65e-13 1.68e-07 3.38e-16 NA
4. PB A5IHR7 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB A9KWA0 Elongation factor Tu 2 1.77e-05 4.00e-02 2.19e-10 NA
4. PB B7N0X6 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A6U257 Elongation factor 4 8.55e-15 2.57e-19 5.32e-21 NA
4. PB B9LQL7 Probable translation initiation factor IF-2 9.32e-04 2.07e-08 0.002 NA
4. PB Q4USF4 Elongation factor 4 0.00e+00 1.26e-17 8.80e-17 NA
4. PB Q8CP13 Elongation factor 4 1.68e-14 2.19e-19 2.16e-21 NA
4. PB Q6CZW5 Elongation factor G 0.00e+00 1.33e-79 0.0 NA
4. PB P43729 Elongation factor 4 1.19e-14 1.73e-17 2.21e-19 NA
4. PB P09604 Elongation factor 2 0.00e+00 3.51e-41 2.10e-72 NA
4. PB Q2SSF7 Elongation factor 4 0.00e+00 4.65e-18 7.49e-20 NA
4. PB Q8A474 Elongation factor G 0.00e+00 4.01e-80 0.0 NA
4. PB B7LDG2 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB B5ZYT2 Elongation factor G 0.00e+00 3.16e-80 0.0 NA
4. PB Q7WFL2 Elongation factor G 2 0.00e+00 1.60e-76 0.0 NA
4. PB B8CQJ7 Elongation factor 4 8.32e-14 1.09e-18 1.43e-19 NA
4. PB A1RVX2 Elongation factor 2 0.00e+00 3.15e-41 6.89e-60 NA
4. PB P86934 Elongation factor 1-alpha 1 3.37e-05 4.24e-04 2.65e-06 NA
4. PB Q8SQT7 Elongation factor 2 3.44e-12 5.49e-26 1.13e-20 NA
4. PB I1K0K6 Elongation factor G-2, chloroplastic 0.00e+00 8.73e-19 0.0 NA
4. PB A2RL76 Elongation factor 4 2.78e-15 5.52e-17 6.20e-20 NA
4. PB Q62GK2 Elongation factor G 2 0.00e+00 3.18e-77 0.0 NA
4. PB C4LBU4 Elongation factor G 0.00e+00 3.09e-77 0.0 NA
4. PB A0JX50 Elongation factor 4 3.72e-14 2.89e-18 1.13e-19 NA
4. PB A9WW49 Elongation factor 4 0.00e+00 5.85e-18 4.20e-18 NA
4. PB Q3APH0 Elongation factor G 0.00e+00 2.55e-71 0.0 NA
4. PB A9R462 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q12KH9 Elongation factor 4 0.00e+00 1.52e-16 1.30e-17 NA
4. PB Q9I5G8 Elongation factor 4 2.44e-15 2.33e-19 4.43e-18 NA
4. PB B2SDY7 Elongation factor G 0.00e+00 1.39e-75 0.0 NA
4. PB Q2FZP4 Peptide chain release factor 3 5.50e-14 3.66e-15 1.96e-52 NA
4. PB A5EX85 Elongation factor G 0.00e+00 1.52e-77 0.0 NA
4. PB Q7V8S4 Elongation factor 4 0.00e+00 3.63e-19 1.22e-18 NA
4. PB O29325 Elongation factor 1-alpha 1.07e-05 2.22e-03 3.72e-11 NA
4. PB Q3K1F9 Elongation factor 4 0.00e+00 6.04e-17 2.04e-18 NA
4. PB P14963 Elongation factor 1-alpha 5.21e-05 9.55e-05 6.18e-07 NA
4. PB A1KRH0 Elongation factor G 0.00e+00 8.44e-74 0.0 NA
4. PB A3MSN3 Elongation factor 2 0.00e+00 1.70e-41 1.18e-59 NA
4. PB B2I601 Elongation factor 4 1.11e-16 4.28e-17 7.20e-19 NA
4. PB B2USI5 Elongation factor 4 0.00e+00 2.71e-20 5.46e-18 NA
4. PB Q2GJV7 Elongation factor 4 0.00e+00 4.44e-18 5.62e-16 NA
4. PB A0K5V7 Elongation factor 4 0.00e+00 1.92e-17 4.95e-19 NA
4. PB Q8Y742 Elongation factor 4 6.88e-15 8.07e-18 7.15e-20 NA
4. PB P0DTT0 50S ribosomal subunit assembly factor BipA 4.52e-08 1.04e-15 1.44e-24 NA
4. PB B4SBU4 Elongation factor G 0.00e+00 1.13e-77 0.0 NA
4. PB A7GHI0 Elongation factor 4 0.00e+00 1.82e-16 1.52e-18 NA
4. PB Q3KHM1 Elongation factor 4 0.00e+00 2.64e-17 2.37e-18 NA
4. PB P60930 Elongation factor 4 4.94e-14 1.84e-18 1.09e-18 NA
4. PB Q11HP9 Elongation factor G 0.00e+00 3.92e-78 0.0 NA
4. PB B8DIZ5 Elongation factor 4 0.00e+00 3.58e-18 7.57e-19 NA
4. PB B9GHA6 Translation factor GUF1 homolog, chloroplastic 4.81e-14 1.59e-10 2.02e-19 NA
4. PB C6BST2 Elongation factor 4 0.00e+00 6.91e-17 9.26e-19 NA
4. PB Q979T1 Elongation factor 1-alpha 1.06e-05 1.20e-03 2.09e-10 NA
4. PB B9KIE5 Elongation factor 4 0.00e+00 5.52e-17 2.19e-14 NA
4. PB Q5F9P9 Elongation factor 4 0.00e+00 3.53e-18 9.74e-20 NA
4. PB A5UFI9 Elongation factor 4 1.25e-14 1.32e-17 2.35e-19 NA
4. PB A6QB12 Sulfate adenylyltransferase subunit 1 1.45e-04 2.19e-02 0.001 NA
4. PB O42820 Elongation factor 1-alpha 1.27e-05 4.64e-05 5.75e-06 NA
4. PB Q1LSY5 Elongation factor G 0.00e+00 1.41e-74 0.0 NA
4. PB A6VLV6 Elongation factor 4 1.32e-14 2.98e-18 2.87e-19 NA
4. PB P34825 Elongation factor 1-alpha 3.89e-05 9.93e-05 9.93e-06 NA
4. PB Q0I0A8 Elongation factor G 1 0.00e+00 1.20e-75 0.0 NA
4. PB A1JKK1 Elongation factor 4 0.00e+00 7.71e-18 5.03e-19 NA
4. PB Q9VCX4 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.82e-43 1.18e-108 NA
4. PB P0A7I4 Peptide chain release factor RF3 5.59e-13 4.54e-13 4.17e-43 NA
4. PB Q1QR19 Elongation factor 4 2.34e-14 1.14e-19 1.50e-17 NA
4. PB B4U6M2 Elongation factor 4 0.00e+00 1.78e-17 3.34e-18 NA
4. PB B2RLZ4 Elongation factor G 0.00e+00 2.23e-77 0.0 NA
4. PB A1AGM7 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q1JH37 Elongation factor 4 3.00e-15 4.34e-17 3.21e-18 NA
4. PB Q6AEB5 Elongation factor 4 2.72e-14 1.95e-17 1.60e-19 NA
4. PB A0SXL6 Elongation factor 2 8.88e-14 7.85e-27 2.72e-22 NA
4. PB B4RK41 Elongation factor 4 4.59e-14 3.53e-18 9.74e-20 NA
4. PB B3QY21 Elongation factor G 0.00e+00 1.43e-75 0.0 NA
4. PB A9MCW5 Elongation factor 4 0.00e+00 5.85e-18 4.20e-18 NA
4. PB Q0BJ48 Elongation factor Tu 1.57e-05 3.90e-02 1.82e-11 NA
4. PB B0JQT7 Elongation factor 4 0.00e+00 1.84e-19 6.92e-17 NA
4. PB Q88MY7 Elongation factor 4 0.00e+00 2.73e-19 3.01e-18 NA
4. PB Q8ZD74 Elongation factor 4 9.55e-15 6.13e-18 5.12e-19 NA
4. PB Q9XV52 Elongation factor G, mitochondrial 0.00e+00 7.90e-40 3.15e-170 NA
4. PB Q8TQL5 Probable translation initiation factor IF-2 4.63e-04 7.75e-08 8.35e-06 NA
4. PB A2SLF9 Elongation factor Tu 1.57e-05 3.39e-02 4.38e-09 NA
4. PB Q92005 Elongation factor 1-alpha 5.75e-05 4.83e-05 4.37e-07 NA
4. PB A9MT06 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q8EK81 Elongation factor Tu 1 1.73e-05 2.68e-02 2.53e-10 NA
4. PB O08810 116 kDa U5 small nuclear ribonucleoprotein component 5.66e-12 5.01e-15 2.87e-13 NA
4. PB B4RYQ8 Elongation factor Tu 1.74e-05 4.84e-02 5.18e-09 NA
4. PB A4SHV8 Elongation factor G 0.00e+00 1.41e-74 0.0 NA
4. PB Q5P335 Elongation factor G 0.00e+00 8.39e-79 0.0 NA
4. PB Q0AF67 Elongation factor 4 0.00e+00 1.60e-18 8.15e-21 NA
4. PB Q5LC85 Elongation factor 4 1.58e-14 6.32e-18 4.59e-18 NA
4. PB P43643 Elongation factor 1-alpha 4.32e-05 3.24e-05 1.16e-06 NA
4. PB A4SUU7 Elongation factor Tu 1.49e-05 3.47e-02 5.03e-11 NA
4. PB P60791 Elongation factor 4 8.54e-14 4.75e-17 1.14e-17 NA
4. PB A9A0N0 Elongation factor 4 0.00e+00 1.06e-17 1.73e-18 NA
4. PB Q96X45 Elongation factor 2 6.12e-14 8.88e-31 1.21e-26 NA
4. PB Q1LTI1 Elongation factor 4 0.00e+00 4.03e-17 4.64e-19 NA
4. PB B2U978 Elongation factor 4 0.00e+00 1.65e-17 5.31e-21 NA
4. PB P68105 Elongation factor 1-alpha 1 5.86e-05 7.77e-05 1.01e-06 NA
4. PB Q9PA90 Elongation factor G 0.00e+00 5.61e-69 0.0 NA
4. PB Q2L2H1 Elongation factor G 1 0.00e+00 2.37e-78 0.0 NA
4. PB Q0IFX5 Translation factor GUF1 homolog, mitochondrial 1.04e-10 1.19e-14 1.18e-16 NA
4. PB Q2N9A7 Elongation factor G 0.00e+00 7.69e-66 0.0 NA
4. PB P0CT55 Elongation factor 1-alpha-B/C 5.11e-05 1.12e-03 7.29e-08 NA
4. PB C5BGM8 Elongation factor G 0.00e+00 7.25e-75 0.0 NA
4. PB Q1G9R4 Elongation factor 4 0.00e+00 4.75e-17 8.98e-19 NA
4. PB Q03KW7 Elongation factor 4 0.00e+00 2.59e-16 5.81e-19 NA
4. PB A5WCD6 Elongation factor 4 0.00e+00 9.44e-19 3.34e-19 NA
4. PB Q5HBH4 Elongation factor 4 0.00e+00 6.82e-18 1.23e-16 NA
4. PB A7GT14 Elongation factor 4 6.11e-15 4.15e-17 9.48e-20 NA
4. PB A8Z666 Elongation factor G 0.00e+00 3.52e-76 0.0 NA
4. PB Q02T82 Elongation factor Tu 1.58e-05 4.10e-02 1.31e-07 NA
4. PB P65270 Elongation factor 4 5.02e-14 1.14e-14 1.53e-18 NA
4. PB Q7WD30 Elongation factor 4 2.38e-14 7.25e-18 1.08e-20 NA
4. PB B3LQ11 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.79e-39 9.85e-121 NA
4. PB Q46GZ6 Elongation factor 4 0.00e+00 8.18e-20 3.77e-19 NA
4. PB Q57770 Elongation factor 1-alpha 1.54e-05 3.83e-03 3.70e-11 NA
4. PB Q3KMV7 Elongation factor 4 4.96e-11 1.70e-18 4.27e-18 NA
4. PB Q8UH69 Sulfate adenylyltransferase subunit 1 2.64e-05 3.59e-02 0.003 NA
4. PB B7MIQ4 Elongation factor 4 0.00e+00 7.25e-18 2.24e-19 NA
4. PB Q5L8A7 Elongation factor G 0.00e+00 1.08e-79 0.0 NA
4. PB Q979T3 Elongation factor 2 2.44e-15 9.54e-39 1.63e-71 NA
4. PB Q5UZS7 Elongation factor 2 1.08e-14 5.22e-38 5.77e-36 NA
4. PB C3PMX3 Elongation factor 4 0.00e+00 4.54e-17 1.49e-17 NA
4. PB Q0SP76 Elongation factor 4 1.11e-16 7.37e-18 6.82e-20 NA
4. PB Q6N4Q4 Elongation factor Tu 1.38e-05 1.68e-02 4.61e-12 NA
4. PB Q8EH83 Elongation factor 4 0.00e+00 1.36e-17 1.24e-18 NA
4. PB Q9C641 Elongation factor G-1, mitochondrial 0.00e+00 3.99e-29 0.0 NA
4. PB A9M5Q3 Elongation factor G 0.00e+00 5.38e-81 0.0 NA
4. PB A0KRL0 Elongation factor Tu 1.64e-05 3.90e-02 4.20e-10 NA
4. PB P0A6N0 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB P86939 Elongation factor 1-alpha 2 4.70e-05 4.24e-04 2.65e-06 NA
4. PB B4TKM1 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q3IUM4 Elongation factor 2 0.00e+00 3.50e-36 9.14e-62 NA
4. PB Q89BJ8 Elongation factor 4 0.00e+00 9.01e-19 1.65e-17 NA
4. PB Q2IIA6 Elongation factor 4 0.00e+00 2.75e-16 8.16e-22 NA
4. PB Q7W2F8 Elongation factor G 1 0.00e+00 4.57e-76 0.0 NA
4. PB B3DSA9 Elongation factor 4 9.36e-14 2.96e-19 1.21e-18 NA
4. PB Q83BK3 Elongation factor 4 0.00e+00 7.90e-17 1.10e-19 NA
4. PB B4U3G9 Elongation factor 4 6.22e-15 2.71e-16 7.93e-20 NA
4. PB Q48EV0 Elongation factor 4 0.00e+00 1.15e-17 2.33e-19 NA
4. PB O94429 Ribosome-releasing factor 2, mitochondrial 0.00e+00 3.03e-42 4.21e-106 NA
4. PB Q038N6 Elongation factor 4 2.00e-15 7.78e-16 1.08e-18 NA
4. PB Q6FR62 Translation factor GUF1, mitochondrial 5.54e-11 1.03e-09 6.47e-18 NA
4. PB Q3BWY7 Elongation factor G 0.00e+00 3.88e-79 0.0 NA
4. PB Q9VRH6 Translation factor waclaw, mitochondrial 2.12e-10 5.26e-08 4.96e-19 NA
4. PB B1VY28 Elongation factor 4 2.32e-13 2.80e-18 2.87e-18 NA
4. PB C3MQ53 Elongation factor 2 0.00e+00 2.22e-39 4.70e-70 NA
4. PB O93729 Elongation factor 1-alpha 3.05e-05 3.56e-02 3.81e-06 NA
4. PB B5R297 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB A4G6S1 Elongation factor 4 1.04e-14 4.82e-17 1.02e-20 NA
4. PB B7HPL8 Elongation factor 4 2.60e-14 3.62e-17 1.40e-18 NA
4. PB Q9ZM93 Elongation factor 4 0.00e+00 1.93e-19 1.39e-17 NA
4. PB B1AIW2 Elongation factor 4 1.17e-13 2.44e-16 4.59e-18 NA
4. PB C1A6Q2 Elongation factor G 0.00e+00 1.09e-76 0.0 NA
4. PB B7I7S1 Elongation factor G 0.00e+00 5.03e-68 0.0 NA
4. PB Q1LKM8 Elongation factor 4 2.38e-14 6.93e-18 4.53e-20 NA
4. PB Q05639 Elongation factor 1-alpha 2 3.19e-05 5.95e-05 4.26e-07 NA
4. PB B2FQ42 Elongation factor G 0.00e+00 2.05e-74 0.0 NA
4. PB Q1C557 Elongation factor 4 1.05e-14 6.13e-18 5.12e-19 NA
4. PB Q0I0B9 Elongation factor Tu 1 1.64e-05 3.74e-02 4.09e-10 NA
4. PB C5A6N7 Elongation factor 2 0.00e+00 2.94e-39 1.20e-67 NA
4. PB B5XLC6 Elongation factor 4 2.89e-15 6.91e-17 3.86e-18 NA
4. PB Q5R4R8 Elongation factor 1-alpha 1 4.46e-05 7.77e-05 1.01e-06 NA
4. PB A1RXW9 Elongation factor 1-alpha 3.51e-05 3.29e-03 6.17e-06 NA
4. PB A6VL11 Elongation factor G 0.00e+00 6.07e-77 0.0 NA
4. PB A7IAP7 Probable translation initiation factor IF-2 1.02e-04 1.38e-07 0.001 NA
4. PB Q057R2 Elongation factor 4 0.00e+00 1.37e-16 6.35e-18 NA
4. PB A7GJ76 Elongation factor Tu 1.63e-05 3.12e-02 4.07e-10 NA
4. PB Q0HNV1 Elongation factor Tu 1 1.59e-05 3.74e-02 4.09e-10 NA
4. PB P0CT54 Elongation factor 1-alpha-B 3.56e-05 1.12e-03 7.29e-08 NA
4. PB Q5JFZ3 Elongation factor 2 0.00e+00 1.59e-38 4.13e-69 NA
4. PB B9F2U5 Translation factor GUF1 homolog, chloroplastic 6.66e-16 2.80e-08 4.05e-19 NA
4. PB A8GMT1 Elongation factor 4 2.19e-14 1.00e-18 4.52e-18 NA
4. PB B0USR9 Elongation factor 4 1.31e-14 2.47e-18 1.30e-18 NA
4. PB A9BNJ8 Elongation factor 4 0.00e+00 1.26e-17 9.21e-19 NA
4. PB P08736 Elongation factor 1-alpha 1 4.77e-05 1.07e-05 1.01e-05 NA
4. PB Q39DL2 Elongation factor G 2 0.00e+00 1.66e-78 0.0 NA
4. PB Q7MH42 Elongation factor G 1 0.00e+00 2.44e-73 0.0 NA
4. PB B2S682 Elongation factor G 0.00e+00 9.81e-81 0.0 NA
4. PB A0K3L0 Elongation factor Tu 3.08e-05 3.90e-02 1.82e-11 NA
4. PB C4Z9E3 Elongation factor 4 2.72e-14 9.68e-16 6.80e-20 NA
4. PB A4IR35 Elongation factor 4 6.11e-15 2.56e-17 9.18e-20 NA
4. PB Q7UE01 Elongation factor 4 2 2.44e-13 6.32e-18 7.84e-20 NA
4. PB Q8RB72 Elongation factor 4 1.11e-16 1.60e-17 7.22e-19 NA
4. PB A4SCQ6 Elongation factor G 0.00e+00 2.18e-74 0.0 NA
4. PB C1CR98 Elongation factor 4 2.00e-15 2.55e-16 2.13e-18 NA
4. PB Q63WJ7 Elongation factor G 1 0.00e+00 7.91e-79 0.0 NA
4. PB A2BPP8 Elongation factor 4 0.00e+00 3.30e-19 1.01e-19 NA
4. PB Q1IV51 Elongation factor 4 4.24e-14 3.57e-17 2.06e-20 NA
4. PB Q13TG7 Elongation factor G 2 0.00e+00 4.11e-79 0.0 NA
4. PB D2VRR7 Translation factor GUF1 homolog, mitochondrial 4.01e-12 1.38e-11 2.40e-16 NA
4. PB P74751 Elongation factor 4 4.09e-14 3.35e-19 3.50e-17 NA
4. PB Q02Z80 Elongation factor 4 2.44e-15 7.12e-17 6.36e-20 NA
4. PB A3NXL8 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB B9M4U5 Elongation factor 4 0.00e+00 1.51e-17 9.05e-19 NA
4. PB Q2G550 Elongation factor 4 3.66e-15 1.35e-18 2.78e-17 NA
4. PB C1C7G9 Elongation factor 4 1.89e-15 1.90e-16 2.07e-18 NA
4. PB A6WDJ3 Elongation factor 4 7.04e-14 2.02e-18 7.54e-19 NA
4. PB Q7N9B2 Elongation factor G 0.00e+00 4.56e-75 0.0 NA
4. PB P48864 Elongation factor Tu 1.53e-05 4.60e-02 2.09e-08 NA
4. PB Q8EK70 Elongation factor Tu 2 1.66e-05 3.50e-02 2.46e-10 NA
4. PB A2BN41 Elongation factor 1-alpha 1.36e-05 5.68e-04 4.50e-05 NA
4. PB Q17152 Elongation factor 2 3.63e-12 3.54e-28 7.18e-23 NA
4. PB A6VKH7 Elongation factor Tu 1.60e-05 4.45e-02 1.35e-08 NA
4. PB F4IW10 Elongation factor G-2, mitochondrial 0.00e+00 3.11e-28 0.0 NA
4. PB C0MDV7 Elongation factor 4 3.11e-15 3.91e-16 4.85e-20 NA
4. PB Q2KWY3 Elongation factor 4 1.29e-14 5.18e-18 2.37e-19 NA
4. PB C3NED6 Elongation factor 2 0.00e+00 2.22e-39 4.70e-70 NA
4. PB Q01SV7 Elongation factor 4 0.00e+00 2.71e-16 2.93e-19 NA
4. PB Q0W8G2 Elongation factor 1-alpha 2.16e-05 3.68e-04 1.49e-10 NA
4. PB Q6L200 Elongation factor 2 3.77e-15 6.65e-40 6.61e-66 NA
4. PB A0M6M2 Elongation factor 4 1.11e-16 5.02e-18 1.38e-17 NA
4. PB A7IEG8 Elongation factor 4 0.00e+00 6.29e-19 5.21e-17 NA
4. PB P17508 Elongation factor 1-alpha, oocyte form 4.35e-05 4.29e-05 7.87e-07 NA
4. PB A5D3X6 Elongation factor 4 0.00e+00 8.20e-18 2.16e-20 NA
4. PB B5F8F8 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q9JHW4 Selenocysteine-specific elongation factor 1.34e-04 1.63e-03 0.046 NA
4. PB O13869 Translation factor guf1, mitochondrial 3.33e-16 3.24e-10 4.19e-15 NA
4. PB A2STF0 Elongation factor 1-alpha 1.38e-05 8.49e-05 1.63e-11 NA
4. PB Q8KAG9 Elongation factor G 0.00e+00 4.27e-77 0.0 NA
4. PB B1XK44 Elongation factor 4 0.00e+00 3.12e-18 5.95e-17 NA
4. PB B4TXE8 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q5WHG5 Elongation factor 4 0.00e+00 1.34e-17 1.23e-19 NA
4. PB Q5HNW2 Elongation factor 4 1.24e-14 2.19e-19 2.16e-21 NA
4. PB Q1D6M1 Elongation factor 4 1.11e-16 1.08e-17 2.34e-23 NA
4. PB P42479 Elongation factor Tu 1.53e-05 4.35e-02 3.80e-13 NA
4. PB Q5AAV3 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.98e-43 6.50e-115 NA
4. PB A5I7K8 Elongation factor Tu 1.64e-05 3.12e-02 4.07e-10 NA
4. PB P28996 Elongation factor 2 8.37e-14 2.08e-31 4.79e-26 NA
4. PB Q0I4Z1 Elongation factor 4 1.21e-14 2.47e-18 1.30e-18 NA
4. PB Q4UKS2 Elongation factor 4 0.00e+00 4.05e-18 7.85e-18 NA
4. PB Q8KCH0 Elongation factor 4 4.97e-14 3.85e-17 8.14e-19 NA
4. PB Q5E312 Elongation factor 4 0.00e+00 8.60e-19 4.14e-18 NA
4. PB B7UYX5 Elongation factor 4 7.22e-15 2.33e-19 4.43e-18 NA
4. PB P23112 Elongation factor 2 0.00e+00 2.73e-40 3.09e-72 NA
4. PB Q126K0 Elongation factor 4 0.00e+00 2.72e-17 2.26e-20 NA
4. PB Q5R1X2 Elongation factor 1-alpha 1 4.79e-05 7.77e-05 1.01e-06 NA
4. PB A9A813 Probable translation initiation factor IF-2 1.93e-03 1.97e-07 8.24e-04 NA
4. PB Q88FI4 Elongation factor G 2 0.00e+00 7.45e-79 0.0 NA
4. PB B1YE08 Elongation factor 2 0.00e+00 8.07e-41 1.60e-63 NA
4. PB A1KL96 Elongation factor 4 1.07e-13 1.14e-14 1.53e-18 NA
4. PB Q9Y9B3 Probable translation initiation factor IF-2 9.08e-05 1.68e-08 6.51e-04 NA
4. PB Q5UXU6 Probable translation initiation factor IF-2 1.27e-03 3.37e-08 0.006 NA
4. PB P34823 Elongation factor 1-alpha 5.34e-05 4.69e-05 4.84e-06 NA
4. PB Q1MIE4 Elongation factor G 0.00e+00 2.02e-80 0.0 NA
4. PB B8IMT0 Elongation factor 4 0.00e+00 2.61e-19 2.28e-16 NA
4. PB A7ZCJ3 Elongation factor 4 0.00e+00 8.31e-20 1.51e-19 NA
4. PB A6VGV5 Elongation factor 2 1.11e-12 2.70e-41 2.96e-77 NA
4. PB A4VIX2 Elongation factor 4 0.00e+00 1.28e-19 8.89e-19 NA
4. PB B7LUZ5 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB P27592 Elongation factor 1-alpha 4.50e-05 1.98e-04 9.74e-06 NA
4. PB Q7VRN9 Elongation factor G 0.00e+00 5.12e-75 0.0 NA
4. PB Q65W89 Elongation factor G 0.00e+00 6.67e-78 0.0 NA
4. PB Q0ATE3 Elongation factor 4 0.00e+00 1.70e-18 4.32e-16 NA
4. PB B3QPU3 Elongation factor 4 5.26e-14 1.34e-17 3.80e-19 NA
4. PB B8GIQ3 Elongation factor 1-alpha 1.13e-05 2.32e-03 3.30e-10 NA
4. PB A0L631 Elongation factor 4 0.00e+00 3.36e-17 1.49e-18 NA
4. PB Q63Q08 Elongation factor G 2 0.00e+00 3.18e-77 0.0 NA
4. PB A9III9 Elongation factor 4 1.65e-14 2.01e-17 2.45e-19 NA
4. PB A6VAK9 Elongation factor 4 6.11e-15 1.84e-19 4.31e-18 NA
4. PB B6IUG3 Elongation factor 4 8.77e-15 1.65e-17 1.28e-18 NA
4. PB B6JKS8 Elongation factor 4 0.00e+00 3.50e-20 9.70e-18 NA
4. PB A7A1H2 Translation factor GUF1, mitochondrial 4.86e-09 2.29e-11 6.95e-18 NA
4. PB Q14FW1 Elongation factor 4 0.00e+00 8.77e-17 8.28e-18 NA
4. PB B3EE17 Elongation factor 4 4.08e-13 3.64e-18 7.46e-19 NA
4. PB Q2KV83 Elongation factor G 2 0.00e+00 1.73e-79 0.0 NA
4. PB Q667U9 Elongation factor 4 1.05e-14 6.13e-18 5.12e-19 NA
4. PB Q6M0I6 Probable translation initiation factor IF-2 1.10e-03 1.59e-07 0.005 NA
4. PB A7TQJ9 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.75e-47 6.82e-118 NA
4. PB Q81LR7 Elongation factor 4 2.00e-15 2.17e-17 1.68e-18 NA
4. PB P17196 Elongation factor 1-alpha 2.08e-05 1.32e-03 2.78e-06 NA
4. PB A1AWP9 Elongation factor 4 0.00e+00 5.20e-17 3.39e-20 NA
4. PB Q82BZ3 Elongation factor 4 2.09e-13 1.04e-18 4.54e-19 NA
4. PB A4SVW0 Elongation factor 4 0.00e+00 2.02e-18 7.09e-21 NA
4. PB A8AD16 Elongation factor 4 0.00e+00 2.14e-17 4.29e-19 NA
4. PB Q1BRU5 Elongation factor G 2 0.00e+00 1.26e-76 0.0 NA
4. PB B7HCU5 Elongation factor 4 3.55e-15 1.44e-17 1.19e-18 NA
4. PB C5A5P4 Elongation factor 1-alpha 1.64e-05 1.25e-03 1.56e-08 NA
4. PB A1BJ37 Elongation factor G 0.00e+00 6.33e-74 0.0 NA
4. PB Q8GTY0 Elongation factor 1-alpha 4 5.25e-05 8.91e-05 1.06e-06 NA
4. PB Q8AA33 Elongation factor 4 1.92e-14 1.53e-18 2.16e-18 NA
4. PB Q8KQB3 Elongation factor G 0.00e+00 4.95e-80 0.0 NA
4. PB P9WNM7 Elongation factor G 0.00e+00 4.16e-84 0.0 NA
4. PB Q65VN2 Elongation factor 4 0.00e+00 7.59e-18 1.51e-19 NA
4. PB P17506 Elongation factor 1-alpha 5.86e-05 1.12e-03 4.90e-06 NA
4. PB Q5X443 Elongation factor 4 0.00e+00 1.48e-18 2.28e-18 NA
4. PB A8GW16 Elongation factor 4 2.24e-14 1.00e-17 5.77e-17 NA
4. PB A5VVU4 Elongation factor 4 0.00e+00 5.85e-18 4.20e-18 NA
4. PB Q9HM89 Elongation factor 1-alpha 2.07e-05 2.10e-02 1.14e-12 NA
4. PB B8MR69 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.96e-36 3.20e-110 NA
4. PB B2U2U7 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A4S3R2 Translation factor GUF1 homolog, mitochondrial 6.02e-10 2.82e-13 2.69e-20 NA
4. PB B0G189 Translation factor GUF1 homolog, mitochondrial 3.40e-12 2.25e-08 7.64e-18 NA
4. PB A4XSC1 Elongation factor 4 1.89e-14 4.52e-19 2.88e-18 NA
4. PB A9M3J8 Elongation factor 4 0.00e+00 2.18e-18 1.02e-19 NA
4. PB Q2LTB9 Elongation factor G 1 0.00e+00 1.49e-68 0.0 NA
4. PB B2SZV7 Elongation factor 4 0.00e+00 5.60e-17 5.31e-19 NA
4. PB B4T1G0 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB P25166 Elongation factor 1-alpha 3.34e-05 3.25e-02 9.75e-07 NA
4. PB Q9JX07 Elongation factor G 0.00e+00 8.44e-74 0.0 NA
4. PB B4SKW0 Elongation factor G 0.00e+00 2.27e-75 0.0 NA
4. PB B5FJM0 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q1IXW5 Elongation factor 4 0.00e+00 1.08e-17 1.03e-19 NA
4. PB Q8UIQ2 Elongation factor 4 0.00e+00 7.80e-20 8.52e-18 NA
4. PB B8HVR8 Elongation factor G 0.00e+00 6.29e-73 0.0 NA
4. PB Q3BVV9 Elongation factor 4 0.00e+00 2.09e-18 1.84e-16 NA
4. PB C1ESL3 Elongation factor 4 3.22e-15 7.23e-17 1.29e-18 NA
4. PB Q7NAT2 Elongation factor 4 0.00e+00 4.16e-15 1.55e-19 NA
4. PB B0R8C3 Elongation factor 1-alpha 1.46e-05 2.10e-02 1.14e-12 NA
4. PB Q3Z864 Elongation factor 4 3.07e-13 1.76e-18 1.27e-20 NA
4. PB A9NAM1 Elongation factor G 0.00e+00 8.20e-74 0.0 NA
4. PB Q00080 Elongation factor 1-alpha 3.75e-05 5.84e-04 1.43e-08 NA
4. PB Q5R6E0 116 kDa U5 small nuclear ribonucleoprotein component 6.04e-12 3.19e-14 9.26e-25 NA
4. PB B5EQB5 Elongation factor 4 0.00e+00 2.71e-18 1.58e-17 NA
4. PB P34617 Translation factor GUF1 homolog, mitochondrial 1.87e-14 2.09e-18 2.34e-19 NA
4. PB B6EKN1 Elongation factor 4 0.00e+00 6.72e-18 2.26e-18 NA
4. PB A2S7H3 Elongation factor G 0.00e+00 3.18e-77 0.0 NA
4. PB A1RMC9 Elongation factor 4 0.00e+00 9.15e-19 3.15e-18 NA
4. PB Q5FUC2 Elongation factor 4 0.00e+00 8.46e-19 3.34e-16 NA
4. PB Q2NGM6 Probable translation initiation factor IF-2 1.11e-03 1.26e-07 1.17e-04 NA
4. PB Q492B1 Elongation factor G 0.00e+00 7.51e-78 0.0 NA
4. PB C4Z541 Elongation factor 4 7.13e-14 1.66e-16 1.21e-19 NA
4. PB Q8C0D5 Elongation factor-like GTPase 1 1.94e-03 1.06e-15 7.59e-19 NA
4. PB B9DSE0 Elongation factor 4 2.11e-15 1.31e-16 3.47e-18 NA
4. PB Q2SXT6 Elongation factor 4 0.00e+00 1.03e-17 6.17e-19 NA
4. PB Q492C9 Elongation factor 4 0.00e+00 5.56e-16 3.14e-21 NA
4. PB P9WNM9 Elongation factor G-like protein 0.00e+00 1.36e-39 1.05e-115 NA
4. PB C0R5S3 Elongation factor 4 0.00e+00 1.93e-16 5.17e-17 NA
4. PB O14460 Elongation factor 2 6.49e-13 2.27e-28 1.44e-21 NA
4. PB Q9HNQ2 Probable translation initiation factor IF-2 8.40e-04 1.21e-08 5.27e-05 NA
4. PB Q09069 Elongation factor 1-alpha 3.45e-05 1.38e-05 5.85e-06 NA
4. PB C6DG80 Elongation factor G 0.00e+00 8.39e-79 0.0 NA
4. PB Q6GGB6 Elongation factor 4 6.88e-15 2.57e-19 5.32e-21 NA
4. PB A4SFN5 Elongation factor 4 1.89e-13 4.44e-18 1.19e-18 NA
4. PB Q66RN5 Elongation factor 1-alpha 1 3.90e-05 7.77e-05 1.01e-06 NA
4. PB B2HUQ4 Elongation factor G 0.00e+00 5.03e-68 0.0 NA
4. PB Q6BJ25 Elongation factor 2 2.41e-14 3.99e-29 1.89e-21 NA
4. PB Q15NP2 Elongation factor Tu 1.63e-05 4.17e-02 1.01e-09 NA
4. PB B0BB51 Elongation factor 4 4.69e-11 2.67e-18 4.39e-18 NA
4. PB Q2GD82 Elongation factor G 0.00e+00 5.45e-87 0.0 NA
4. PB A3DBA0 Elongation factor Tu 2 1.71e-05 4.00e-02 2.19e-10 NA
4. PB Q1QDV6 Elongation factor 4 0.00e+00 3.47e-18 3.20e-19 NA
4. PB Q31XR8 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q8G075 Elongation factor G 0.00e+00 5.38e-81 0.0 NA
4. PB A7I4X4 Elongation factor 2 0.00e+00 2.84e-42 5.29e-69 NA
4. PB P36048 Pre-mRNA-splicing factor SNU114 6.81e-12 1.08e-17 6.20e-06 NA
4. PB P13639 Elongation factor 2 2.26e-13 4.15e-27 2.41e-22 NA
4. PB Q12GX4 Elongation factor G 1 0.00e+00 8.95e-76 0.0 NA
4. PB Q2Y873 Elongation factor 4 0.00e+00 1.02e-17 1.31e-19 NA
4. PB Q0A8Z4 Elongation factor 4 0.00e+00 1.54e-16 2.62e-18 NA
4. PB B9MJZ5 Elongation factor 4 1.11e-16 9.31e-17 2.89e-19 NA
4. PB Q5R104 Elongation factor 4 0.00e+00 3.87e-19 2.73e-21 NA
4. PB Q03QU8 Elongation factor 4 2.12e-14 3.31e-17 4.25e-18 NA
4. PB Q7NEF2 Elongation factor G 0.00e+00 1.70e-75 0.0 NA
4. PB Q65H50 Elongation factor 4 5.03e-14 1.03e-16 1.43e-17 NA
4. PB A5FY07 Elongation factor 4 0.00e+00 1.04e-18 2.56e-16 NA
4. PB Q050R3 Elongation factor 4 0.00e+00 7.23e-17 2.62e-16 NA
4. PB B0UWC4 Elongation factor G 0.00e+00 2.27e-75 0.0 NA
4. PB A9ADE0 Elongation factor 4 1.77e-14 3.02e-17 4.91e-19 NA
4. PB C5BQ43 Elongation factor G 0.00e+00 8.20e-78 0.0 NA
4. PB P62632 Elongation factor 1-alpha 2 3.16e-05 6.13e-05 4.41e-07 NA
4. PB A0M5A0 Elongation factor G 0.00e+00 8.98e-85 0.0 NA
4. PB A6SXR0 Elongation factor 4 8.10e-15 3.91e-17 1.63e-20 NA
4. PB B2TYI0 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q8SS29 Elongation factor 1-alpha 1.20e-05 7.36e-03 4.57e-04 NA
4. PB Q8W4H7 Elongation factor 1-alpha 2 5.47e-05 8.91e-05 1.06e-06 NA
4. PB B1X6J0 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q2FGD9 Elongation factor 4 7.33e-15 2.57e-19 5.32e-21 NA
4. PB A4SRD4 Elongation factor 4 1.34e-14 4.05e-20 9.36e-18 NA
4. PB B1XB43 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB B7G816 Translation factor GUF1 homolog, mitochondrial 2.96e-13 1.04e-07 1.61e-17 NA
4. PB A3MV69 Elongation factor 1-alpha 3.63e-05 1.19e-02 1.18e-05 NA
4. PB Q9ZDQ1 Elongation factor 4 2.44e-14 4.72e-18 2.04e-17 NA
4. PB Q31CB8 Elongation factor 4 0.00e+00 5.72e-19 1.30e-19 NA
4. PB Q3AF13 Elongation factor 4 0.00e+00 3.85e-17 9.47e-21 NA
4. PB Q04KB7 Elongation factor 4 2.11e-15 2.55e-16 2.13e-18 NA
4. PB Q1BU86 Elongation factor G 1 0.00e+00 5.92e-80 0.0 NA
4. PB B0CH35 Elongation factor G 0.00e+00 4.10e-81 0.0 NA
4. PB Q975H5 Elongation factor 2 3.49e-13 3.42e-39 2.76e-73 NA
4. PB A2S9Z3 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q01765 Elongation factor 1-alpha 3.36e-05 1.37e-05 4.29e-06 NA
4. PB B3EPG7 Elongation factor 4 2.36e-13 1.35e-18 1.21e-17 NA
4. PB B3ESU2 Elongation factor 4 2.65e-14 1.04e-18 5.91e-20 NA
4. PB A4G9U1 Elongation factor G 0.00e+00 1.91e-75 0.0 NA
4. PB Q8RFD1 Elongation factor 4 0.00e+00 7.37e-18 4.73e-22 NA
4. PB A6LC18 Elongation factor 4 1.50e-14 2.56e-17 5.04e-17 NA
4. PB B2GHU9 Elongation factor 4 2.74e-14 9.44e-19 1.17e-17 NA
4. PB Q662S4 Elongation factor 4 0.00e+00 5.42e-18 7.85e-20 NA
4. PB O29490 Probable translation initiation factor IF-2 5.67e-04 1.03e-07 6.33e-06 NA
4. PB A4I9M7 Translation factor GUF1 homolog, mitochondrial 3.83e-11 1.48e-04 2.72e-14 NA
4. PB C3K2X9 Elongation factor G 0.00e+00 1.03e-71 0.0 NA
4. PB B7MCV5 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q2NQL6 Elongation factor G 0.00e+00 3.48e-78 0.0 NA
4. PB Q74MI6 Elongation factor 1-alpha 1.72e-05 4.36e-04 7.42e-07 NA
4. PB A0LI00 Elongation factor 4 8.52e-14 2.72e-17 2.46e-17 NA
4. PB Q2FXY7 Elongation factor 4 4.33e-15 2.57e-19 5.32e-21 NA
4. PB P53013 Elongation factor 1-alpha 3.75e-05 2.06e-04 3.65e-06 NA
4. PB B8HLK8 Elongation factor 4 0.00e+00 3.99e-19 2.72e-18 NA
4. PB C7NYH7 Elongation factor 2 1.04e-13 3.40e-37 5.09e-59 NA
4. PB Q03ZQ2 Elongation factor G 0.00e+00 1.16e-73 0.0 NA
4. PB B0S8S7 Elongation factor 4 7.01e-14 9.85e-18 1.33e-17 NA
4. PB Q64NK6 Elongation factor G 0.00e+00 1.08e-79 0.0 NA
4. PB Q892Q6 Elongation factor 4 2.51e-14 8.49e-16 4.98e-19 NA
4. PB B9RUN8 Translation factor GUF1 homolog, mitochondrial 1.43e-09 2.38e-11 1.43e-18 NA
4. PB P60788 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB O59949 Elongation factor 1-alpha 4.84e-05 3.47e-05 3.99e-06 NA
4. PB Q8PUR7 Elongation factor 2 2.78e-15 1.06e-43 7.60e-66 NA
4. PB Q27139 Elongation factor 1-alpha 1 4.12e-05 1.39e-03 1.66e-06 NA
4. PB A4WIK2 Probable translation initiation factor IF-2 3.12e-04 2.12e-08 1.17e-06 NA
4. PB O93632 Elongation factor 2 3.33e-16 1.61e-45 7.43e-75 NA
4. PB Q21RV5 Elongation factor G 0.00e+00 5.07e-79 0.0 NA
4. PB B1X3K4 Translation factor GUF1 homolog, organellar chromatophore 0.00e+00 1.86e-17 3.88e-18 NA
4. PB Q0SH84 Elongation factor 4 4.65e-14 5.13e-19 1.93e-18 NA
4. PB A1TLE7 Elongation factor 4 0.00e+00 3.41e-17 2.71e-20 NA
4. PB Q97JJ6 Elongation factor 4 3.95e-14 4.28e-17 7.24e-21 NA
4. PB A8Z4C4 Elongation factor 4 1.57e-14 2.57e-19 5.32e-21 NA
4. PB C0M8H9 Elongation factor 4 2.22e-15 2.27e-16 4.17e-20 NA
4. PB Q88VN0 Elongation factor 4 1 1.22e-15 8.14e-17 9.53e-19 NA
4. PB A3DA74 Elongation factor Tu 1 1.71e-05 4.00e-02 2.19e-10 NA
4. PB A6WYK4 Elongation factor 4 0.00e+00 1.08e-17 3.85e-18 NA
4. PB B8H2Z7 Elongation factor 4 0.00e+00 1.43e-19 1.78e-17 NA
4. PB Q8K0D5 Elongation factor G, mitochondrial 0.00e+00 1.13e-35 0.0 NA
4. PB P60931 Elongation factor 4 1.63e-10 9.91e-20 1.69e-15 NA
4. PB Q3JV86 Elongation factor G 1 0.00e+00 6.24e-79 0.0 NA
4. PB B8DTV6 Elongation factor G 0.00e+00 2.67e-77 0.0 NA
4. PB Q57LC8 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB Q2YT42 Elongation factor 4 1.70e-14 2.57e-19 5.32e-21 NA
4. PB C0PYG5 Elongation factor 4 5.44e-15 2.84e-18 2.60e-19 NA
4. PB A6T3K7 Elongation factor G 0.00e+00 3.09e-77 0.0 NA
4. PB Q0I537 Elongation factor G 0.00e+00 2.27e-75 0.0 NA
4. PB Q1J6V6 Elongation factor 4 2.33e-15 3.02e-17 4.83e-18 NA
4. PB B3RHG9 Translation factor GUF1, mitochondrial 9.15e-09 2.29e-11 6.95e-18 NA
4. PB Q28LR4 Elongation factor 4 0.00e+00 1.96e-16 4.15e-16 NA
4. PB Q8U152 Elongation factor 1-alpha 1.80e-05 6.34e-03 1.44e-08 NA
4. PB Q0ABH8 Elongation factor G 0.00e+00 1.99e-77 0.0 NA
4. PB B6J5C9 Elongation factor G 0.00e+00 7.97e-74 0.0 NA
4. PB Q2HJN4 Elongation factor 1-alpha 1 6.74e-05 1.38e-04 1.01e-06 NA
4. PB A7I1F0 Elongation factor 4 0.00e+00 1.47e-19 5.07e-19 NA
4. PB Q4L6T4 Elongation factor 4 1.88e-14 1.07e-19 1.40e-19 NA
4. PB Q0BRZ7 Elongation factor 4 0.00e+00 1.58e-18 1.00e-16 NA
4. PB Q8DC78 Elongation factor 4 0.00e+00 4.87e-18 7.72e-18 NA
4. PB A0JMI9 Ribosome-releasing factor 2, mitochondrial 0.00e+00 4.54e-32 5.11e-145 NA
4. PB Q1GRH5 Elongation factor 4 2.89e-15 2.71e-18 1.45e-18 NA
4. PB B5QTV0 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB Q8YDB8 Elongation factor 4 0.00e+00 1.15e-17 3.91e-18 NA
4. PB A5DG70 Translation factor GUF1, mitochondrial 5.28e-14 1.22e-09 2.78e-17 NA
4. PB A1S3X9 Elongation factor 4 2.22e-16 2.18e-18 5.87e-17 NA
4. PB B0R6U5 Probable translation initiation factor IF-2 7.68e-04 1.21e-08 5.27e-05 NA
4. PB C1AUN7 Elongation factor 4 4.35e-14 6.49e-19 1.75e-18 NA
4. PB Q976A1 Probable translation initiation factor IF-2 4.57e-04 1.78e-08 0.022 NA
4. PB B1LP82 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB B9MB70 Elongation factor G 0.00e+00 2.27e-76 0.0 NA
4. PB P62629 Elongation factor 1-alpha 1 5.25e-05 9.93e-05 9.80e-07 NA
4. PB Q2HJN8 Elongation factor 1-alpha 2 3.76e-05 2.14e-04 1.40e-06 NA
4. PB B8DE32 Elongation factor 4 3.89e-15 8.07e-18 7.15e-20 NA
4. PB A9KKU4 Elongation factor 4 4.07e-14 3.73e-17 6.92e-21 NA
4. PB B5E4T8 Elongation factor 4 4.44e-15 1.90e-16 2.07e-18 NA
4. PB B6YVG2 Elongation factor 1-alpha 1.86e-05 7.87e-04 8.91e-09 NA
4. PB B0S1G2 Elongation factor 4 0.00e+00 6.42e-18 2.20e-23 NA
4. PB A4FWF0 Elongation factor 2 0.00e+00 8.04e-42 1.99e-47 NA
4. PB Q3SH47 Elongation factor 4 0.00e+00 4.11e-18 6.92e-21 NA
4. PB P62630 Elongation factor 1-alpha 1 5.70e-05 9.93e-05 9.80e-07 NA
4. PB P52854 Elongation factor Tu 6.14e-05 4.38e-02 1.27e-06 NA
4. PB A5G4G3 Elongation factor 4 0.00e+00 6.51e-17 4.17e-20 NA
4. PB C5DWG7 Translation factor GUF1, mitochondrial 1.39e-09 2.27e-13 1.93e-18 NA
4. PB Q31VU9 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q11QB0 Elongation factor G 0.00e+00 1.39e-77 0.0 NA
4. PB A0B7D6 Elongation factor 1-alpha 2.04e-05 3.66e-03 1.04e-05 NA
4. PB B7GYM8 Elongation factor G 0.00e+00 1.75e-68 0.0 NA
4. PB B7UK50 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB P46943 Translation factor GUF1, mitochondrial 4.93e-09 3.24e-12 6.95e-18 NA
4. PB Q8PMV3 Elongation factor 4 8.23e-14 1.10e-18 6.26e-17 NA
4. PB Q2FRI3 Elongation factor 1-alpha 7.39e-06 1.97e-03 1.73e-06 NA
4. PB A5CR97 Elongation factor 4 5.88e-14 3.63e-19 2.43e-19 NA
4. PB Q5M008 Elongation factor 4 2.44e-15 2.59e-16 5.81e-19 NA
4. PB Q6MTR6 Elongation factor 4 0.00e+00 2.25e-18 1.95e-19 NA
4. PB B0R8C8 Elongation factor 2 3.33e-16 5.62e-37 2.39e-34 NA
4. PB A0RIT7 Elongation factor 4 3.22e-15 7.23e-17 1.29e-18 NA
4. PB A7ZSL5 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A9R400 Elongation factor 4 0.00e+00 6.13e-18 5.12e-19 NA
4. PB A4YCQ5 Probable translation initiation factor IF-2 7.16e-04 2.90e-09 0.023 NA
4. PB Q72E76 Elongation factor 4 0.00e+00 3.32e-18 3.36e-18 NA
4. PB Q1D777 Elongation factor G 2 0.00e+00 8.14e-75 0.0 NA
4. PB A5CXN7 Elongation factor G 0.00e+00 6.34e-72 0.0 NA
4. PB Q7NQF0 Elongation factor G 0.00e+00 1.23e-78 0.0 NA
4. PB A8A379 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB A0Q1R8 Elongation factor 4 6.74e-14 1.78e-17 8.27e-20 NA
4. PB Q21BS0 Elongation factor 4 0.00e+00 8.71e-18 1.30e-16 NA
4. PB Q71ZJ1 Elongation factor 4 3.22e-15 8.07e-18 7.15e-20 NA
4. PB Q818E4 Elongation factor 4 3.29e-14 1.37e-16 1.07e-18 NA
4. PB Q98N59 Elongation factor G 0.00e+00 5.88e-79 0.0 NA
4. PB Q9RDC9 Elongation factor 4 2.42e-13 9.44e-19 2.68e-18 NA
4. PB Q13E78 Elongation factor 4 0.00e+00 1.29e-18 1.69e-16 NA
4. PB A3DMQ1 Elongation factor 1-alpha 3.25e-05 2.88e-03 4.53e-05 NA
4. PB B0U3D5 Elongation factor 4 1.11e-16 4.75e-17 7.40e-19 NA
4. PB P9WK96 Elongation factor 4 4.88e-14 1.14e-14 1.53e-18 NA
4. PB A8MAJ1 Elongation factor 1-alpha 2.27e-05 2.57e-02 9.84e-09 NA
4. PB P05303 Elongation factor 1-alpha 2 4.25e-05 1.66e-05 4.81e-06 NA
4. PB B7NRM2 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q82DQ1 Elongation factor G 0.00e+00 3.67e-80 0.0 NA
4. PB B3R202 Elongation factor 4 0.00e+00 7.48e-18 1.73e-19 NA
4. PB Q2KDL5 Elongation factor 4 0.00e+00 2.75e-20 2.16e-17 NA
4. PB B3CPV1 Elongation factor 4 0.00e+00 3.46e-17 1.03e-17 NA
4. PB A8H1C5 Elongation factor 4 6.66e-16 1.26e-17 4.63e-18 NA
4. PB B1JIV5 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q8XIS6 Elongation factor 4 0.00e+00 2.41e-16 1.57e-19 NA
4. PB B7H1K5 Elongation factor Tu 1.58e-05 2.64e-02 2.84e-09 NA
4. PB A6UVG0 Probable translation initiation factor IF-2 1.09e-03 7.45e-07 5.14e-04 NA
4. PB B6I5E3 Elongation factor 4 0.00e+00 6.22e-18 2.30e-19 NA
4. PB Q08BB1 Elongation factor G, mitochondrial 0.00e+00 1.14e-40 0.0 NA
4. PB Q46Z15 Elongation factor 4 0.00e+00 1.73e-18 7.96e-20 NA
4. PB Q2RKX8 Elongation factor 4 0.00e+00 1.24e-17 2.79e-20 NA
4. PB A6QHC7 Elongation factor 4 6.22e-15 2.57e-19 5.32e-21 NA
4. PB Q1JC06 Elongation factor 4 1.54e-14 6.38e-15 4.80e-18 NA
4. PB Q47UW3 Elongation factor G 2 0.00e+00 3.87e-73 0.0 NA
4. PB Q049W8 Elongation factor 4 0.00e+00 4.75e-17 8.98e-19 NA
4. PB B2J0M4 Elongation factor 4 0.00e+00 6.86e-20 1.21e-17 NA
4. PB Q47JA6 Elongation factor G 0.00e+00 2.70e-76 0.0 NA
4. PB Q97EH5 Elongation factor Tu 1.37e-05 2.77e-02 1.80e-07 NA
4. PB A6UZH4 Elongation factor Tu 1.52e-05 4.10e-02 1.31e-07 NA
4. PB A6LEJ3 Elongation factor G 0.00e+00 1.26e-74 0.0 NA
4. PB Q46PQ4 Elongation factor G 2 0.00e+00 1.84e-79 0.0 NA
4. PB A4VUL8 Elongation factor 4 3.00e-15 3.64e-16 2.36e-18 NA
4. PB F4JWP9 109 kDa U5 small nuclear ribonucleoprotein component GFL 3.19e-12 3.33e-14 1.20e-13 NA
4. PB B8BYH3 Translation factor GUF1 homolog, mitochondrial 5.40e-11 4.08e-07 9.79e-19 NA
4. PB Q3SYU2 Elongation factor 2 7.27e-14 7.17e-27 5.60e-22 NA
4. PB B3QR64 Elongation factor G 0.00e+00 1.89e-73 0.0 NA
4. PB Q5ZUD2 Elongation factor 4 0.00e+00 1.48e-18 2.28e-18 NA
4. PB A0AIS8 Elongation factor 4 2.56e-14 6.13e-18 1.02e-19 NA
4. PB B3WEQ5 Elongation factor 4 3.77e-15 7.78e-16 1.08e-18 NA
4. PB A4Y4K2 Elongation factor 4 0.00e+00 4.18e-19 3.12e-18 NA
4. PB Q160Y3 Elongation factor G 0.00e+00 2.48e-71 0.0 NA
4. PB Q87DG7 Bifunctional enzyme CysN/CysC 8.44e-04 1.31e-02 3.97e-04 NA
4. PB Q1R0H8 Elongation factor G 0.00e+00 5.03e-74 0.0 NA
4. PB P07810 Elongation factor 1-alpha 1.23e-05 1.48e-02 1.40e-11 NA
4. PB B8J444 Elongation factor 4 0.00e+00 1.22e-17 1.15e-17 NA
4. PB Q7MTL1 Elongation factor G 0.00e+00 1.82e-77 0.0 NA
4. PB Q0AWL9 Elongation factor 4 0.00e+00 4.32e-19 6.54e-19 NA
4. PB A2STM8 Probable translation initiation factor IF-2 7.69e-04 2.68e-07 0.030 NA
4. PB B7GRY7 Elongation factor 4 3.64e-14 2.91e-19 8.76e-19 NA
4. PB A8ABM5 Elongation factor 1-alpha 4.74e-05 7.94e-04 1.21e-04 NA
4. PB Q24SR6 Elongation factor 4 9.66e-15 2.37e-16 3.54e-18 NA
4. PB Q464Z4 Elongation factor 1-alpha 1.07e-05 6.34e-03 4.00e-06 NA
4. PB A5U598 Elongation factor 4 4.91e-14 1.14e-14 1.53e-18 NA
4. PB A8EW86 Elongation factor G 0.00e+00 4.11e-79 0.0 NA
4. PB Q9HM85 Elongation factor 2 1.44e-15 5.62e-37 2.39e-34 NA
4. PB P68103 Elongation factor 1-alpha 1 5.56e-05 7.77e-05 1.01e-06 NA
4. PB Q8R2Q4 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.56e-26 1.82e-151 NA
4. PB A7MZB0 Elongation factor 4 0.00e+00 6.39e-19 2.69e-18 NA
4. PB B9E6X5 Elongation factor 4 2.78e-15 2.26e-19 1.08e-19 NA
4. PB A9BE39 Elongation factor 4 0.00e+00 2.67e-18 8.84e-18 NA
4. PB P05197 Elongation factor 2 7.92e-14 6.67e-27 1.57e-22 NA
4. PB Q0BP65 Elongation factor 4 0.00e+00 9.45e-17 1.85e-17 NA
4. PB Q13UU8 Elongation factor G 1 0.00e+00 5.07e-79 0.0 NA
4. PB P90519 Elongation factor 1-alpha 4.02e-05 2.68e-03 3.56e-05 NA
4. PB A7FXL9 Elongation factor 4 7.18e-14 7.33e-17 2.18e-18 NA
4. PB Q6F9B9 Elongation factor 4 2.05e-14 4.52e-19 4.81e-19 NA
4. PB Q47WP3 Elongation factor 4 0.00e+00 2.76e-17 1.21e-19 NA
4. PB O28385 Elongation factor 2 0.00e+00 2.70e-41 1.06e-42 NA
4. PB P0CY35 Elongation factor 1-alpha 1 1.65e-05 3.75e-04 1.32e-06 NA
4. PB Q7WRC7 Elongation factor G 1 0.00e+00 9.42e-77 0.0 NA
4. PB Q8ZJB3 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q62LT1 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q13VM6 Elongation factor 4 0.00e+00 6.61e-17 5.90e-19 NA
4. PB B1YCQ7 Probable translation initiation factor IF-2 3.00e-04 6.99e-09 1.66e-06 NA
4. PB B2KA49 Elongation factor 4 1.04e-14 6.13e-18 5.12e-19 NA
4. PB Q6CK29 Ribosome-releasing factor 2, mitochondrial 0.00e+00 5.98e-46 9.90e-123 NA
4. PB P0A6M9 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB C5BRN3 Elongation factor 4 0.00e+00 6.04e-18 2.40e-19 NA
4. PB B4F049 Elongation factor 4 0.00e+00 2.71e-16 1.95e-18 NA
4. PB P68104 Elongation factor 1-alpha 1 3.96e-05 7.77e-05 1.01e-06 NA
4. PB Q3ZXK4 Elongation factor 4 1.90e-13 9.01e-19 2.79e-20 NA
4. PB B3RXR7 Translation factor GUF1 homolog, mitochondrial 1.64e-10 1.50e-11 4.79e-17 NA
4. PB P65273 Elongation factor 4 6.88e-15 6.04e-17 2.04e-18 NA
4. PB Q0BYB1 Elongation factor G 0.00e+00 4.01e-69 0.0 NA
4. PB Q30XI4 Elongation factor 4 0.00e+00 9.12e-18 4.97e-20 NA
4. PB B1XTL2 Elongation factor 4 0.00e+00 8.85e-18 3.06e-19 NA
4. PB Q2YB00 Elongation factor G 0.00e+00 3.69e-78 0.0 NA
4. PB Q92IQ1 Elongation factor 4 0.00e+00 1.70e-17 1.54e-18 NA
4. PB A9A9U4 Elongation factor 2 0.00e+00 2.58e-41 2.64e-76 NA
4. PB P65272 Elongation factor 4 6.22e-15 2.57e-19 5.32e-21 NA
4. PB C3MAX7 Elongation factor G 0.00e+00 1.68e-79 0.0 NA
4. PB A2Q0Z0 Elongation factor 1-alpha 1 6.96e-05 3.30e-05 1.01e-06 NA
4. PB Q6LXI2 Elongation factor 2 2.26e-14 2.53e-41 6.14e-75 NA
4. PB Q9USZ1 Elongation factor G, mitochondrial 0.00e+00 5.21e-32 0.0 NA
4. PB Q8F500 Elongation factor 4 1.11e-16 2.63e-16 2.55e-16 NA
4. PB A1TYJ4 Elongation factor G 0.00e+00 1.81e-71 0.0 NA
4. PB A1AE99 Elongation factor 4 0.00e+00 7.25e-18 2.24e-19 NA
4. PB B0RX30 Elongation factor 4 0.00e+00 1.26e-17 8.80e-17 NA
4. PB A4XKA0 Elongation factor 4 2.22e-16 1.52e-16 3.07e-19 NA
4. PB Q1I5V6 Elongation factor 4 0.00e+00 3.25e-19 3.85e-18 NA
4. PB Q92SU3 Elongation factor 4 0.00e+00 1.30e-19 5.36e-18 NA
4. PB Q67S76 Elongation factor 4 5.10e-14 1.02e-16 3.41e-18 NA
4. PB A0KQ96 Elongation factor G 0.00e+00 8.63e-75 0.0 NA
4. PB Q7VNA2 Elongation factor G 0.00e+00 3.09e-78 0.0 NA
4. PB B2VK36 Elongation factor G 0.00e+00 2.34e-80 0.0 NA
4. PB Q1AVV0 Elongation factor 4 1.11e-16 1.90e-20 6.14e-18 NA
4. PB A7I656 Elongation factor 1-alpha 1.12e-05 6.07e-03 1.76e-10 NA
4. PB B2IA64 Elongation factor G 0.00e+00 4.13e-69 0.0 NA
4. PB B5ZXQ5 Elongation factor 4 0.00e+00 6.14e-20 2.36e-17 NA
4. PB A4JAM5 Elongation factor Tu 3.04e-05 2.80e-02 1.76e-11 NA
4. PB P51554 Elongation factor 1-alpha 4.72e-05 1.94e-06 7.11e-06 NA
4. PB C1CEG3 Elongation factor 4 3.77e-15 1.90e-16 1.09e-18 NA
4. PB A5DPE3 Elongation factor 1-alpha 3.64e-05 3.86e-04 1.26e-06 NA
4. PB Q7UMW2 Bifunctional enzyme CysN/CysC 8.27e-04 2.42e-02 2.51e-04 NA
4. PB A8AWG3 Elongation factor 4 2.00e-15 9.45e-17 6.25e-18 NA
4. PB A5ITB2 Elongation factor 4 7.88e-15 2.57e-19 5.32e-21 NA
4. PB Q730L6 Elongation factor 4 2.71e-14 2.68e-17 1.28e-18 NA
4. PB C6A4M0 Elongation factor 2 0.00e+00 4.01e-41 8.75e-72 NA
4. PB B8GJK8 Elongation factor 2 0.00e+00 6.30e-42 2.89e-67 NA
4. PB O27131 Elongation factor 2 3.33e-15 7.46e-43 1.13e-67 NA
4. PB A4YCR6 Elongation factor 1-alpha 2.35e-05 4.53e-03 2.77e-05 NA
4. PB P02993 Elongation factor 1-alpha 3.86e-05 8.66e-05 6.74e-07 NA
4. PB C3NHB6 Elongation factor 2 4.11e-15 2.22e-39 4.70e-70 NA
4. PB Q41011 Elongation factor 1-alpha 5.00e-05 3.55e-05 1.41e-05 NA
4. PB A1B023 Elongation factor G 0.00e+00 2.11e-69 0.0 NA
4. PB P13060 Eukaryotic translation elongation factor 2 6.44e-15 4.85e-28 7.60e-22 NA
4. PB A6UV43 Elongation factor 1-alpha 1.45e-05 1.68e-02 1.47e-10 NA
4. PB P0DH99 Elongation factor 1-alpha 1 5.53e-05 8.91e-05 1.06e-06 NA
4. PB Q8PB55 Elongation factor 4 0.00e+00 1.30e-17 9.11e-17 NA
4. PB B1YKS5 Elongation factor 4 0.00e+00 1.38e-17 2.13e-18 NA
4. PB Q3SLQ2 Elongation factor G 0.00e+00 8.89e-77 0.0 NA
4. PB Q2JWR1 Elongation factor 4 0.00e+00 1.70e-18 5.46e-19 NA
4. PB P09445 Elongation factor 2 4.85e-13 1.73e-27 1.34e-22 NA
4. PB Q608M4 Elongation factor 4 1.69e-14 1.13e-17 2.82e-17 NA
4. PB A6QLJ3 Translation factor GUF1, mitochondrial 3.91e-14 7.30e-10 1.15e-20 NA
4. PB A9M3X0 Elongation factor G 0.00e+00 8.44e-74 0.0 NA
4. PB A7MH13 Elongation factor 4 1.09e-14 5.68e-18 1.66e-19 NA
4. PB A9KRZ3 Elongation factor G 0.00e+00 9.77e-76 0.0 NA
4. PB B1YVM2 Elongation factor 4 0.00e+00 1.89e-17 5.31e-19 NA
4. PB Q9RXK5 Elongation factor G 0.00e+00 3.28e-78 0.0 NA
4. PB B0TAD2 Elongation factor 4 0.00e+00 4.54e-17 1.14e-19 NA
4. PB Q5QWB4 Elongation factor G 0.00e+00 3.88e-74 0.0 NA
4. PB A2BJZ8 Probable translation initiation factor IF-2 6.00e-04 7.24e-08 0.001 NA
4. PB Q5E8B9 Elongation factor G 1 0.00e+00 1.48e-77 0.0 NA
4. PB A0RW30 Elongation factor 2 6.22e-15 1.14e-39 3.50e-34 NA
4. PB P60792 Elongation factor 4 1.81e-13 4.18e-18 1.91e-20 NA
4. PB Q38W39 Elongation factor 4 2.00e-15 3.05e-16 2.31e-17 NA
4. PB P50257 Elongation factor 1-alpha S 3.50e-05 3.31e-04 5.29e-06 NA
4. PB B7UH09 Elongation factor 4 0.00e+00 7.25e-18 2.24e-19 NA
4. PB Q123W3 Elongation factor G 2 0.00e+00 9.23e-78 0.0 NA
4. PB Q5P089 Elongation factor 4 2.22e-14 1.44e-17 2.59e-20 NA
4. PB Q64T74 Elongation factor 4 3.01e-14 6.32e-18 4.59e-18 NA
4. PB B3CRQ1 Elongation factor 4 0.00e+00 2.80e-17 4.26e-18 NA
4. PB B2SC25 Elongation factor 4 0.00e+00 1.38e-17 3.98e-18 NA
4. PB P0CN30 Elongation factor 1-alpha 3.56e-05 3.22e-04 1.33e-04 NA
4. PB Q7NWC7 Elongation factor 4 0.00e+00 3.68e-17 4.26e-20 NA
4. PB Q976B1 Elongation factor 1-alpha 2.33e-05 1.21e-03 9.28e-07 NA
4. PB Q87L45 Elongation factor G 1 0.00e+00 5.81e-74 0.0 NA
4. PB Q6F0Z2 Elongation factor 4 3.80e-14 7.79e-17 1.98e-18 NA
4. PB Q58448 Elongation factor 2 0.00e+00 1.87e-39 4.75e-52 NA
4. PB Q0T1T6 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q2NEL0 Elongation factor 2 1.11e-15 4.52e-42 1.03e-40 NA
4. PB Q9LNC5 110 kDa U5 small nuclear ribonucleoprotein component CLO 4.12e-12 2.95e-15 2.92e-14 NA
4. PB O51115 Elongation factor 4 1.55e-15 7.95e-18 3.61e-20 NA
4. PB A4J080 Elongation factor 4 0.00e+00 1.03e-16 5.68e-18 NA
4. PB Q1HPK6 Translation elongation factor 2 5.61e-13 2.58e-27 1.26e-21 NA
4. PB Q46WE0 Elongation factor G 1 0.00e+00 8.14e-77 0.0 NA
4. PB Q5WVI1 Elongation factor 4 0.00e+00 9.29e-19 2.18e-18 NA
4. PB Q7NGX4 Elongation factor 4 0.00e+00 1.12e-18 1.63e-18 NA
4. PB Q02HR9 Elongation factor 4 1.09e-14 2.33e-19 4.43e-18 NA
4. PB Q3B2V1 Elongation factor 4 2.62e-13 3.47e-18 4.18e-19 NA
4. PB A8A5E7 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB B4S9B7 Elongation factor 4 1.72e-13 1.63e-18 9.43e-19 NA
4. PB A8LR11 Elongation factor 4 0.00e+00 1.15e-17 1.09e-16 NA
4. PB C1DQS0 Elongation factor 4 0.00e+00 1.04e-18 3.26e-18 NA
4. PB Q8Y0I4 Elongation factor 4 1.01e-14 1.55e-17 1.29e-20 NA
4. PB Q9Y713 Elongation factor 1-alpha 3.57e-05 3.22e-04 2.79e-05 NA
4. PB A5N6L8 Elongation factor 4 0.00e+00 4.34e-16 8.89e-19 NA
4. PB A5VB59 Elongation factor 4 4.66e-15 2.02e-18 6.03e-17 NA
4. PB A3DMS0 Probable translation initiation factor IF-2 1.74e-03 1.30e-07 0.002 NA
4. PB B0RCT0 Elongation factor 4 6.97e-14 4.82e-19 2.52e-19 NA
4. PB B6K6L6 Translation factor guf1, mitochondrial 1.41e-12 8.56e-14 6.44e-16 NA
4. PB A4WDE0 Elongation factor 4 0.00e+00 4.65e-18 1.56e-19 NA
4. PB Q12Z93 Probable translation initiation factor IF-2 5.78e-04 8.77e-08 1.63e-04 NA
4. PB B0BWV5 Elongation factor 4 0.00e+00 6.32e-18 2.77e-18 NA
4. PB A4HAG7 Translation factor GUF1 homolog, mitochondrial 5.07e-09 9.55e-06 3.01e-14 NA
4. PB Q5VTE0 Putative elongation factor 1-alpha-like 3 1.19e-04 8.91e-05 8.99e-07 NA
4. PB Q41803 Elongation factor 1-alpha 4.85e-05 2.04e-05 1.30e-06 NA
4. PB B4SUU6 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q7V2Q1 Elongation factor 4 1.11e-16 3.25e-19 1.95e-19 NA
4. PB A4J7F8 Elongation factor 4 0.00e+00 6.93e-18 1.20e-19 NA
4. PB Q9V0V7 Elongation factor 1-alpha 1.64e-05 8.71e-04 1.56e-08 NA
4. PB C3K6G8 Elongation factor 4 0.00e+00 3.32e-18 3.17e-18 NA
4. PB Q5LMR4 Elongation factor G 0.00e+00 1.15e-71 0.0 NA
4. PB B7IYH2 Elongation factor 4 2.43e-14 1.10e-17 1.19e-18 NA
4. PB Q089Q7 Elongation factor G 1 0.00e+00 7.29e-78 0.0 NA
4. PB A3M306 Elongation factor G 0.00e+00 5.03e-68 0.0 NA
4. PB A2SDH0 Elongation factor 4 0.00e+00 4.87e-18 1.19e-19 NA
4. PB Q1B684 Elongation factor 4 4.69e-14 2.69e-19 1.73e-17 NA
4. PB O59521 Elongation factor 2 0.00e+00 3.70e-40 2.99e-73 NA
4. PB A3D1V4 Elongation factor 4 0.00e+00 2.30e-17 1.93e-18 NA
4. PB B9KNH9 Elongation factor 4 1.60e-14 1.79e-18 2.06e-18 NA
4. PB A6ZQM4 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.14e-38 2.18e-120 NA
4. PB Q8D3H2 Elongation factor G 0.00e+00 1.26e-73 0.0 NA
4. PB Q8DCQ8 Elongation factor G 0.00e+00 2.44e-73 0.0 NA
4. PB O49169 Elongation factor 1-alpha 3.11e-05 8.91e-05 1.05e-06 NA
4. PB A6URS1 Probable translation initiation factor IF-2 1.11e-03 5.86e-07 0.001 NA
4. PB P70782 Elongation factor G 0.00e+00 6.67e-80 0.0 NA
4. PB Q2N9U6 Elongation factor 4 6.77e-15 3.47e-18 1.44e-15 NA
4. PB B8EBQ4 Elongation factor 4 0.00e+00 2.04e-17 2.01e-18 NA
4. PB Q8YHP3 Elongation factor G 0.00e+00 7.71e-81 0.0 NA
4. PB O66428 Elongation factor G 0.00e+00 1.51e-75 0.0 NA
4. PB Q1R8G3 Elongation factor 4 0.00e+00 7.25e-18 2.24e-19 NA
4. PB A9RFQ5 Translation factor GUF1 homolog, chloroplastic 4.44e-16 1.37e-03 2.51e-18 NA
4. PB B1Y7G9 Elongation factor G 0.00e+00 1.52e-77 0.0 NA
4. PB A4VHM7 Elongation factor G 0.00e+00 7.46e-75 0.0 NA
4. PB Q9Z8I4 Elongation factor 4 1.53e-13 3.02e-17 7.57e-21 NA
4. PB B2SEJ6 Elongation factor 4 0.00e+00 5.36e-17 8.13e-18 NA
4. PB P95691 Probable translation initiation factor IF-2 4.46e-04 4.58e-10 0.011 NA
4. PB A4QV78 Translation factor GUF1, mitochondrial 7.84e-13 2.20e-07 9.97e-16 NA
4. PB A1W2Q4 Elongation factor G 0.00e+00 3.95e-76 0.0 NA
4. PB Q1LI29 Elongation factor G 1 0.00e+00 7.67e-77 0.0 NA
4. PB A3N247 Elongation factor G 0.00e+00 1.09e-74 0.0 NA
4. PB A2BV79 Elongation factor 4 0.00e+00 2.49e-19 2.20e-19 NA
4. PB Q7VL73 Elongation factor 4 0.00e+00 2.22e-18 6.39e-19 NA
4. PB Q3ALG5 Elongation factor 4 0.00e+00 6.32e-18 1.24e-19 NA
4. PB Q8EWZ9 Elongation factor 4 0.00e+00 2.34e-17 1.31e-20 NA
4. PB C4Y8M4 Translation factor GUF1, mitochondrial 1.35e-13 8.77e-10 6.01e-18 NA
4. PB B5XNG8 Elongation factor 4 0.00e+00 4.37e-18 7.53e-20 NA
4. PB P33167 Elongation factor Tu 1.25e-05 4.31e-02 1.77e-11 NA
4. PB P0DC23 Elongation factor 4 3.44e-15 5.20e-17 1.30e-18 NA
4. PB Q14JC2 Elongation factor G 0.00e+00 9.21e-76 0.0 NA
4. PB B6JJT7 Elongation factor 4 1.78e-14 9.01e-19 1.43e-17 NA
4. PB B0VCT7 Elongation factor 4 0.00e+00 1.09e-18 6.54e-19 NA
4. PB C3PHY1 Elongation factor 4 1.93e-14 6.54e-20 5.48e-16 NA
4. PB Q97BK4 Probable translation initiation factor IF-2 1.02e-03 3.45e-08 0.002 NA
4. PB Q9V1Z8 Elongation factor 2 0.00e+00 7.09e-40 1.15e-73 NA
4. PB O84067 Elongation factor 4 5.27e-11 1.65e-18 4.16e-18 NA
4. PB B1IC02 Elongation factor 4 2.33e-15 1.39e-16 2.97e-18 NA
4. PB B9JDS6 Elongation factor G 0.00e+00 3.05e-79 0.0 NA
4. PB P60785 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB A4W0W0 Elongation factor 4 3.11e-15 3.64e-16 2.36e-18 NA
4. PB P60793 Elongation factor 4 0.00e+00 1.99e-18 2.68e-16 NA
4. PB B2K5N5 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB B7JNV1 Elongation factor 4 2.59e-14 3.62e-17 1.40e-18 NA
4. PB A1TJ04 Elongation factor G 0.00e+00 6.63e-77 0.0 NA
4. PB A1UIU2 Elongation factor 4 3.63e-14 2.69e-19 1.73e-17 NA
4. PB Q969S9 Ribosome-releasing factor 2, mitochondrial 0.00e+00 8.14e-29 3.06e-152 NA
4. PB Q2RNY6 Elongation factor 4 0.00e+00 4.72e-18 3.21e-16 NA
4. PB B4SRL3 Elongation factor 4 0.00e+00 1.86e-17 3.23e-17 NA
4. PB Q044A7 Elongation factor 4 0.00e+00 6.51e-17 5.31e-16 NA
4. PB A4SUV8 Elongation factor G 0.00e+00 4.04e-78 0.0 NA
4. PB Q9K1I8 Elongation factor G 0.00e+00 1.26e-73 0.0 NA
4. PB P57938 Elongation factor G 0.00e+00 4.69e-75 0.0 NA
4. PB Q1JLY8 Elongation factor 4 3.33e-15 6.71e-17 3.47e-18 NA
4. PB Q89AM5 Elongation factor 4 0.00e+00 4.95e-16 2.75e-21 NA
4. PB B1IVQ8 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q55E94 Elongation factor G, mitochondrial 0.00e+00 1.70e-42 0.0 NA
4. PB P65274 Elongation factor 4 2.66e-15 6.04e-17 2.04e-18 NA
4. PB Q9HWD2 Elongation factor G 1 0.00e+00 1.71e-77 0.0 NA
4. PB B0KV29 Elongation factor 4 1.58e-14 3.53e-18 4.84e-18 NA
4. PB B5YTP7 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB C0RMH8 Elongation factor 4 0.00e+00 1.15e-17 3.91e-18 NA
4. PB Q04634 Elongation factor 1-alpha 4.42e-05 4.82e-03 3.06e-06 NA
4. PB C5CCD4 Elongation factor 4 6.99e-14 5.21e-19 2.69e-20 NA
4. PB Q3J8D2 Elongation factor 4 0.00e+00 3.20e-19 5.06e-18 NA
4. PB B5ZAB8 Elongation factor 4 0.00e+00 4.31e-20 1.18e-17 NA
4. PB Q2A5X6 Elongation factor 4 0.00e+00 9.45e-17 1.85e-17 NA
4. PB B1ILM7 Elongation factor 4 5.85e-14 1.82e-16 1.52e-18 NA
4. PB B1KSM7 Elongation factor Tu 1.71e-05 2.30e-02 3.76e-10 NA
4. PB A6TCI3 Elongation factor 4 0.00e+00 3.32e-18 1.96e-19 NA
4. PB A4XZ93 Elongation factor G 0.00e+00 1.60e-70 0.0 NA
4. PB B7PJS6 Translation factor GUF1 homolog, mitochondrial 1.10e-10 2.44e-15 4.51e-17 NA
4. PB A5VR09 Elongation factor G 0.00e+00 2.05e-81 0.0 NA
4. PB B8D9V0 Elongation factor G 0.00e+00 4.69e-75 0.0 NA
4. PB B6YVG5 Elongation factor 2 0.00e+00 1.12e-39 1.41e-70 NA
4. PB Q6LVC1 Elongation factor G 1 0.00e+00 6.66e-73 0.0 NA
4. PB C4K3Z1 Elongation factor 4 0.00e+00 8.32e-18 9.22e-20 NA
4. PB Q5F5S3 Elongation factor G 0.00e+00 2.18e-73 0.0 NA
4. PB B4S5N0 Elongation factor G 0.00e+00 1.06e-76 0.0 NA
4. PB Q5X862 Elongation factor G 0.00e+00 2.97e-79 0.0 NA
4. PB B1ZC10 Elongation factor 4 0.00e+00 6.22e-18 4.65e-17 NA
4. PB B3PLG4 Elongation factor 4 0.00e+00 7.93e-20 2.23e-18 NA
4. PB A1KRF9 Elongation factor Tu 1.31e-05 2.87e-02 1.72e-08 NA
4. PB Q8NN68 Elongation factor 4 3.06e-14 4.12e-19 8.86e-16 NA
4. PB C4YJQ8 Elongation factor 2 2.82e-14 3.74e-30 7.26e-24 NA
4. PB Q6G550 Elongation factor 4 0.00e+00 7.71e-18 9.10e-19 NA
4. PB Q2JQ51 Elongation factor 4 0.00e+00 3.02e-18 2.41e-19 NA
4. PB O83523 Elongation factor 4 0.00e+00 2.45e-17 4.38e-17 NA
4. PB B0B9H2 Elongation factor 4 5.79e-11 2.67e-18 4.39e-18 NA
4. PB B5BGZ2 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q0C5X0 Elongation factor 4 0.00e+00 3.64e-18 1.14e-15 NA
4. PB Q1H2L5 Elongation factor 4 0.00e+00 9.74e-17 1.22e-19 NA
4. PB Q57918 Selenocysteine-specific elongation factor 3.27e-03 1.29e-04 3.56e-07 NA
4. PB P16018 Elongation factor 1-alpha 1.17e-05 3.12e-02 4.29e-13 NA
4. PB B8G6S9 Elongation factor G 0.00e+00 9.84e-80 0.0 NA
4. PB P41203 Elongation factor 1-alpha 2.60e-05 3.73e-03 5.42e-08 NA
4. PB B1XZN0 Elongation factor 4 0.00e+00 2.43e-18 4.73e-20 NA
4. PB Q4UIN6 Translation factor GUF1 homolog, mitochondrial 9.31e-12 6.87e-10 1.54e-17 NA
4. PB Q8K9Q9 Elongation factor 4 0.00e+00 8.14e-17 2.41e-18 NA
4. PB P57593 Elongation factor G 0.00e+00 4.69e-75 0.0 NA
4. PB A5FLU8 Elongation factor 4 0.00e+00 7.44e-17 9.55e-18 NA
4. PB Q576S5 Elongation factor 4 0.00e+00 1.38e-17 3.98e-18 NA
4. PB A5ULM6 Elongation factor 2 0.00e+00 1.09e-39 2.32e-65 NA
4. PB Q089R8 Elongation factor Tu 1 1.75e-05 3.36e-02 1.26e-09 NA
4. PB Q8YU48 Elongation factor 4 0.00e+00 1.11e-19 1.88e-18 NA
4. PB Q13TF5 Elongation factor Tu 1.59e-05 2.49e-02 1.14e-11 NA
4. PB Q5BJP6 Ribosome-releasing factor 2, mitochondrial 0.00e+00 3.08e-25 2.69e-154 NA
4. PB C1AQW9 Elongation factor 4 9.90e-14 1.14e-14 1.53e-18 NA
4. PB Q5QWA3 Elongation factor Tu 1.61e-05 3.47e-02 1.17e-09 NA
4. PB Q9A9F4 Elongation factor 4 0.00e+00 8.86e-20 1.83e-17 NA
4. PB B2G6W5 Elongation factor 4 2.00e-15 4.80e-18 4.14e-19 NA
4. PB Q2T0I7 Elongation factor G 1 0.00e+00 2.17e-78 0.0 NA
4. PB Q112D2 Elongation factor 4 0.00e+00 1.30e-19 2.85e-18 NA
4. PB P35021 Elongation factor 1-alpha 1.99e-05 1.74e-02 2.91e-07 NA
4. PB B7LS46 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q2NJE6 Elongation factor 4 1.41e-13 1.84e-17 1.66e-19 NA
4. PB Q134R0 Elongation factor Tu 2 1.42e-05 3.97e-02 6.08e-12 NA
4. PB B4EYV7 Elongation factor G 0.00e+00 4.88e-74 0.0 NA
4. PB Q874B9 Elongation factor 2 1.07e-14 2.27e-29 3.22e-24 NA
4. PB P10126 Elongation factor 1-alpha 1 5.72e-05 9.93e-05 9.80e-07 NA
4. PB B3EUF3 Elongation factor G 0.00e+00 6.65e-75 0.0 NA
4. PB Q15R31 Elongation factor 4 0.00e+00 2.80e-18 4.83e-20 NA
4. PB Q664R6 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB Q5HFH6 Elongation factor 4 7.77e-15 2.57e-19 5.32e-21 NA
4. PB P0A1W5 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB O94316 Pre-mRNA-splicing factor cwf10 3.51e-11 1.43e-14 6.70e-08 NA
4. PB C6A1V3 Probable translation initiation factor IF-2 5.67e-04 1.36e-07 5.81e-06 NA
4. PB B9KL88 Elongation factor G 0.00e+00 6.66e-73 0.0 NA
4. PB P26752 Elongation factor 2 2.11e-15 2.88e-38 6.17e-71 NA
4. PB B9IY86 Elongation factor 4 7.66e-15 6.91e-17 1.45e-18 NA
4. PB Q5N390 Elongation factor 4 0.00e+00 9.00e-20 5.82e-19 NA
4. PB A8ACA7 Elongation factor 2 0.00e+00 8.81e-41 5.63e-70 NA
4. PB Q04ED6 Elongation factor G 0.00e+00 5.40e-77 0.0 NA
4. PB B0SRL4 Elongation factor 4 6.26e-14 9.85e-18 1.33e-17 NA
4. PB Q4QPM8 Elongation factor 4 1.33e-14 1.32e-17 2.35e-19 NA
4. PB Q96RP9 Elongation factor G, mitochondrial 0.00e+00 1.03e-34 0.0 NA
4. PB Q8DM20 Elongation factor 4 0.00e+00 9.29e-19 8.03e-19 NA
4. PB C5BAI0 Elongation factor 4 0.00e+00 8.58e-18 1.99e-19 NA
4. PB B0VTG3 Elongation factor G 0.00e+00 1.26e-66 0.0 NA
4. PB A1WAW8 Elongation factor 4 0.00e+00 1.60e-17 6.84e-20 NA
4. PB Q2NEL1 Elongation factor 1-alpha 1.06e-05 1.85e-02 2.22e-06 NA
4. PB P86933 Elongation factor 1-alpha 4.00e-05 3.61e-04 2.91e-06 NA
4. PB A5FR18 Elongation factor 4 5.82e-13 9.01e-19 2.79e-20 NA
4. PB A8GRF6 Elongation factor 4 0.00e+00 6.32e-18 2.77e-18 NA
4. PB Q5GWS9 Elongation factor G 0.00e+00 2.34e-79 0.0 NA
4. PB B2RKK1 Elongation factor 4 0.00e+00 2.01e-17 5.22e-17 NA
4. PB Q87A35 Elongation factor G 0.00e+00 4.13e-69 0.0 NA
4. PB Q9FLE4 Translation factor GUF1 homolog, mitochondrial 7.06e-13 4.81e-11 3.04e-20 NA
4. PB Q31R08 Elongation factor 4 0.00e+00 2.41e-19 2.33e-19 NA
4. PB C5Z3W1 Translation factor GUF1 homolog, mitochondrial 7.26e-13 4.86e-08 3.11e-20 NA
4. PB A6TSM4 Elongation factor 4 1.11e-16 2.91e-15 3.73e-19 NA
4. PB Q00ZZ1 Translation factor GUF1 homolog, mitochondrial 7.77e-16 3.20e-12 4.10e-20 NA
4. PB Q90835 Elongation factor 1-alpha 1 4.35e-05 8.16e-05 9.72e-07 NA
4. PB A8A8D3 Probable translation initiation factor IF-2 6.55e-04 1.16e-08 2.47e-04 NA
4. PB Q01372 Elongation factor 1-alpha 3.43e-05 3.17e-05 5.46e-06 NA
4. PB P54959 Elongation factor 1-alpha 3.45e-05 6.65e-04 2.67e-05 NA
4. PB P53893 Ribosome assembly protein 1 1.63e-07 4.78e-14 7.51e-14 NA
4. PB Q1CCT8 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB B1J4D8 Elongation factor 4 1.12e-14 1.57e-19 2.93e-18 NA
4. PB B2SRY0 Elongation factor 4 6.36e-14 2.38e-17 3.94e-16 NA
4. PB Q0VSL8 Elongation factor G 0.00e+00 4.23e-74 0.0 NA
4. PB P0CT31 Elongation factor 1-alpha 3.87e-05 1.55e-06 3.87e-08 NA
4. PB Q6BMV8 Translation factor GUF1, mitochondrial 1.01e-13 2.59e-16 2.22e-17 NA
4. PB B0TIV5 Elongation factor 4 9.11e-14 4.58e-18 4.55e-18 NA
4. PB Q83NI1 Elongation factor 4 4.66e-14 1.20e-16 4.55e-19 NA
4. PB Q8G5B6 Elongation factor G 0.00e+00 1.07e-80 0.0 NA
4. PB Q8EK71 Elongation factor G 1 0.00e+00 1.60e-75 0.0 NA
4. PB Q0WL56 Elongation factor 1-alpha 3 3.75e-05 8.91e-05 1.06e-06 NA
4. PB Q254E1 Elongation factor 4 1.76e-13 4.61e-17 4.66e-21 NA
4. PB Q5YZZ7 Elongation factor 4 3.10e-14 2.25e-18 3.26e-18 NA
4. PB P09591 Elongation factor Tu 1.55e-05 4.10e-02 1.31e-07 NA
4. PB B5ZBD4 Elongation factor 4 9.09e-14 3.91e-17 4.06e-18 NA
4. PB Q3IDL4 Elongation factor 4 0.00e+00 1.53e-17 8.22e-19 NA
4. PB Q1IX68 Elongation factor G 0.00e+00 4.52e-77 0.0 NA
4. PB Q9I244 Elongation factor G 2 0.00e+00 1.01e-79 0.0 NA
4. PB Q5VQ69 Translation factor GUF1 homolog, mitochondrial 7.69e-13 8.72e-11 1.55e-19 NA
4. PB C4ZUJ5 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB B1KZP1 Elongation factor 4 6.34e-14 9.59e-17 2.19e-18 NA
4. PB B8JAF3 Elongation factor 4 1.11e-16 3.53e-16 1.94e-21 NA
4. PB A4TGY6 Elongation factor G 0.00e+00 2.04e-78 0.0 NA
4. PB A3CTG3 Elongation factor 1-alpha 1.24e-05 1.54e-04 2.47e-07 NA
4. PB Q23716 Elongation factor 2 9.29e-13 3.47e-30 2.58e-21 NA
4. PB B5BAS8 Elongation factor 4 0.00e+00 1.46e-18 2.97e-19 NA
4. PB B8NDZ1 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.14e-38 2.44e-115 NA
4. PB Q6MEF3 Elongation factor 4 2.74e-13 2.68e-17 5.39e-20 NA
4. PB Q5PAX8 Elongation factor 4 0.00e+00 5.52e-17 2.19e-14 NA
4. PB B0TM14 Elongation factor Tu 1.92e-05 4.88e-02 1.38e-09 NA
4. PB A3PHQ9 Elongation factor 4 1.70e-14 1.25e-18 2.19e-18 NA
4. PB Q7Z2Z2 Elongation factor-like GTPase 1 8.95e-07 2.01e-14 8.68e-19 NA
4. PB A9L5N4 Elongation factor 4 8.55e-15 2.04e-17 2.01e-18 NA
4. PB A5GMR2 Elongation factor 4 1.11e-16 2.80e-18 3.62e-19 NA
4. PB A4RZA6 Translation factor GUF1 homolog, chloroplastic 0.00e+00 5.94e-18 8.38e-16 NA
4. PB Q9ASR1 Elongation factor 2 5.75e-13 6.40e-31 4.68e-20 NA
4. PB B5RH09 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB Q49Y26 Elongation factor 4 1.29e-14 6.91e-19 1.06e-19 NA
4. PB A3Q2A6 Elongation factor 4 3.38e-14 2.69e-19 1.73e-17 NA
4. PB Q5A0M4 Elongation factor 2 2.25e-14 4.19e-30 6.95e-24 NA
4. PB P14865 Elongation factor 1-alpha 7.05e-05 5.17e-04 1.23e-06 NA
4. PB B5FAH2 Elongation factor 4 0.00e+00 4.18e-19 4.56e-18 NA
4. PB Q2GGA6 Elongation factor 4 0.00e+00 3.07e-17 5.67e-16 NA
4. PB Q605A9 Elongation factor G 2 0.00e+00 4.14e-77 0.0 NA
4. PB Q92QH2 Elongation factor G 0.00e+00 1.43e-78 0.0 NA
4. PB Q8FNA3 Elongation factor 4 4.10e-14 8.87e-19 8.86e-16 NA
4. PB Q1AU26 Elongation factor G 0.00e+00 1.02e-66 0.0 NA
4. PB B8ELG5 Elongation factor Tu 1.20e-05 2.94e-02 5.13e-12 NA
4. PB Q5ZYP6 Elongation factor G 0.00e+00 1.25e-79 0.0 NA
4. PB Q3ILP5 Elongation factor G 1 0.00e+00 6.90e-74 0.0 NA
4. PB A1WMW4 Elongation factor 4 0.00e+00 1.87e-18 4.29e-20 NA
4. PB A7FZ71 Elongation factor Tu 1.68e-05 3.12e-02 4.07e-10 NA
4. PB B6YWH3 Probable translation initiation factor IF-2 2.41e-04 7.75e-08 3.23e-04 NA
4. PB B8FUP2 Elongation factor 4 1.13e-14 2.37e-16 3.54e-18 NA
4. PB Q62HK4 Elongation factor G 1 0.00e+00 7.91e-79 0.0 NA
4. PB A2SLG0 Elongation factor G 0.00e+00 9.99e-77 0.0 NA
4. PB Q4FUV9 Elongation factor 4 0.00e+00 3.53e-18 3.17e-19 NA
4. PB Q2J2Y0 Elongation factor 4 0.00e+00 5.55e-19 1.89e-16 NA
4. PB P37949 Elongation factor 4 1.10e-14 1.03e-16 4.75e-18 NA
4. PB Q1H4P0 Elongation factor G 0.00e+00 1.19e-76 0.0 NA
4. PB B8D852 Elongation factor G 0.00e+00 4.69e-75 0.0 NA
4. PB B8ZUS2 Elongation factor 4 5.30e-14 2.51e-18 6.17e-18 NA
4. PB P0CT53 Elongation factor 1-alpha-A 3.58e-05 9.92e-04 5.15e-08 NA
4. PB A6X0B5 Elongation factor G 0.00e+00 1.87e-81 0.0 NA
4. PB Q5SKA7 Elongation factor 4 1.17e-13 1.71e-16 1.75e-17 NA
4. PB Q2A5H2 Elongation factor G 0.00e+00 7.51e-76 0.0 NA
4. PB Q4Q3F0 Translation factor GUF1 homolog, mitochondrial 5.69e-08 6.25e-06 2.22e-14 NA
4. PB Q10W80 Elongation factor G 2 0.00e+00 1.30e-76 0.0 NA
4. PB A7X2Y7 Elongation factor 4 7.11e-15 2.57e-19 5.32e-21 NA
4. PB B6I240 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB P34811 Elongation factor G-1, chloroplastic 0.00e+00 1.27e-16 0.0 NA
4. PB Q1R5U3 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A4WKK8 Elongation factor 1-alpha 3.73e-05 2.10e-02 1.08e-06 NA
4. PB A5VJE9 Elongation factor 4 2.22e-15 4.80e-18 4.14e-19 NA
4. PB Q87C09 Elongation factor 4 1.11e-16 4.28e-17 7.20e-19 NA
4. PB Q5NEF8 Elongation factor 4 0.00e+00 8.77e-17 8.28e-18 NA
4. PB Q5NLP5 Elongation factor 4 0.00e+00 2.98e-18 1.84e-16 NA
4. PB Q4K530 Elongation factor G 0.00e+00 4.11e-74 0.0 NA
4. PB Q0VP16 Elongation factor 4 0.00e+00 1.89e-17 2.28e-17 NA
4. PB Q4URD6 Elongation factor G 0.00e+00 1.00e-78 0.0 NA
4. PB B4TS16 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB A4FZQ3 Probable translation initiation factor IF-2 3.60e-04 1.32e-07 0.003 NA
4. PB O50565 Elongation factor G 0.00e+00 6.51e-74 0.0 NA
4. PB Q2NS11 Elongation factor 4 8.77e-15 2.93e-18 5.99e-20 NA
4. PB A9MGX5 Elongation factor 4 0.00e+00 3.02e-18 3.24e-19 NA
4. PB Q9PQG7 Elongation factor 4 8.30e-14 2.44e-16 4.59e-18 NA
4. PB P0A1W4 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB Q1IFW8 Elongation factor Tu 2.10e-05 3.25e-02 5.52e-08 NA
4. PB B8H8S3 Elongation factor 4 3.64e-14 8.33e-19 3.48e-19 NA
4. PB Q1BXU3 Elongation factor 4 0.00e+00 1.92e-17 4.95e-19 NA
4. PB Q72QU8 Elongation factor 4 1.11e-16 2.63e-16 2.55e-16 NA
4. PB P33159 Elongation factor 2 0.00e+00 4.90e-38 1.73e-59 NA
4. PB A6KYJ7 Elongation factor G 0.00e+00 1.79e-79 0.0 NA
4. PB P41745 Elongation factor 1-alpha 3.62e-05 1.90e-04 8.16e-05 NA
4. PB Q90705 Elongation factor 2 1.44e-14 9.93e-27 9.39e-23 NA
4. PB B5FRC7 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB Q9X1V8 Elongation factor 4 1.11e-16 2.98e-17 7.18e-21 NA
4. PB Q74M52 Elongation factor 2 0.00e+00 8.18e-37 2.22e-65 NA
4. PB Q8PNS6 Elongation factor G 0.00e+00 3.05e-79 0.0 NA
4. PB P75498 Elongation factor 4 0.00e+00 4.41e-17 1.48e-16 NA
4. PB Q8G603 Elongation factor 4 4.46e-14 2.96e-19 1.21e-18 NA
4. PB B7K3Z7 Elongation factor 4 0.00e+00 3.00e-19 4.97e-18 NA
4. PB P26751 Elongation factor 1-alpha 1.94e-05 1.38e-02 1.70e-08 NA
4. PB A7NR66 Elongation factor G 0.00e+00 2.60e-83 0.0 NA
4. PB Q57J26 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB P40911 Elongation factor 1-alpha 3.19e-05 2.35e-04 1.69e-04 NA
4. PB Q0HNT9 Elongation factor Tu 2 1.63e-05 3.59e-02 3.87e-10 NA
4. PB B5F1G3 Elongation factor 4 0.00e+00 2.55e-18 2.81e-19 NA
4. PB Q7UX15 Elongation factor 4 1 1.11e-16 4.12e-19 4.63e-19 NA
4. PB A7N9S4 Elongation factor G 0.00e+00 6.49e-76 0.0 NA
4. PB Q6L202 Elongation factor 1-alpha 1.69e-05 4.87e-03 4.27e-10 NA
4. PB B7NDU8 Elongation factor G 0.00e+00 6.24e-79 0.0 NA
4. PB Q8UE15 Elongation factor G 0.00e+00 2.98e-80 0.0 NA
4. PB B0CS18 Translation factor GUF1, mitochondrial 6.74e-13 3.36e-17 1.41e-17 NA
4. PB Q8LPC4 Elongation factor 1-alpha 3.82e-05 8.99e-03 1.88e-06 NA
4. PB O67618 Elongation factor 4 0.00e+00 1.76e-18 6.99e-22 NA
4. PB B5E1P9 Peptide chain release factor 3 NA 1.90e-13 4.95e-46 NA
4. PB B1MW21 Elongation factor G 0.00e+00 6.13e-76 0.0 NA
4. PB C3P8M5 Elongation factor 4 9.10e-15 2.17e-17 1.68e-18 NA
4. PB Q2S909 Elongation factor G 1 0.00e+00 5.72e-77 0.0 NA
4. PB Q9YIC0 Elongation factor 1-alpha 4.71e-05 9.27e-05 3.60e-06 NA
4. PB B1VGK6 Elongation factor 4 1.83e-14 4.89e-19 2.65e-16 NA
4. PB F4K410 Putative elongation factor TypA-like SVR3, chloroplastic 2.30e-07 6.06e-04 1.67e-22 NA
4. PB Q8NWA7 Elongation factor 4 1.23e-14 2.09e-19 5.96e-21 NA
4. PB Q057A1 Elongation factor G 0.00e+00 3.51e-75 0.0 NA
4. PB A7Z6W5 Elongation factor 4 1.85e-14 1.78e-17 4.73e-18 NA
4. PB C4L433 Elongation factor 4 1.89e-15 6.13e-17 4.39e-19 NA
4. PB P0A1H4 Elongation factor G 0.00e+00 9.45e-79 0.0 NA
4. PB B8B2R1 Translation factor GUF1 homolog, mitochondrial 1.51e-11 2.56e-10 1.68e-19 NA
4. PB Q88QN7 Elongation factor Tu-B 2.32e-05 3.25e-02 5.52e-08 NA
4. PB A1RXH6 Probable translation initiation factor IF-2 1.11e-03 5.83e-08 4.18e-08 NA
4. PB A8GYW2 Elongation factor Tu 1.81e-05 3.17e-02 6.48e-10 NA
4. PB A8G1F0 Elongation factor Tu 1.75e-05 3.93e-02 2.82e-09 NA
4. PB A9KF98 Elongation factor 4 0.00e+00 3.46e-17 2.16e-19 NA
4. PB A9VHU6 Elongation factor 4 2.78e-15 5.36e-17 1.28e-18 NA
4. PB O26359 Probable translation initiation factor IF-2 1.37e-03 2.70e-09 1.20e-04 NA
4. PB B9JVN4 Elongation factor G 0.00e+00 7.09e-76 0.0 NA
4. PB Q5M4M2 Elongation factor 4 2.89e-15 2.24e-16 6.35e-19 NA
4. PB Q980Q8 Probable translation initiation factor IF-2 1.16e-03 4.56e-09 0.011 NA
4. PB Q9PKX6 Elongation factor 4 3.26e-11 1.46e-18 3.34e-18 NA
4. PB Q1D7V1 Elongation factor Tu 1 1.61e-05 4.88e-02 2.30e-11 NA
4. PB Q68X95 Elongation factor 4 0.00e+00 5.34e-18 1.46e-18 NA
4. PB P06805 Elongation factor 1-alpha 4.02e-05 1.81e-04 1.22e-06 NA
4. PB A8HTW6 Elongation factor Tu 1.58e-05 3.65e-02 3.67e-11 NA
4. PB Q31HP5 Elongation factor 4 0.00e+00 1.46e-18 2.04e-18 NA
4. PB A8AQM8 Elongation factor G 0.00e+00 1.82e-78 0.0 NA
4. PB Q2JUX5 Elongation factor G 0.00e+00 3.94e-75 0.0 NA
4. PB A8YVQ1 Elongation factor 4 0.00e+00 1.37e-16 4.99e-17 NA
4. PB A0KZN4 Elongation factor 4 0.00e+00 1.70e-18 1.04e-18 NA
4. PB A9S3D3 Translation factor GUF1 homolog, mitochondrial 1.04e-12 2.25e-08 1.70e-19 NA
4. PB Q9PD78 Bifunctional enzyme CysN/CysC 9.36e-04 1.01e-02 2.86e-04 NA
4. PB Q8K948 Elongation factor G 0.00e+00 3.19e-78 0.0 NA
4. PB C7ZA26 Translation factor GUF1, mitochondrial 6.66e-14 1.56e-15 2.73e-16 NA
4. PB B4RQX2 Elongation factor G 0.00e+00 2.18e-73 0.0 NA
4. PB Q8PU78 Probable translation initiation factor IF-2 3.81e-04 2.17e-08 9.37e-06 NA
4. PB Q5R8Z3 Elongation factor 2 3.02e-13 4.15e-27 2.41e-22 NA
4. PB Q3AWX3 Elongation factor 4 1.11e-16 1.33e-18 1.34e-18 NA
4. PB Q9YAV0 Elongation factor 1-alpha 2.66e-05 1.34e-03 3.27e-06 NA
4. PB A5DWY7 Translation factor GUF1, mitochondrial 6.16e-13 2.10e-10 1.40e-15 NA
4. PB P50256 Elongation factor 1-alpha C 3.74e-05 8.83e-03 2.00e-06 NA
4. PB Q9JV65 Elongation factor 4 0.00e+00 1.48e-18 9.16e-20 NA
4. PB Q5LUS0 Elongation factor 4 0.00e+00 6.32e-17 3.04e-17 NA
4. PB Q5F5Q8 Elongation factor Tu 1.59e-05 4.24e-02 1.95e-08 NA
4. PB Q15029 116 kDa U5 small nuclear ribonucleoprotein component 7.73e-13 1.16e-14 3.25e-25 NA
4. PB P17507 Elongation factor 1-alpha, oocyte form 4.34e-05 5.83e-05 7.47e-07 NA
4. PB Q9KPB0 Elongation factor 4 7.99e-15 2.84e-18 4.77e-17 NA
4. PB D3E3N9 Elongation factor 2 0.00e+00 1.95e-39 5.80e-53 NA
4. PB A8FSD4 Elongation factor 4 8.90e-14 3.99e-18 3.24e-19 NA
4. PB P60787 Elongation factor 4 0.00e+00 7.95e-18 2.09e-19 NA
4. PB Q7S0P6 Translation factor guf1, mitochondrial 2.93e-12 1.42e-03 1.82e-17 NA
4. PB A0B7D5 Elongation factor 2 2.22e-16 7.55e-44 6.22e-67 NA
4. PB Q1MMQ8 Elongation factor 4 0.00e+00 4.67e-20 3.53e-17 NA
4. PB Q01520 Elongation factor 1-alpha 4.24e-05 1.94e-05 4.51e-06 NA
4. PB P62631 Elongation factor 1-alpha 2 3.25e-05 6.13e-05 4.41e-07 NA
4. PB C1CXH0 Elongation factor G 0.00e+00 3.32e-76 0.0 NA
4. PB Q96WZ1 Elongation factor 1-alpha 3.77e-05 1.12e-03 1.54e-04 NA
4. PB Q46497 Selenocysteine-specific elongation factor 4.35e-05 1.85e-03 0.005 NA
4. PB Q7VDF7 Elongation factor 4 0.00e+00 1.16e-18 1.02e-18 NA
4. PB Q4DZ91 Translation factor GUF1 homolog 2, mitochondrial 3.72e-09 3.90e-12 2.98e-17 NA
4. PB B0UFE0 Elongation factor 4 0.00e+00 7.13e-19 9.95e-17 NA
4. PB A5CWJ4 Elongation factor 4 5.28e-14 3.36e-17 2.19e-19 NA
4. PB Q2SU24 Elongation factor G 2 0.00e+00 3.18e-77 0.0 NA
4. PB B7I580 Elongation factor 4 0.00e+00 1.09e-18 6.54e-19 NA
4. PB Q9RV84 Elongation factor 4 0.00e+00 1.65e-17 6.57e-18 NA
4. PB Q39KI2 Elongation factor Tu 1.54e-05 3.90e-02 1.82e-11 NA
4. PB P0A6M8 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A5ULM5 Elongation factor 1-alpha 8.19e-06 4.17e-02 7.99e-09 NA
4. PB B8DUL6 Elongation factor 4 4.46e-14 1.93e-18 6.51e-19 NA
4. PB A4WVL1 Elongation factor G 0.00e+00 7.97e-74 0.0 NA
4. PB P64027 Elongation factor Tu 1.26e-05 2.87e-02 1.72e-08 NA
4. PB A5B4D2 Translation factor GUF1 homolog, chloroplastic NA 5.99e-09 5.69e-19 NA
4. PB Q4ZMP1 Elongation factor G 0.00e+00 3.76e-73 0.0 NA
4. PB Q5KWZ3 Elongation factor 4 6.77e-15 1.60e-17 8.94e-20 NA
4. PB Q40034 Elongation factor 1-alpha 3.72e-05 5.28e-05 3.83e-06 NA
4. PB Q1GIV5 Elongation factor 4 0.00e+00 4.09e-17 5.86e-18 NA
4. PB Q1Q8P1 Elongation factor G 0.00e+00 4.78e-70 0.0 NA
4. PB P61877 Elongation factor 2 0.00e+00 9.81e-40 3.67e-73 NA
4. PB Q2FU48 Probable translation initiation factor IF-2 6.89e-04 2.73e-10 3.66e-04 NA
4. PB Q88QN8 Elongation factor G 1 0.00e+00 1.04e-75 0.0 NA
4. PB Q464Z3 Elongation factor 2 1.22e-15 5.03e-44 1.89e-71 NA
4. PB A3CXM8 Elongation factor 2 0.00e+00 2.08e-42 1.78e-60 NA
4. PB Q0HNU0 Elongation factor G 1 0.00e+00 1.20e-75 0.0 NA
4. PB A9MN39 Elongation factor G 0.00e+00 6.05e-79 0.0 NA
4. PB Q4JWS1 Elongation factor 4 2.40e-14 1.04e-19 1.19e-15 NA
4. PB Q8TV06 Probable translation initiation factor IF-2 1.15e-03 2.17e-08 4.70e-07 NA
4. PB Q4FQG5 Elongation factor G 0.00e+00 1.40e-68 0.0 NA
4. PB A5GRE6 Elongation factor 4 0.00e+00 1.53e-18 1.54e-19 NA
4. PB Q8ZX20 Probable translation initiation factor IF-2 4.07e-04 7.29e-07 2.11e-06 NA
4. PB Q4KHT3 Elongation factor 4 0.00e+00 1.05e-17 7.46e-19 NA
4. PB Q8TRC4 Elongation factor 1-alpha 1.20e-05 3.63e-03 3.13e-09 NA
4. PB Q1WUE6 Elongation factor 4 1.79e-14 3.12e-17 1.72e-18 NA
4. PB B0C9R9 Elongation factor 4 0.00e+00 1.03e-17 6.28e-19 NA
4. PB Q1GP96 Elongation factor G 0.00e+00 1.04e-75 0.0 NA
4. PB Q754C8 Elongation factor 2 1.87e-14 4.03e-31 5.31e-25 NA
4. PB Q8N442 Translation factor GUF1, mitochondrial 3.24e-14 8.74e-09 2.98e-20 NA
4. PB Q6LMS0 Elongation factor 4 0.00e+00 2.36e-18 1.17e-17 NA
4. PB Q0BNS9 Elongation factor G 0.00e+00 7.51e-76 0.0 NA
4. PB B6Q1T9 Ribosome-releasing factor 2, mitochondrial 0.00e+00 1.21e-32 2.76e-111 NA
4. PB Q32CV2 Elongation factor 4 0.00e+00 9.26e-18 2.03e-19 NA
4. PB Q8XRM7 Elongation factor G 2 0.00e+00 6.32e-82 0.0 NA
4. PB A6L744 Elongation factor 4 1.70e-14 7.25e-18 4.09e-18 NA
4. PB Q5BB57 Ribosome-releasing factor 2, mitochondrial 0.00e+00 4.61e-34 1.15e-122 NA
4. PB Q1GK42 Elongation factor G 0.00e+00 9.94e-73 0.0 NA
4. PB Q8FV17 Elongation factor 4 0.00e+00 5.85e-18 4.20e-18 NA
4. PB Q3SVT1 Elongation factor 4 1.61e-14 7.13e-19 1.35e-17 NA
4. PB Q2YM00 Elongation factor G 0.00e+00 9.81e-81 0.0 NA
4. PB A1K601 Elongation factor 4 0.00e+00 1.19e-18 4.27e-20 NA
4. PB Q59P53 Translation factor GUF1, mitochondrial 4.23e-13 2.46e-12 1.00e-16 NA
4. PB B7NLP5 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB A1AVJ7 Elongation factor G 0.00e+00 8.69e-76 0.0 NA
4. PB P32324 Elongation factor 2 3.13e-14 5.08e-30 1.84e-24 NA
4. PB Q39US7 Elongation factor 4 0.00e+00 1.55e-17 1.13e-18 NA
4. PB Q754I9 Ribosome-releasing factor 2, mitochondrial 0.00e+00 2.00e-36 3.90e-120 NA
4. PB Q2HJN6 Elongation factor 1-alpha 3 5.73e-05 5.42e-04 1.89e-06 NA
4. PB A1V6B9 Elongation factor 4 0.00e+00 1.81e-17 6.17e-19 NA
4. PB Q21M89 Elongation factor G 1 0.00e+00 1.07e-80 0.0 NA
4. PB Q82T70 Elongation factor G 0.00e+00 1.39e-77 0.0 NA
4. PB A6WHR4 Elongation factor Tu 1.70e-05 4.00e-02 2.19e-10 NA
4. PB Q7VTD5 Elongation factor G 0.00e+00 1.23e-76 0.0 NA
4. PB C1D7L2 Elongation factor 4 3.45e-14 8.07e-18 1.95e-19 NA
4. PB Q8D307 Elongation factor 4 0.00e+00 2.52e-16 1.35e-20 NA
4. PB A8LM45 Elongation factor G 0.00e+00 6.48e-71 0.0 NA
4. PB Q8PUR8 Elongation factor 1-alpha 1.04e-05 3.18e-03 4.60e-06 NA
4. PB P29520 Elongation factor 1-alpha 4.19e-05 7.69e-05 4.77e-06 NA
4. PB A7FFT7 Elongation factor 4 1.17e-14 6.13e-18 5.12e-19 NA
4. PB Q9K055 Elongation factor 4 4.34e-14 2.09e-18 9.65e-20 NA
4. PB Q47EG0 Elongation factor 4 0.00e+00 1.84e-18 9.21e-20 NA
4. PB A6VGV6 Elongation factor 1-alpha 1.28e-05 8.53e-03 2.92e-12 NA
4. PB P30925 Elongation factor 2 2.22e-16 2.32e-39 9.97e-70 NA
4. PB P40173 Elongation factor G 1 0.00e+00 6.62e-79 0.0 NA
4. PB B8D7F7 Elongation factor 4 0.00e+00 1.87e-16 1.73e-19 NA
4. PB B2FQC4 Elongation factor 4 0.00e+00 4.37e-18 4.09e-17 NA
4. PB A6UV44 Elongation factor 2 0.00e+00 9.82e-41 7.16e-79 NA
4. PB Q2NZY2 Elongation factor G 0.00e+00 2.34e-79 0.0 NA
4. PB B7VK81 Elongation factor 4 0.00e+00 6.91e-19 1.77e-18 NA
4. PB Q089Q6 Elongation factor Tu 2 1.77e-05 4.49e-02 1.33e-09 NA
4. PB P9WK97 Elongation factor 4 5.03e-14 1.14e-14 1.53e-18 NA
4. PB Q06193 Elongation factor 2 8.60e-13 7.84e-29 1.08e-22 NA
4. PB Q182F4 Elongation factor 4 0.00e+00 5.09e-16 4.49e-18 NA
4. PB A0RUM4 Elongation factor 1-alpha 3.85e-05 4.28e-04 8.22e-05 NA
4. PB B1L7Q0 Elongation factor 2 1.03e-12 3.36e-41 9.65e-69 NA
4. PB Q2GD00 Elongation factor 4 1.14e-14 3.46e-17 3.31e-16 NA
4. PB Q0TCB9 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB Q12WT3 Elongation factor 1-alpha 6.89e-06 9.22e-03 1.73e-05 NA
4. PB A3QBS5 Elongation factor 4 0.00e+00 3.37e-18 9.97e-20 NA
4. PB Q0RP81 Elongation factor 4 4.37e-14 1.67e-19 1.46e-16 NA
4. PB Q31IY5 Elongation factor G 0.00e+00 3.58e-77 0.0 NA
4. PB Q3YWT2 Elongation factor G 0.00e+00 7.02e-79 0.0 NA
4. PB P17786 Elongation factor 1-alpha 3.15e-05 7.69e-05 4.90e-06 NA
4. PB B1XSP8 Elongation factor G 0.00e+00 8.45e-78 0.0 NA
4. PB B8ZQ69 Elongation factor 4 2.11e-15 2.55e-16 2.13e-18 NA
4. PB C1CKU6 Elongation factor 4 2.33e-15 1.71e-16 1.80e-18 NA
4. PB B7JKB6 Elongation factor G NA 4.22e-92 0.0 NA
4. PB C6DZ67 Elongation factor 4 0.00e+00 1.98e-17 1.57e-18 NA
4. PB O23755 Elongation factor 2 4.29e-13 7.47e-31 2.44e-20 NA
4. PB A1WHC2 Elongation factor G 0.00e+00 4.27e-77 0.0 NA
4. PB B9MDP9 Elongation factor 4 0.00e+00 2.38e-17 6.66e-20 NA
4. PB P28295 Elongation factor 1-alpha 1.29e-05 1.57e-04 2.46e-05 NA
4. PB Q0AIJ8 Elongation factor G 0.00e+00 2.92e-78 0.0 NA
4. PB Q1CKE6 Elongation factor 4 1.19e-14 6.13e-18 5.12e-19 NA
4. PB A1VRT5 Elongation factor 4 0.00e+00 2.55e-18 1.17e-19 NA
4. PB B5EB36 Elongation factor 4 0.00e+00 5.60e-17 2.66e-18 NA
4. PB Q07YZ4 Elongation factor 4 0.00e+00 2.43e-18 4.03e-17 NA
4. PB B3EH94 Elongation factor G 0.00e+00 1.23e-73 0.0 NA
4. PB C3MVH1 Elongation factor 2 1.48e-13 2.22e-39 4.70e-70 NA
4. PB Q71V39 Elongation factor 1-alpha 2 2.70e-05 5.95e-05 4.26e-07 NA
4. PB Q134S7 Elongation factor Tu 1 1.39e-05 4.13e-02 8.24e-12 NA
4. PB Q57CQ5 Elongation factor G 0.00e+00 9.81e-81 0.0 NA
4. PB Q21XN4 Elongation factor 4 0.00e+00 2.75e-18 8.11e-20 NA
4. PB P19486 Elongation factor 1-alpha 1.27e-05 1.06e-03 1.04e-09 NA
4. PB B5ELX6 Elongation factor G 0.00e+00 2.06e-82 0.0 NA
4. PB Q39KH0 Elongation factor G 1 0.00e+00 3.68e-77 0.0 NA
4. PB A4WX88 Elongation factor 4 1.38e-14 5.10e-18 4.51e-18 NA
4. PB A8FFD6 Elongation factor 4 1.82e-14 1.15e-17 5.69e-17 NA
4. PB Q1Q8P2 Elongation factor Tu 1.70e-05 1.71e-02 1.30e-05 NA
4. PB Q6G8Y3 Elongation factor 4 6.00e-15 2.57e-19 5.32e-21 NA
4. PB C1DAR4 Elongation factor G 0.00e+00 4.92e-79 0.0 NA
4. PB B9KD01 Elongation factor 4 0.00e+00 6.65e-20 3.13e-19 NA
4. PB A5WGL0 Elongation factor G 0.00e+00 2.15e-71 0.0 NA
4. PB Q0BH06 Elongation factor 4 0.00e+00 1.89e-17 5.31e-19 NA
4. PB A5ID24 Elongation factor 4 0.00e+00 1.48e-18 2.28e-18 NA
4. PB Q8TRC3 Elongation factor 2 1.89e-15 3.83e-44 9.07e-69 NA
4. PB B0TW33 Elongation factor 4 0.00e+00 4.54e-17 2.13e-17 NA
4. PB O93640 Elongation factor 2 0.00e+00 4.80e-44 1.79e-47 NA
4. PB P64026 Elongation factor Tu 1.28e-05 2.87e-02 1.72e-08 NA
4. PB Q875Z2 Elongation factor 2 3.00e-14 7.61e-31 7.14e-24 NA
5. P P57772 Selenocysteine-specific elongation factor 1.43e-04 8.99e-03 NA NA
5. P Q18FT0 Probable translation initiation factor IF-2 2.07e-03 1.95e-07 NA NA
5. P P43927 Selenocysteine-specific elongation factor 4.33e-05 8.55e-04 NA NA
5. P P27634 Elongation factor 1-alpha (Fragment) NA 5.23e-05 NA NA
5. P P14081 Selenocysteine-specific elongation factor 1.73e-04 7.10e-04 NA NA
5. P P28604 Bifunctional enzyme NodQ 2.09e-04 4.45e-02 NA NA
5. P Q7NVN5 Sulfate adenylyltransferase subunit 1 7.61e-04 3.81e-02 NA NA
5. P Q08046 Elongation factor 1-alpha (Fragment) 2.35e-04 3.71e-02 NA NA
5. P Q46455 Selenocysteine-specific elongation factor 3.05e-06 4.95e-03 NA NA
5. P Q3IMS5 Probable translation initiation factor IF-2 9.45e-04 2.15e-07 NA NA
5. P A8MBV9 Probable translation initiation factor IF-2 8.03e-04 2.20e-09 NA NA
7. B Q47RV1 Translation initiation factor IF-2 7.30e-05 NA 7.21e-07 NA
7. B Q8DI42 Elongation factor Tu 1.19e-05 NA 6.16e-09 NA
7. B Q889X3 Elongation factor Tu 1.93e-05 NA 8.53e-09 NA
7. B C4Z5N7 Translation initiation factor IF-2 6.78e-04 NA 2.88e-05 NA
7. B Q4FNM9 Translation initiation factor IF-2 1.92e-05 NA 0.015 NA
7. B Q92C29 Translation initiation factor IF-2 2.87e-05 NA 1.97e-05 NA
7. B P0DA83 Elongation factor Tu 1.80e-05 NA 4.33e-07 NA
7. B B5Z3B3 Sulfate adenylyltransferase subunit 1 2.57e-04 NA 4.07e-04 NA
7. B Q3ZJ24 Elongation factor Tu, chloroplastic 8.80e-06 NA 1.02e-10 NA
7. B A7GRE3 Translation initiation factor IF-2 2.35e-05 NA 2.90e-07 NA
7. B A9KZX1 Translation initiation factor IF-2 1.07e-04 NA 5.53e-07 NA
7. B Q91YJ5 Translation initiation factor IF-2, mitochondrial 4.70e-04 NA 1.21e-06 NA
7. B Q5FJN6 Translation initiation factor IF-2 5.99e-04 NA 1.83e-08 NA
7. B Q7VA05 Elongation factor Tu 8.47e-06 NA 4.66e-08 NA
7. B A4SHU2 Elongation factor Tu 1.62e-05 NA 1.39e-08 NA
7. B A2CI56 Elongation factor Tu, chloroplastic 1.16e-05 NA 4.96e-10 NA
7. B Q0HLG1 Translation initiation factor IF-2 1.94e-04 NA 7.11e-07 NA
7. B Q664R7 Elongation factor Tu 2 1.94e-05 NA 4.05e-09 NA
7. B B8D9U9 Elongation factor Tu 1.86e-05 NA 1.84e-09 NA
7. B C1D890 Sulfate adenylyltransferase subunit 1 4.27e-04 NA 0.014 NA
7. B Q1XDN0 Translation initiation factor IF-2, chloroplastic 6.75e-04 NA 7.44e-06 NA
7. B A1WHC3 Elongation factor Tu 1.11e-05 NA 4.44e-11 NA
7. B A0PQC4 Translation initiation factor IF-2 1.49e-04 NA 1.38e-07 NA
7. B B1KRR0 Translation initiation factor IF-2 1.23e-04 NA 2.03e-07 NA
7. B Q6MDN0 Elongation factor Tu 1.17e-05 NA 6.54e-10 NA
7. B Q67P86 Translation initiation factor IF-2 2.04e-03 NA 8.44e-05 NA
7. B A8MFA8 Translation initiation factor IF-2 1.89e-05 NA 3.66e-07 NA
7. B Q8ETY4 Elongation factor Tu 1.70e-05 NA 8.19e-12 NA
7. B Q03QT5 Translation initiation factor IF-2 5.31e-05 NA 5.16e-07 NA
7. B C5BSJ5 Sulfate adenylyltransferase subunit 1 5.08e-04 NA 7.32e-05 NA
7. B Q1IIT3 Translation initiation factor IF-2 1.33e-03 NA 1.80e-05 NA
7. B B4E7L1 Translation initiation factor IF-2 7.73e-04 NA 2.49e-04 NA
7. B Q9PKU0 Translation initiation factor IF-2 9.81e-04 NA 0.003 NA
7. B A9MP36 Translation initiation factor IF-2 1.82e-04 NA 0.027 NA
7. B A6WRG8 Translation initiation factor IF-2 1.10e-04 NA 5.53e-07 NA
7. B A7I3V0 Translation initiation factor IF-2 8.49e-05 NA 5.66e-08 NA
7. B A9M1D5 Translation initiation factor IF-2 7.73e-04 NA 3.56e-04 NA
7. B A1TJ05 Elongation factor Tu 1.13e-05 NA 2.03e-10 NA
7. B P50371 Elongation factor Tu, chloroplastic 1.07e-05 NA 1.60e-08 NA
7. B Q88DV7 Translation initiation factor IF-2 8.32e-04 NA 1.72e-06 NA
7. B A0T0K6 Elongation factor Tu, chloroplastic 1.12e-05 NA 6.19e-07 NA
7. B Q822I4 Elongation factor Tu 1.50e-05 NA 2.53e-09 NA
7. B Q0K5Z9 Elongation factor Tu 1.18e-05 NA 8.64e-11 NA
7. B Q8PC59 Elongation factor Tu-A 1.43e-05 NA 1.68e-08 NA
7. B Q1C1T4 Elongation factor Tu 2 1.64e-05 NA 4.34e-09 NA
7. B Q7U8L9 Translation initiation factor IF-2 1.65e-05 NA 1.18e-07 NA
7. B A8GPF2 Elongation factor Tu 1.73e-05 NA 6.59e-11 NA
7. B Q3A4A7 Translation initiation factor IF-2 9.71e-05 NA 9.67e-06 NA
7. B Q6AJY4 Translation initiation factor IF-2 8.93e-04 NA 1.74e-05 NA
7. B Q5JDL3 Translation initiation factor 2 subunit gamma 3.63e-05 NA 0.007 NA
7. B A4TCF8 Translation initiation factor IF-2 7.71e-04 NA 4.36e-08 NA
7. B Q89AF5 Translation initiation factor IF-2 9.24e-04 NA 6.72e-06 NA
7. B P50372 Elongation factor Tu, chloroplastic 1.12e-05 NA 1.43e-08 NA
7. B Q1WU83 Elongation factor Tu 1.46e-05 NA 3.63e-08 NA
7. B A9N2D8 Sulfate adenylyltransferase subunit 1 1.39e-04 NA 1.19e-04 NA
7. B B7IF03 Translation initiation factor IF-2 6.41e-05 NA 2.03e-08 NA
7. B A2C4U5 Elongation factor Tu 8.70e-06 NA 2.04e-08 NA
7. B A3CQ18 Translation initiation factor IF-2 9.64e-04 NA 2.96e-06 NA
7. B Q8EQU1 Translation initiation factor IF-2 1.57e-05 NA 1.30e-08 NA
7. B Q4QK37 Translation initiation factor IF-2 1.48e-03 NA 0.001 NA
7. B A5CXX6 Translation initiation factor IF-2 9.60e-06 NA 2.88e-05 NA
7. B B3DQF0 Translation initiation factor IF-2 1.82e-04 NA 1.31e-05 NA
7. B B8D7V3 Sulfate adenylyltransferase subunit 1 5.42e-04 NA 0.002 NA
7. B P04766 Translation initiation factor IF-2 3.15e-04 NA 1.16e-07 NA
7. B C1CSB0 Elongation factor Tu 1.84e-05 NA 2.82e-07 NA
7. B B5BEY8 Sulfate adenylyltransferase subunit 1 1.44e-04 NA 1.07e-04 NA
7. B Q65ZX2 Translation initiation factor IF-2 8.50e-04 NA 2.03e-06 NA
7. B Q1GAQ0 Elongation factor Tu 1.19e-05 NA 8.45e-10 NA
7. B A8EWD7 Translation initiation factor IF-2 4.15e-05 NA 2.85e-06 NA
7. B B2V5W6 GTPase Der 1.62e-02 NA 0.005 NA
7. B Q492B2 Elongation factor Tu 1.46e-05 NA 1.53e-09 NA
7. B O58822 Probable translation initiation factor IF-2 7.64e-03 NA 0.010 NA
7. B A5F926 Translation initiation factor IF-2 1.64e-04 NA 9.63e-07 NA
7. B A5CEN6 Translation initiation factor IF-2 8.06e-05 NA 5.36e-05 NA
7. B B0TWR3 Translation initiation factor IF-2 3.39e-04 NA 1.73e-05 NA
7. B Q0SN31 Elongation factor Tu 1.18e-05 NA 6.55e-11 NA
7. B C1C5S8 Translation initiation factor IF-2 1.06e-03 NA 7.53e-07 NA
7. B P0CE48 Elongation factor Tu 2 1.90e-05 NA 4.42e-09 NA
7. B Q5FGX3 Translation initiation factor IF-2 2.29e-05 NA 5.49e-04 NA
7. B A5WBS5 Translation initiation factor IF-2 3.59e-03 NA 3.31e-07 NA
7. B P48862 Elongation factor G (Fragment) 0.00e+00 NA 2.54e-61 NA
7. B A1WVD6 Elongation factor Tu 2 1.11e-05 NA 1.24e-09 NA
7. B Q6LVC0 Elongation factor Tu 1 1.66e-05 NA 2.77e-09 NA
7. B A4VPP0 Translation initiation factor IF-2 9.58e-05 NA 6.79e-06 NA
7. B A4VHL6 Elongation factor Tu 1 1.90e-05 NA 1.80e-08 NA
7. B Q2LQA3 Elongation factor Tu 1.45e-05 NA 4.47e-08 NA
7. B Q1CUA6 Translation initiation factor IF-2 8.30e-04 NA 9.66e-06 NA
7. B C5D9C9 Translation initiation factor IF-2 1.68e-05 NA 3.34e-08 NA
7. B A4IJI7 Elongation factor Tu 1.17e-05 NA 1.12e-11 NA
7. B Q6CZW6 Elongation factor Tu 1.91e-05 NA 4.12e-09 NA
7. B Q49V58 Elongation factor Tu 2.27e-05 NA 1.52e-09 NA
7. B Q2LWU6 Translation initiation factor IF-2 8.17e-04 NA 7.32e-05 NA
7. B Q2SML3 Translation initiation factor IF-2 1.54e-03 NA 4.25e-07 NA
7. B Q2RFP5 Elongation factor Tu 1.40e-05 NA 6.06e-12 NA
7. B O31297 Elongation factor Tu 1.79e-05 NA 1.84e-09 NA
7. B A8AWA0 Elongation factor Tu 1.93e-05 NA 2.51e-07 NA
7. B Q2YAZ9 Elongation factor Tu 1.50e-05 NA 1.65e-10 NA
7. B Q8K9H1 Translation initiation factor IF-2 9.76e-04 NA 1.58e-06 NA
7. B Q3YV04 Elongation factor Tu 2 1.83e-05 NA 4.42e-09 NA
7. B Q8DD27 Elongation factor Tu 1 1.52e-05 NA 2.36e-09 NA
7. B A4XI37 Elongation factor Tu 1.13e-05 NA 1.35e-10 NA
7. B A3PEZ7 Elongation factor Tu 8.49e-06 NA 3.25e-08 NA
7. B B2FN90 Translation initiation factor IF-2 3.70e-03 NA 3.23e-07 NA
7. B P0A3A9 Elongation factor Tu 1.14e-05 NA 2.42e-12 NA
7. B B1ZDQ8 Translation initiation factor IF-2 1.57e-03 NA 8.12e-05 NA
7. B Q03LX0 Elongation factor Tu 2.03e-05 NA 9.56e-08 NA
7. B P42474 Elongation factor Tu 1.47e-05 NA 1.17e-09 NA
7. B P0DB84 Translation initiation factor IF-2 9.76e-04 NA 8.74e-06 NA
7. B A8F982 Elongation factor Tu 1.31e-05 NA 2.82e-11 NA
7. B B3PI96 Translation initiation factor IF-2 1.57e-03 NA 2.39e-06 NA
7. B Q8CJQ8 Translation initiation factor IF-2 5.40e-05 NA 2.36e-08 NA
7. B Q1RHL9 Elongation factor Tu 1.54e-05 NA 3.33e-12 NA
7. B Q2K9N2 Elongation factor Tu 1 1.33e-05 NA 2.20e-10 NA
7. B Q48UK5 Elongation factor Tu 1.82e-05 NA 4.33e-07 NA
7. B A7GZK6 Elongation factor Tu 1.18e-05 NA 5.05e-08 NA
7. B P65134 Translation initiation factor IF-2 1.67e-05 NA 2.62e-06 NA
7. B Q2YSB3 Elongation factor Tu 1.06e-05 NA 6.03e-09 NA
7. B Q482T9 Translation initiation factor IF-2 2.06e-03 NA 1.94e-06 NA
7. B A6YG72 Elongation factor Tu, chloroplastic 1.20e-05 NA 2.58e-08 NA
7. B Q318P8 Translation initiation factor IF-2 4.13e-04 NA 1.23e-08 NA
7. B Q9SHI1 Translation initiation factor IF-2, chloroplastic 1.97e-03 NA 1.36e-07 NA
7. B C3K2X8 Elongation factor Tu 2.36e-05 NA 2.26e-07 NA
7. B Q1G9P9 Translation initiation factor IF-2 4.33e-04 NA 3.17e-08 NA
7. B Q5WT36 Translation initiation factor IF-2 5.65e-05 NA 1.01e-06 NA
7. B A0L5V8 Elongation factor Tu 1.30e-05 NA 5.28e-10 NA
7. B Q877T5 Elongation factor Tu 1.50e-05 NA 5.52e-10 NA
7. B P57997 Translation initiation factor IF-2, chloroplastic NA NA 1.60e-04 NA
7. B Q9Z8M1 Translation initiation factor IF-2 7.18e-04 NA 0.001 NA
7. B Q63H92 Elongation factor Tu 1.22e-05 NA 7.87e-11 NA
7. B A5GVG4 Translation initiation factor IF-2 3.06e-04 NA 6.83e-07 NA
7. B P64030 Elongation factor Tu 1.84e-05 NA 2.82e-07 NA
7. B Q5F797 Translation initiation factor IF-2 1.25e-03 NA 0.001 NA
7. B Q5HGG2 Translation initiation factor IF-2 2.04e-05 NA 2.51e-06 NA
7. B Q4UWA2 Translation initiation factor IF-2 2.87e-03 NA 1.60e-07 NA
7. B Q7VQM3 Translation initiation factor IF-2 1.67e-03 NA 7.99e-05 NA
7. B Q0ANN1 Elongation factor Tu 1.04e-05 NA 3.96e-12 NA
7. B Q7TTF9 Elongation factor Tu 1.88e-05 NA 6.03e-09 NA
7. B P99152 Elongation factor Tu 1.06e-05 NA 6.03e-09 NA
7. B B7J241 Elongation factor Tu 1.19e-05 NA 6.50e-11 NA
7. B Q7VYR2 Translation initiation factor IF-2 2.05e-03 NA 2.55e-04 NA
7. B Q3ILP4 Elongation factor Tu 1 1.61e-05 NA 8.53e-10 NA
7. B Q3A6R2 Elongation factor Tu 1 1.53e-05 NA 5.12e-10 NA
7. B A5UZQ2 Translation initiation factor IF-2 2.81e-04 NA 3.83e-06 NA
7. B O50274 Bifunctional enzyme CysN/CysC 8.13e-04 NA 5.99e-05 NA
7. B B9M1G0 Translation initiation factor IF-2 5.50e-05 NA 6.13e-06 NA
7. B B1VYN5 Translation initiation factor IF-2 2.24e-04 NA 6.96e-07 NA
7. B Q5FFE6 Elongation factor Tu 1.86e-05 NA 1.66e-05 NA
7. B Q6AXM7 HBS1-like protein 3.44e-04 NA 6.86e-04 NA
7. B B7IHU4 Elongation factor Tu 1.31e-05 NA 9.31e-10 NA
7. B A6LHS1 Translation initiation factor IF-2 1.38e-03 NA 2.52e-04 NA
7. B P0A6N2 Elongation factor Tu 1.88e-05 NA 4.42e-09 NA
7. B C0PZ54 Translation initiation factor IF-2 1.77e-04 NA 0.027 NA
7. B Q06J54 Elongation factor Tu, chloroplastic 7.52e-06 NA 1.14e-10 NA
7. B A5E866 Translation initiation factor IF-2 6.05e-04 NA 8.76e-07 NA
7. B Q6FZC0 Elongation factor Tu 1 1.32e-05 NA 1.08e-10 NA
7. B Q7NY13 Translation initiation factor IF-2 1.48e-03 NA 3.76e-06 NA
7. B A5N842 Translation initiation factor IF-2 1.24e-05 NA 6.81e-07 NA
7. B A7NEC7 Elongation factor Tu 1.51e-05 NA 1.56e-09 NA
7. B Q9RTG5 Translation initiation factor IF-2 5.18e-06 NA 0.011 NA
7. B Q74CT3 Translation initiation factor IF-2 8.04e-05 NA 3.54e-05 NA
7. B A5F578 Sulfate adenylyltransferase subunit 1 1.76e-04 NA 7.99e-04 NA
7. B A7X1Q1 Translation initiation factor IF-2 2.38e-05 NA 2.62e-06 NA
7. B A0LXQ1 Translation initiation factor IF-2 7.83e-04 NA 0.005 NA
7. B Q2NC10 Translation initiation factor IF-2 6.12e-04 NA 0.001 NA
7. B B7UJ63 Translation initiation factor IF-2 1.47e-04 NA 0.019 NA
7. B B1IQV3 Translation initiation factor IF-2 1.67e-04 NA 0.019 NA
7. B P84316 Elongation factor 1-alpha (Fragment) 1.07e-04 NA 1.01e-04 NA
7. B P18906 Elongation factor Tu 1.11e-05 NA 2.64e-10 NA
7. B Q3KMS4 Translation initiation factor IF-2 7.67e-04 NA 4.84e-04 NA
7. B Q4QMW6 Elongation factor Tu 1 1.79e-05 NA 1.28e-08 NA
7. B Q9ZF28 Translation initiation factor IF-2 1.93e-04 NA 1.91e-06 NA
7. B A1S462 Translation initiation factor IF-2 1.08e-04 NA 8.28e-07 NA
7. B Q3ZXX3 Elongation factor Tu 1.14e-05 NA 4.64e-06 NA
7. B B7K834 Elongation factor Tu 1.34e-05 NA 4.84e-08 NA
7. B Q2Y7W2 Translation initiation factor IF-2 3.98e-03 NA 7.17e-05 NA
7. B A5IYA9 Elongation factor Tu 7.43e-06 NA 2.65e-08 NA
7. B Q038M5 Translation initiation factor IF-2 9.09e-04 NA 1.64e-07 NA
7. B B4UHG0 Translation initiation factor IF-2 3.12e-04 NA 1.60e-04 NA
7. B Q5M5V5 Translation initiation factor IF-2 1.06e-03 NA 5.42e-05 NA
7. B P18668 Elongation factor Tu 1.17e-05 NA 7.28e-10 NA
7. B Q8YEB3 Translation initiation factor IF-2 1.07e-03 NA 7.32e-06 NA
7. B O59683 Translation initiation factor IF-2, mitochondrial 5.96e-05 NA 4.22e-06 NA
7. B O63930 Elongation factor Tu, chloroplastic (Fragment) 2.52e-05 NA 6.81e-06 NA
7. B Q3IYN5 Translation initiation factor IF-2 1.01e-02 NA 1.65e-06 NA
7. B Q1AU14 Elongation factor Tu 1.04e-05 NA 1.94e-09 NA
7. B Q3ZXU3 Translation initiation factor IF-2 1.09e-04 NA 4.02e-05 NA
7. B Q826Z7 Elongation factor Tu 2 4.76e-06 NA 1.32e-06 NA
7. B Q7NH85 Translation initiation factor IF-2 1.10e-04 NA 2.87e-05 NA
7. B Q11HA6 Elongation factor Tu 1.21e-05 NA 2.16e-11 NA
7. B B1IVA7 Elongation factor Tu 2 1.85e-05 NA 4.42e-09 NA
7. B B7I3R9 Translation initiation factor IF-2 1.98e-03 NA 2.34e-06 NA
7. B A5FQR6 Translation initiation factor IF-2 1.05e-04 NA 4.02e-05 NA
7. B Q8PC51 Elongation factor Tu-B 1.45e-05 NA 1.68e-08 NA
7. B Q11PK5 Translation initiation factor IF-2 1.56e-03 NA 0.001 NA
7. B A4J0Z5 Elongation factor Tu 1.47e-05 NA 5.10e-10 NA
7. B B6I1P3 Translation initiation factor IF-2 1.38e-04 NA 0.019 NA
7. B Q1GP97 Elongation factor Tu 1.45e-05 NA 1.68e-09 NA
7. B Q21SF0 Elongation factor Tu 1 1.54e-05 NA 6.83e-12 NA
7. B Q0TPR7 Translation initiation factor IF-2 7.91e-06 NA 1.78e-07 NA
7. B P57458 Translation initiation factor IF-2 1.02e-04 NA 1.21e-06 NA
7. B P56292 Elongation factor Tu, chloroplastic 1.01e-05 NA 2.48e-10 NA
7. B Q4A9G1 Elongation factor Tu 1.05e-05 NA 2.44e-09 NA
7. B B7N6Y1 Sulfate adenylyltransferase subunit 1 1.76e-04 NA 1.53e-04 NA
7. B Q5LES3 Sulfate adenylyltransferase subunit 1 9.38e-04 NA 2.88e-05 NA
7. B Q8ZMF5 Sulfate adenylyltransferase subunit 1 6.03e-04 NA 1.20e-04 NA
7. B P26184 Elongation factor Tu 1.23e-05 NA 5.61e-09 NA
7. B C5CLW3 Translation initiation factor IF-2 2.33e-03 NA 7.91e-05 NA
7. B Q4ZNR2 Translation initiation factor IF-2 8.12e-04 NA 6.47e-07 NA
7. B A8G708 Elongation factor Tu 8.45e-06 NA 3.40e-08 NA
7. B B0JSE0 Elongation factor Tu 1.36e-05 NA 1.90e-08 NA
7. B P0A3K7 Translation initiation factor IF-2 8.74e-04 NA 6.71e-06 NA
7. B Q5L890 Elongation factor Tu 8.97e-06 NA 4.09e-10 NA
7. B Q1R6H0 Translation initiation factor IF-2 1.72e-04 NA 0.019 NA
7. B B0U1Q8 Translation initiation factor IF-2 2.91e-03 NA 2.68e-06 NA
7. B Q0HXR5 Translation initiation factor IF-2 1.94e-03 NA 7.11e-07 NA
7. B A0KNE3 Translation initiation factor IF-2 1.35e-04 NA 1.59e-05 NA
7. B A7HBL7 Elongation factor Tu 1.40e-05 NA 4.20e-10 NA
7. B Q33451 Elongation factor Tu, apicoplast 1.36e-05 NA 4.76e-11 NA
7. B Q5N0A5 Translation initiation factor IF-2 1.98e-04 NA 2.85e-05 NA
7. B A7MQE1 Translation initiation factor IF-2 9.52e-05 NA 0.012 NA
7. B P14634 Elongation factor Tu, plastid 8.94e-06 NA 2.29e-10 NA
7. B Q895J8 Translation initiation factor IF-2 7.78e-06 NA 3.70e-08 NA
7. B P0A705 Translation initiation factor IF-2 1.51e-04 NA 0.019 NA
7. B Q88VK7 Translation initiation factor IF-2 7.42e-05 NA 1.59e-07 NA
7. B Q62GK3 Elongation factor Tu 1.25e-05 NA 2.18e-10 NA
7. B A2RM37 Translation initiation factor IF-2 9.27e-05 NA 6.05e-06 NA
7. B B5FGJ9 Sulfate adenylyltransferase subunit 1 2.66e-04 NA 1.67e-04 NA
7. B B5F6T8 Translation initiation factor IF-2 1.95e-04 NA 0.027 NA
7. B P13552 Elongation factor Tu 1.07e-05 NA 6.57e-09 NA
7. B A4SRG8 Sulfate adenylyltransferase subunit 1 4.35e-04 NA 2.21e-05 NA
7. B Q47JA5 Elongation factor Tu 1.62e-05 NA 2.06e-10 NA
7. B A4WVL0 Elongation factor Tu 1.36e-05 NA 2.95e-10 NA
7. B A7H9F3 Translation initiation factor IF-2 1.14e-03 NA 1.88e-05 NA
7. B O33581 Sulfate adenylyltransferase subunit 1 2.32e-04 NA 0.007 NA
7. B A3MRT8 Elongation factor Tu 1.26e-05 NA 2.18e-10 NA
7. B B4RMZ3 Translation initiation factor IF-2 1.31e-03 NA 8.69e-04 NA
7. B Q7U4D1 Elongation factor Tu 9.75e-06 NA 3.03e-08 NA
7. B Q5NIL7 Translation initiation factor IF-2 2.61e-04 NA 3.02e-06 NA
7. B Q21C31 Translation initiation factor IF-2 6.40e-04 NA 4.83e-07 NA
7. B A0M3Z6 Elongation factor Tu 1.84e-05 NA 8.49e-10 NA
7. B A5U6J1 Translation initiation factor IF-2 6.02e-05 NA 6.28e-07 NA
7. B Q9JTB5 Translation initiation factor IF-2 2.04e-03 NA 3.62e-04 NA
7. B Q0AF46 Elongation factor Tu 2 1.49e-05 NA 4.87e-08 NA
7. B A4XL70 Translation initiation factor IF-2 3.41e-04 NA 3.63e-05 NA
7. B A1V3N4 Translation initiation factor IF-2 2.52e-03 NA 6.95e-04 NA
7. B A5V604 Elongation factor Tu 1.50e-05 NA 1.73e-10 NA
7. B A1AX82 Elongation factor Tu 2 1.43e-05 NA 3.19e-09 NA
7. B A5GW14 Elongation factor Tu 9.70e-06 NA 2.13e-08 NA
7. B B0SUQ7 Elongation factor Tu 1 1.36e-05 NA 6.31e-10 NA
7. B Q8Z3H7 Translation initiation factor IF-2 1.73e-04 NA 0.026 NA
7. B Q1JMR3 Elongation factor Tu 1.85e-05 NA 4.33e-07 NA
7. B B2SVK3 Translation initiation factor IF-2 3.09e-03 NA 5.73e-08 NA
7. B Q9XEK9 Translation initiation factor IF-2, chloroplastic (Fragment) 9.52e-05 NA 1.02e-06 NA
7. B Q1QS64 Translation initiation factor IF-2 6.71e-04 NA 4.97e-06 NA
7. B Q3YS01 Translation initiation factor IF-2 5.63e-05 NA 0.001 NA
7. B Q8D240 Elongation factor Tu 3.15e-05 NA 1.46e-09 NA
7. B B4SQS0 Translation initiation factor IF-2 3.63e-03 NA 3.49e-08 NA
7. B Q11BC8 Translation initiation factor IF-2 1.06e-03 NA 2.03e-05 NA
7. B A2S2L1 Translation initiation factor IF-2 2.83e-03 NA 6.95e-04 NA
7. B P72689 Translation initiation factor IF-2 2.52e-04 NA 2.24e-06 NA
7. B Q8Y7F6 Translation initiation factor IF-2 7.40e-05 NA 2.14e-05 NA
7. B A3NEI1 Elongation factor Tu 1.26e-05 NA 2.18e-10 NA
7. B A9HF18 Translation initiation factor IF-2 8.98e-04 NA 3.23e-04 NA
7. B Q20EU5 Elongation factor Tu, chloroplastic 1.04e-05 NA 1.04e-11 NA
7. B C5BPV9 Translation initiation factor IF-2 2.33e-03 NA 6.54e-07 NA
7. B A8LLG2 Elongation factor Tu 1.47e-05 NA 2.33e-09 NA
7. B Q636L3 Translation initiation factor IF-2 1.64e-05 NA 3.29e-07 NA
7. B Q5XD49 Elongation factor Tu 1.84e-05 NA 4.33e-07 NA
7. B B8CKH3 Translation initiation factor IF-2 7.54e-04 NA 4.30e-06 NA
7. B Q8AAP9 Sulfate adenylyltransferase subunit 1 6.26e-04 NA 1.24e-04 NA
7. B B0T2B5 Elongation factor Tu 2 1.36e-05 NA 6.65e-10 NA
7. B B0B7N8 Elongation factor Tu 1.59e-05 NA 1.93e-09 NA
7. B P49411 Elongation factor Tu, mitochondrial 4.90e-05 NA 2.99e-07 NA
7. B A7ZUJ2 Elongation factor Tu 2 1.91e-05 NA 3.45e-09 NA
7. B A8M746 Translation initiation factor IF-2 2.00e-04 NA 7.84e-06 NA
7. B Q9W074 Protein HBS1 4.10e-04 NA 4.84e-04 NA
7. B B1YP36 Translation initiation factor IF-2 8.39e-04 NA 4.85e-04 NA
7. B B1XI63 Elongation factor Tu 1.29e-05 NA 4.90e-09 NA
7. B Q89WA9 Translation initiation factor IF-2 5.32e-04 NA 1.03e-05 NA
7. B Q72NX3 Translation initiation factor IF-2 4.66e-04 NA 8.21e-05 NA
7. B A1AV99 Translation initiation factor IF-2 4.34e-04 NA 1.68e-06 NA
7. B Q73H85 Elongation factor Tu 2 1.10e-05 NA 1.25e-10 NA
7. B Q254H4 Translation initiation factor IF-2 7.58e-04 NA 7.33e-04 NA
7. B Q57AA0 Translation initiation factor IF-2 1.40e-04 NA 7.19e-06 NA
7. B A3MJW4 Translation initiation factor IF-2 7.17e-04 NA 6.95e-04 NA
7. B Q5X1C3 Translation initiation factor IF-2 1.39e-03 NA 6.21e-07 NA
7. B Q9ZCZ8 Translation initiation factor IF-2 1.30e-03 NA 1.62e-04 NA
7. B B5QW22 Sulfate adenylyltransferase subunit 1 6.05e-04 NA 1.17e-04 NA
7. B Q7N9B1 Elongation factor Tu 1 1.67e-05 NA 4.01e-09 NA
7. B A5UHC1 Elongation factor Tu 1.79e-05 NA 1.25e-08 NA
7. B Q73NP6 Translation initiation factor IF-2 1.58e-03 NA 1.61e-07 NA
7. B Q2K9L8 Elongation factor Tu 2 1.28e-05 NA 2.14e-10 NA
7. B Q99QM0 Elongation factor Tu 1.36e-05 NA 2.92e-11 NA
7. B Q1MN39 Translation initiation factor IF-2 8.61e-04 NA 4.06e-05 NA
7. B B9MQH1 Elongation factor Tu 1.14e-05 NA 1.28e-10 NA
7. B B1J2A9 Translation initiation factor IF-2 7.96e-04 NA 1.67e-06 NA
7. B P46198 Translation initiation factor IF-2, mitochondrial 2.51e-04 NA 1.51e-04 NA
7. B O50293 Elongation factor Tu 1.08e-05 NA 3.66e-08 NA
7. B A8F2E9 Elongation factor Tu 1.17e-05 NA 1.95e-12 NA
7. B A1V8A5 Elongation factor Tu 1.54e-05 NA 2.18e-10 NA
7. B B3PXE3 Translation initiation factor IF-2 9.42e-04 NA 4.54e-05 NA
7. B A7MKI5 Elongation factor Tu 1.92e-05 NA 2.77e-09 NA
7. B Q54HB2 Elongation factor Tu, mitochondrial 1.62e-05 NA 3.31e-08 NA
7. B B2TZI0 Sulfate adenylyltransferase subunit 1 4.88e-04 NA 4.00e-04 NA
7. B A7NR65 Elongation factor Tu 1 1.46e-05 NA 4.78e-08 NA
7. B Q981F7 Elongation factor Tu 1.20e-05 NA 2.20e-11 NA
7. B P50373 Elongation factor Tu, chloroplastic 1.33e-05 NA 8.91e-08 NA
7. B A0T100 Elongation factor Tu, chloroplastic 1.15e-05 NA 3.12e-07 NA
7. B Q15VB8 Sulfate adenylyltransferase subunit 1 5.10e-04 NA 2.28e-04 NA
7. B A5IHU7 Translation initiation factor IF-2 9.91e-04 NA 6.48e-07 NA
7. B Q5P334 Elongation factor Tu 1.37e-05 NA 1.17e-09 NA
7. B Q2JMD7 Translation initiation factor IF-2 2.43e-04 NA 6.61e-08 NA
7. B A7GZZ3 Translation initiation factor IF-2 6.58e-04 NA 5.98e-07 NA
7. B P19457 Elongation factor Tu, chloroplastic 1.57e-05 NA 4.24e-09 NA
7. B B9E8Q0 Elongation factor Tu 2.30e-05 NA 3.26e-11 NA
7. B Q1IZ02 Translation initiation factor IF-2 4.14e-06 NA 2.17e-06 NA
7. B C5BQ44 Elongation factor Tu 1.17e-05 NA 8.04e-08 NA
7. B Q3SKX1 Translation initiation factor IF-2 1.43e-04 NA 7.18e-06 NA
7. B B8EIA7 Translation initiation factor IF-2 6.67e-04 NA 1.82e-06 NA
7. B C3P5L5 Translation initiation factor IF-2 1.51e-05 NA 2.31e-07 NA
7. B B7LWK4 Sulfate adenylyltransferase subunit 1 3.71e-04 NA 9.10e-05 NA
7. B Q3K1U4 Elongation factor Tu 2.11e-05 NA 3.80e-07 NA
7. B Q0P3M7 Elongation factor Tu, chloroplastic 1.05e-05 NA 1.06e-08 NA
7. B C3L7B4 Translation initiation factor IF-2 1.24e-05 NA 2.31e-07 NA
7. B Q7V5M4 Translation initiation factor IF-2 4.06e-04 NA 4.78e-08 NA
7. B Q9ZM46 Translation initiation factor IF-2 5.95e-05 NA 2.80e-06 NA
7. B Q9Z9A7 Elongation factor Tu 1.56e-05 NA 9.74e-10 NA
7. B B5Z8K3 Elongation factor Tu 1.43e-05 NA 1.02e-08 NA
7. B A5GIP0 Elongation factor Tu 1.24e-05 NA 4.54e-08 NA
7. B Q2KHZ2 HBS1-like protein 4.51e-04 NA 2.46e-04 NA
7. B C6DKK3 Translation initiation factor IF-2 1.62e-04 NA 0.025 NA
7. B Q02WY9 Elongation factor Tu 1.62e-05 NA 7.47e-07 NA
7. B Q6LM69 Sulfate adenylyltransferase subunit 1 2.78e-04 NA 3.22e-06 NA
7. B Q14JU2 Elongation factor Tu 2.97e-05 NA 1.56e-09 NA
7. B Q0BKB8 Elongation factor Tu 1.27e-05 NA 1.56e-09 NA
7. B A9WFP3 Elongation factor Tu 1.56e-05 NA 4.19e-08 NA
7. B Q4A7E2 Translation initiation factor IF-2 7.35e-05 NA 6.96e-11 NA
7. B C4LAG3 Sulfate adenylyltransferase subunit 1 5.71e-04 NA 4.38e-05 NA
7. B A4SJR5 Translation initiation factor IF-2 1.90e-04 NA 3.87e-05 NA
7. B A5EWY9 Translation initiation factor IF-2 1.15e-04 NA 1.77e-07 NA
7. B P33166 Elongation factor Tu 1.35e-05 NA 1.71e-11 NA
7. B Q48RU8 Translation initiation factor IF-2 9.79e-04 NA 8.74e-06 NA
7. B Q87WQ5 Translation initiation factor IF-2 8.52e-04 NA 5.54e-07 NA
7. B B1IPW0 Elongation factor Tu 1 1.83e-05 NA 4.50e-09 NA
7. B A5U9R1 Elongation factor Tu 1.80e-05 NA 1.25e-08 NA
7. B Q15V72 Translation initiation factor IF-2 1.90e-03 NA 1.65e-08 NA
7. B B4TTW5 Sulfate adenylyltransferase subunit 1 1.55e-04 NA 6.15e-05 NA
7. B A8L6F4 Translation initiation factor IF-2 1.83e-04 NA 2.35e-08 NA
7. B B0RU96 Elongation factor Tu 2 1.44e-05 NA 1.68e-08 NA
7. B C1CF71 Elongation factor Tu 1.84e-05 NA 2.82e-07 NA
7. B B4U3U1 Elongation factor Tu 1.97e-05 NA 4.26e-07 NA
7. B Q04FQ4 Elongation factor Tu 1.26e-05 NA 1.09e-08 NA
7. B P57873 Translation initiation factor IF-2 1.09e-04 NA 1.63e-04 NA
7. B Q64ZR4 Translation initiation factor IF-2 1.18e-03 NA 5.03e-04 NA
7. B A5DN78 Elongation factor Tu, mitochondrial 1.79e-05 NA 1.19e-08 NA
7. B A6QGG8 Translation initiation factor IF-2 2.40e-05 NA 2.51e-06 NA
7. B A7MJ69 Sulfate adenylyltransferase subunit 1 1.28e-04 NA 4.76e-05 NA
7. B Q8FEJ1 Sulfate adenylyltransferase subunit 1 4.45e-04 NA 4.32e-04 NA
7. B A3N005 Translation initiation factor IF-2 1.40e-03 NA 4.49e-04 NA
7. B B8GP02 Translation initiation factor IF-2 1.56e-03 NA 3.22e-06 NA
7. B Q4JV51 Translation initiation factor IF-2 7.38e-04 NA 2.13e-06 NA
7. B A1B002 Elongation factor Tu 1.54e-05 NA 5.07e-11 NA
7. B Q7VJ74 Elongation factor Tu 1.09e-05 NA 4.50e-08 NA
7. B Q8ZAN8 Elongation factor Tu-B 1.65e-05 NA 4.34e-09 NA
7. B P42477 Elongation factor Tu 1.29e-05 NA 2.06e-09 NA
7. B Q1LSK8 Translation initiation factor IF-2 2.34e-04 NA 4.99e-06 NA
7. B P64024 Elongation factor Tu 1.45e-05 NA 6.69e-11 NA
7. B A4TS36 Elongation factor Tu 2 1.65e-05 NA 4.34e-09 NA
7. B A6X0A2 Elongation factor Tu 1.38e-05 NA 6.75e-11 NA
7. B Q8XGZ0 Elongation factor Tu 1.27e-05 NA 1.60e-10 NA
7. B C4L8X4 Translation initiation factor IF-2 1.95e-04 NA 2.46e-06 NA
7. B Q5PAJ5 Translation initiation factor IF-2 5.87e-04 NA 1.17e-04 NA
7. B P18311 Translation initiation factor IF-2 3.90e-04 NA 3.68e-06 NA
7. B Q8KTA3 Elongation factor Tu 1.40e-05 NA 1.80e-12 NA
7. B Q2SU25 Elongation factor Tu 1.26e-05 NA 2.18e-10 NA
7. B Q7WHG2 Translation initiation factor IF-2 2.05e-03 NA 2.62e-04 NA
7. B B4SCE7 Translation initiation factor IF-2 8.70e-04 NA 0.002 NA
7. B Q3AB98 Translation initiation factor IF-2 1.66e-05 NA 2.44e-06 NA
7. B A6TWI4 Elongation factor Tu 1 1.72e-05 NA 8.57e-07 NA
7. B B2J955 Translation initiation factor IF-2 1.02e-03 NA 3.03e-07 NA
7. B Q8E0H1 Elongation factor Tu 2.04e-05 NA 3.87e-07 NA
7. B B0BB83 Translation initiation factor IF-2 7.58e-04 NA 5.65e-04 NA
7. B Q9PIZ1 Translation initiation factor IF-2 4.81e-05 NA 1.71e-07 NA
7. B Q1R0H7 Elongation factor Tu 1.56e-05 NA 1.29e-08 NA
7. B A1A0A2 Translation initiation factor IF-2 2.10e-04 NA 1.83e-05 NA
7. B A6U842 Elongation factor Tu 1.24e-05 NA 2.10e-11 NA
7. B B1XCS7 Sulfate adenylyltransferase subunit 1 5.32e-04 NA 4.03e-04 NA
7. B Q5LMR5 Elongation factor Tu 1.42e-05 NA 9.19e-10 NA
7. B Q8R7T8 Elongation factor Tu-B 1.25e-05 NA 9.84e-09 NA
7. B P84315 Elongation factor 1-alpha (Fragment) 1.19e-04 NA 1.01e-04 NA
7. B P58002 Translation initiation factor IF-2 1.26e-04 NA 6.41e-06 NA
7. B Q8Z470 Sulfate adenylyltransferase subunit 1 5.30e-04 NA 1.14e-04 NA
7. B Q5NG10 Sulfate adenylyltransferase subunit 1 1.13e-03 NA 4.07e-05 NA
7. B Q5GSU2 Elongation factor Tu 1 1.08e-05 NA 5.80e-10 NA
7. B C0PXB1 Sulfate adenylyltransferase subunit 1 1.41e-04 NA 4.24e-05 NA
7. B P57966 Elongation factor Tu-B 1.83e-05 NA 1.37e-07 NA
7. B B8D851 Elongation factor Tu 1.83e-05 NA 1.84e-09 NA
7. B Q46IW4 Elongation factor Tu 9.34e-06 NA 1.46e-08 NA
7. B Q2N9A8 Elongation factor Tu 1.51e-05 NA 2.82e-09 NA
7. B B3QY22 Elongation factor Tu 1.13e-05 NA 5.56e-11 NA
7. B B9DPF5 Translation initiation factor IF-2 1.81e-04 NA 2.04e-06 NA
7. B C1EP35 Translation initiation factor IF-2 2.02e-05 NA 3.29e-07 NA
7. B A1W8Z4 Translation initiation factor IF-2 2.11e-03 NA 0.002 NA
7. B A4SY78 Translation initiation factor IF-2 2.69e-03 NA 8.26e-05 NA
7. B Q57H76 Elongation factor Tu 1.87e-05 NA 4.42e-09 NA
7. B Q9PGR3 Translation initiation factor IF-2 2.58e-03 NA 3.05e-06 NA
7. B Q5E7L5 Translation initiation factor IF-2 2.08e-04 NA 1.32e-06 NA
7. B B1ZPC5 Elongation factor Tu 3.32e-05 NA 9.50e-06 NA
7. B A3PNL2 Translation initiation factor IF-2 3.47e-03 NA 1.63e-06 NA
7. B Q9ZF25 Translation initiation factor IF-2 1.52e-03 NA 6.50e-07 NA
7. B Q04GN0 Translation initiation factor IF-2 1.79e-04 NA 2.53e-06 NA
7. B Q3KM40 Elongation factor Tu 1.55e-05 NA 1.70e-09 NA
7. B A1AG73 Translation initiation factor IF-2 9.85e-05 NA 0.019 NA
7. B B5XKI1 Elongation factor Tu 1.86e-05 NA 3.33e-07 NA
7. B B3WER5 Translation initiation factor IF-2 9.14e-04 NA 1.72e-07 NA
7. B C1C881 Elongation factor Tu 1.87e-05 NA 2.82e-07 NA
7. B B7M076 Translation initiation factor IF-2 1.11e-04 NA 0.019 NA
7. B A9KNW4 Translation initiation factor IF-2 1.82e-03 NA 7.04e-04 NA
7. B Q8KT99 Elongation factor Tu 1.15e-05 NA 1.88e-12 NA
7. B Q0AUH8 Elongation factor Tu 1 1.23e-05 NA 4.73e-09 NA
7. B Q0I7K2 Translation initiation factor IF-2 4.03e-04 NA 2.45e-07 NA
7. B Q8FXT2 Translation initiation factor IF-2 2.90e-05 NA 7.26e-06 NA
7. B B4RC55 Translation initiation factor IF-2 1.72e-03 NA 4.47e-05 NA
7. B Q3Z7S9 Elongation factor Tu 1.15e-05 NA 5.34e-06 NA
7. B A8H740 Translation initiation factor IF-2 1.77e-04 NA 2.66e-06 NA
7. B A0RHI4 Translation initiation factor IF-2 2.08e-05 NA 3.29e-07 NA
7. B P0A706 Translation initiation factor IF-2 3.12e-04 NA 0.019 NA
7. B Q0SQC8 Elongation factor Tu 1.28e-05 NA 8.16e-09 NA
7. B B5REN6 Translation initiation factor IF-2 5.09e-04 NA 0.026 NA
7. B Q7URR0 Translation initiation factor IF-2 1.30e-03 NA 1.18e-04 NA
7. B B0VLU2 Translation initiation factor IF-2 6.66e-05 NA 2.36e-06 NA
7. B A7ZQJ5 Sulfate adenylyltransferase subunit 1 4.92e-04 NA 4.32e-04 NA
7. B Q1H4Q1 Elongation factor Tu 1 1.30e-05 NA 1.70e-10 NA
7. B B7GNA3 Translation initiation factor IF-2 1.62e-04 NA 1.41e-05 NA
7. B A2C4P1 Translation initiation factor IF-2 6.28e-04 NA 3.25e-07 NA
7. B O50340 Elongation factor Tu 7.01e-06 NA 8.26e-08 NA
7. B Q8DVP9 Translation initiation factor IF-2 8.70e-04 NA 3.84e-06 NA
7. B Q1R5Y2 Elongation factor Tu 1 1.90e-05 NA 4.50e-09 NA
7. B Q0C5Z5 Translation initiation factor IF-2 8.43e-04 NA 0.014 NA
7. B Q8E1H3 Translation initiation factor IF-2 1.29e-04 NA 6.77e-06 NA
7. B P9WNN1 Elongation factor Tu 2.41e-05 NA 4.26e-08 NA
7. B Q99YG1 Translation initiation factor IF-2 1.05e-03 NA 8.74e-06 NA
7. B Q9Z9L6 Elongation factor Tu 1.16e-05 NA 2.69e-09 NA
7. B A4TGY7 Elongation factor Tu 1 1.98e-05 NA 4.05e-09 NA
7. B B5Z6E6 Translation initiation factor IF-2 1.20e-04 NA 1.67e-05 NA
7. B Q1JHV6 Elongation factor Tu 1.88e-05 NA 4.33e-07 NA
7. B O31301 Elongation factor Tu (Fragment) 4.26e-05 NA 2.01e-07 NA
7. B Q140U6 Translation initiation factor IF-2 2.61e-03 NA 3.55e-04 NA
7. B Q160Y4 Elongation factor Tu 1.54e-05 NA 3.03e-11 NA
7. B C0Q9Y7 Elongation factor Tu 1.37e-05 NA 7.81e-11 NA
7. B A9WPV8 Translation initiation factor IF-2 3.15e-04 NA 2.61e-07 NA
7. B A7FNN8 Elongation factor Tu 2 1.94e-05 NA 4.05e-09 NA
7. B A1B587 Translation initiation factor IF-2 6.13e-04 NA 1.22e-05 NA
7. B Q1DAM6 Translation initiation factor IF-2 5.25e-04 NA 1.39e-05 NA
7. B A9MHG0 Elongation factor Tu 1.91e-05 NA 4.42e-09 NA
7. B C5CGR6 Elongation factor Tu 1.20e-05 NA 1.66e-08 NA
7. B B1XV89 Translation initiation factor IF-2 2.64e-03 NA 8.50e-06 NA
7. B Q3IJ53 Translation initiation factor IF-2 1.00e-03 NA 3.18e-07 NA
7. B P72230 Elongation factor G (Fragment) 2.78e-07 NA 3.02e-35 NA
7. B A5CUB6 Elongation factor Tu 2.79e-05 NA 9.98e-05 NA
7. B Q5R4B3 Eukaryotic peptide chain release factor GTP-binding subunit ERF3B 2.54e-04 NA 0.017 NA
7. B C1CCT8 Translation initiation factor IF-2 9.25e-04 NA 7.60e-07 NA
7. B Q3K5X4 Elongation factor Tu 2.15e-05 NA 5.52e-08 NA
7. B C1B313 Translation initiation factor IF-2 2.85e-04 NA 1.47e-06 NA
7. B A5D5I8 Elongation factor Tu 2 1.62e-05 NA 3.48e-09 NA
7. B Q85FT7 Elongation factor Tu, chloroplastic 1.22e-05 NA 7.84e-08 NA
7. B Q2JSB7 Translation initiation factor IF-2 1.43e-04 NA 5.80e-09 NA
7. B B2T381 Translation initiation factor IF-2 2.94e-03 NA 3.61e-04 NA
7. B B7HLE6 Translation initiation factor IF-2 2.06e-05 NA 3.21e-07 NA
7. B Q9ZT91 Elongation factor Tu, mitochondrial 2.06e-05 NA 6.19e-10 NA
7. B Q8NL22 Elongation factor Tu 1.48e-05 NA 7.38e-09 NA
7. B A7NID1 Translation initiation factor IF-2 3.06e-04 NA 4.09e-06 NA
7. B Q823F2 Translation initiation factor IF-2 1.14e-03 NA 1.97e-04 NA
7. B C3LJ80 Elongation factor Tu 9.83e-06 NA 7.87e-11 NA
7. B P33165 Elongation factor Tu 1.15e-05 NA 4.09e-10 NA
7. B Q8I335 Translation factor GUF1 homolog, mitochondrial 1.15e-04 NA 1.20e-21 NA
7. B A7FLY2 Sulfate adenylyltransferase subunit 1 1.20e-03 NA 1.40e-05 NA
7. B A5GNJ0 Translation initiation factor IF-2 3.98e-04 NA 2.53e-07 NA
7. B Q2VZV0 Translation initiation factor IF-2 5.80e-04 NA 7.77e-07 NA
7. B Q6NGN2 Translation initiation factor IF-2 1.74e-04 NA 1.75e-06 NA
7. B B8I6E7 Translation initiation factor IF-2 2.68e-04 NA 2.09e-05 NA
7. B A8FYS0 Translation initiation factor IF-2 9.12e-05 NA 7.00e-06 NA
7. B A2BT70 Translation initiation factor IF-2 3.89e-04 NA 3.53e-09 NA
7. B Q9Y700 Elongation factor Tu, mitochondrial 1.04e-05 NA 7.75e-12 NA
7. B A4G7S7 Translation initiation factor IF-2 1.94e-03 NA 3.14e-05 NA
7. B B2I726 Translation initiation factor IF-2 4.08e-03 NA 2.57e-06 NA
7. B P52978 Bifunctional enzyme NodQ 1.48e-03 NA 0.001 NA
7. B A6L030 Translation initiation factor IF-2 1.53e-03 NA 8.44e-04 NA
7. B Q3YYB1 Sulfate adenylyltransferase subunit 1 4.26e-04 NA 4.03e-04 NA
7. B B2A397 Translation initiation factor IF-2 3.50e-04 NA 1.76e-06 NA
7. B Q9ZF31 Translation initiation factor IF-2 1.77e-04 NA 0.027 NA
7. B A5FIJ9 Elongation factor Tu 2.72e-05 NA 1.63e-10 NA
7. B Q123F6 Elongation factor Tu 1.13e-05 NA 3.26e-12 NA
7. B Q5NQ65 Elongation factor Tu 1.44e-05 NA 1.25e-10 NA
7. B Q21M86 Elongation factor Tu 1.42e-05 NA 2.31e-07 NA
7. B B7H115 Translation initiation factor IF-2 1.96e-03 NA 2.34e-06 NA
7. B Q1D776 Elongation factor Tu 2 1.61e-05 NA 2.36e-11 NA
7. B Q1IHG6 Elongation factor Tu 3.20e-05 NA 3.79e-10 NA
7. B B0RRB4 Translation initiation factor IF-2 1.56e-04 NA 1.88e-07 NA
7. B A7Z4T4 Translation initiation factor IF-2 2.25e-05 NA 7.46e-07 NA
7. B A2RMT1 Elongation factor Tu 1.65e-05 NA 7.47e-07 NA
7. B B7JUP5 Elongation factor Tu 1.29e-05 NA 4.49e-08 NA
7. B Q38W81 Translation initiation factor IF-2 1.02e-03 NA 1.05e-05 NA
7. B B1WQY4 Elongation factor Tu 1.24e-05 NA 7.60e-09 NA
7. B B8JFY6 Translation initiation factor IF-2 1.12e-03 NA 1.53e-04 NA
7. B Q927I6 Elongation factor Tu 1.42e-05 NA 5.18e-11 NA
7. B B1Z7C0 Sulfate adenylyltransferase subunit 1 1.98e-05 NA 0.001 NA
7. B A9ISD9 Elongation factor Tu 1.27e-05 NA 4.03e-11 NA
7. B Q18EY5 Elongation factor 1-alpha 2.46e-05 NA 3.43e-13 NA
7. B A1USC1 Elongation factor Tu 1 1.25e-05 NA 1.75e-10 NA
7. B A4IW10 Translation initiation factor IF-2 8.94e-05 NA 2.99e-06 NA
7. B Q318N5 Elongation factor Tu 8.39e-06 NA 3.61e-08 NA
7. B B7KIU2 Translation initiation factor IF-2 3.42e-04 NA 1.15e-06 NA
7. B A6GWV8 Translation initiation factor IF-2 1.29e-03 NA 1.16e-04 NA
7. B B9JB95 Sulfate adenylyltransferase subunit 1 4.09e-05 NA 0.001 NA
7. B Q3SSW8 Elongation factor Tu 1.32e-05 NA 4.13e-11 NA
7. B B7JKB7 Elongation factor Tu 1.26e-05 NA 7.87e-11 NA
7. B Q877L9 Elongation factor Tu 1.31e-05 NA 2.31e-08 NA
7. B Q1H4N9 Elongation factor Tu 2 1.63e-05 NA 1.77e-10 NA
7. B Q9TJQ8 Elongation factor Tu, plastid 1.09e-05 NA 1.06e-10 NA
7. B A6Q1L5 Elongation factor Tu 1.32e-05 NA 2.73e-09 NA
7. B Q71ZZ7 Translation initiation factor IF-2 2.08e-05 NA 2.00e-05 NA
7. B Q88QP8 Elongation factor Tu-A 2.28e-05 NA 7.79e-08 NA
7. B Q3SWP9 Translation initiation factor IF-2 4.56e-04 NA 2.17e-06 NA
7. B Q925Y6 Elongation factor Tu 1.27e-05 NA 2.10e-11 NA
7. B B2RHM9 Translation initiation factor IF-2 1.41e-03 NA 1.02e-04 NA
7. B A2RFQ4 Elongation factor Tu 1.89e-05 NA 4.33e-07 NA
7. B A8EYF4 Translation initiation factor IF-2 6.05e-04 NA 1.07e-04 NA
7. B B0BUR2 Elongation factor Tu 1.14e-05 NA 1.53e-12 NA
7. B Q14HG2 Sulfate adenylyltransferase subunit 1 2.26e-04 NA 4.07e-05 NA
7. B Q18CE4 Elongation factor Tu 1.44e-05 NA 1.53e-11 NA
7. B Q6D9A5 Translation initiation factor IF-2 1.97e-04 NA 0.020 NA
7. B A0KTZ6 Translation initiation factor IF-2 1.15e-03 NA 4.60e-07 NA
7. B A4VTQ7 Elongation factor Tu 1.83e-05 NA 2.77e-07 NA
7. B Q83JC4 Elongation factor Tu 1.88e-05 NA 4.50e-09 NA
7. B Q1R7U0 Sulfate adenylyltransferase subunit 1 2.51e-04 NA 4.32e-04 NA
7. B Q255F3 Elongation factor Tu 1.48e-05 NA 2.32e-09 NA
7. B B8DW43 Translation initiation factor IF-2 1.13e-04 NA 2.29e-05 NA
7. B O83861 Translation initiation factor IF-2 8.08e-04 NA 1.63e-06 NA
7. B Q057A2 Elongation factor Tu 1.58e-05 NA 8.35e-09 NA
7. B P42476 Elongation factor Tu 1.43e-05 NA 3.35e-10 NA
7. B C5C9T1 Translation initiation factor IF-2 5.71e-05 NA 8.71e-07 NA
7. B Q5NZS1 Translation initiation factor IF-2 3.53e-04 NA 3.36e-05 NA
7. B A8GKK1 Elongation factor Tu 2 1.94e-05 NA 2.77e-09 NA
7. B A9KRZ4 Elongation factor Tu 1.58e-05 NA 9.69e-10 NA
7. B A1JS52 Elongation factor Tu 2 1.96e-05 NA 2.16e-09 NA
7. B B6J6B1 Translation initiation factor IF-2 1.84e-03 NA 0.048 NA
7. B Q05FI3 Elongation factor Tu 1.18e-05 NA 7.24e-09 NA
7. B A8YUS2 Elongation factor Tu 1.09e-05 NA 1.69e-09 NA
7. B A5UF34 Translation initiation factor IF-2 2.91e-03 NA 0.001 NA
7. B A0LV27 Translation initiation factor IF-2 1.61e-05 NA 2.79e-08 NA
7. B C4K3F0 Translation initiation factor IF-2 7.83e-05 NA 0.015 NA
7. B A1U600 Translation initiation factor IF-2 1.45e-03 NA 6.83e-07 NA
7. B A1JJT0 Sulfate adenylyltransferase subunit 1 1.76e-04 NA 2.74e-05 NA
7. B Q6KID8 Translation initiation factor IF-2 7.12e-05 NA 1.63e-10 NA
7. B A1VIP8 Elongation factor Tu 1.45e-05 NA 1.70e-10 NA
7. B Q32CH9 Sulfate adenylyltransferase subunit 1 2.38e-04 NA 4.10e-04 NA
7. B P57939 Elongation factor Tu-A 1.84e-05 NA 1.39e-08 NA
7. B B7N0V3 Translation initiation factor IF-2 9.38e-05 NA 0.018 NA
7. B P50062 Elongation factor Tu 1.21e-05 NA 6.50e-11 NA
7. B A7HWP7 Elongation factor Tu 1.36e-05 NA 8.54e-12 NA
7. B Q5HAS0 Elongation factor Tu 1.89e-05 NA 1.66e-05 NA
7. B Q5R6Y0 HBS1-like protein 3.68e-04 NA 3.90e-04 NA
7. B Q8KHX9 Elongation factor Tu 1.32e-05 NA 1.18e-10 NA
7. B Q83GT8 Translation initiation factor IF-2 4.95e-04 NA 4.25e-07 NA
7. B B9KFF9 Elongation factor Tu 1.21e-05 NA 8.98e-09 NA
7. B A2BYM0 Translation initiation factor IF-2 5.71e-04 NA 1.87e-08 NA
7. B Q58735 Uncharacterized protein MJ1339 1.73e-04 NA 4.17e-04 NA
7. B Q2NJ20 Elongation factor Tu 1.33e-05 NA 5.14e-10 NA
7. B A1KV51 Translation initiation factor IF-2 1.28e-04 NA 3.44e-04 NA
7. B Q2A1M0 Elongation factor Tu 1.24e-05 NA 1.56e-09 NA
7. B Q7M7X5 Translation initiation factor IF-2 1.37e-04 NA 1.56e-06 NA
7. B A1R516 Translation initiation factor IF-2 1.14e-04 NA 1.52e-07 NA
7. B Q4MYA4 Elongation factor Tu, apicoplast 3.99e-05 NA 4.07e-08 NA
7. B B9DVB7 Translation initiation factor IF-2 1.03e-03 NA 3.47e-06 NA
7. B Q65QG6 Elongation factor Tu 1.60e-05 NA 1.37e-08 NA
7. B P46199 Translation initiation factor IF-2, mitochondrial 3.58e-04 NA 3.59e-05 NA
7. B B4TJ06 Translation initiation factor IF-2 9.53e-05 NA 0.027 NA
7. B C0ZYA5 Translation initiation factor IF-2 2.22e-04 NA 1.91e-06 NA
7. B Q7M7F1 Elongation factor Tu 1.31e-05 NA 2.13e-08 NA
7. B A0ALY8 Elongation factor Tu 1.39e-05 NA 1.72e-10 NA
7. B Q68WI4 Translation initiation factor IF-2 1.67e-03 NA 1.81e-04 NA
7. B A6GYU7 Elongation factor Tu 2.95e-05 NA 3.38e-10 NA
7. B Q0BK70 Translation initiation factor IF-2 1.09e-03 NA 3.29e-06 NA
7. B Q5PEH2 Sulfate adenylyltransferase subunit 1 3.31e-04 NA 1.07e-04 NA
7. B Q2SVG8 Translation initiation factor IF-2 2.77e-03 NA 6.01e-04 NA
7. B B3EH93 Elongation factor Tu 1.41e-05 NA 1.55e-11 NA
7. B Q5YSC6 Translation initiation factor IF-2 2.51e-04 NA 8.10e-07 NA
7. B C6E2Q0 Translation initiation factor IF-2 5.89e-05 NA 1.48e-05 NA
7. B Q39H30 Translation initiation factor IF-2 2.56e-03 NA 1.21e-04 NA
7. B B1K0M0 Translation initiation factor IF-2 2.18e-03 NA 2.60e-04 NA
7. B A0RQZ4 Translation initiation factor IF-2 5.48e-05 NA 6.35e-07 NA
7. B Q8P1W4 Elongation factor Tu 1.81e-05 NA 3.33e-07 NA
7. B B7VJH7 Translation initiation factor IF-2 1.11e-04 NA 1.48e-07 NA
7. B Q1IX70 Elongation factor Tu 1.53e-05 NA 1.30e-06 NA
7. B Q1J5B4 Translation initiation factor IF-2 1.00e-03 NA 7.96e-06 NA
7. B Q6HPR0 Elongation factor Tu 1.22e-05 NA 7.87e-11 NA
7. B Q1QSZ0 Translation initiation factor IF-2 1.52e-03 NA 3.29e-06 NA
7. B A7WYX6 Elongation factor Tu 1.07e-05 NA 6.03e-09 NA
7. B A8A779 Elongation factor Tu 2 1.80e-05 NA 4.42e-09 NA
7. B A6MW28 Elongation factor Tu, chloroplastic 1.00e-05 NA 6.22e-08 NA
7. B A8A3N0 Sulfate adenylyltransferase subunit 1 3.69e-04 NA 4.25e-04 NA
7. B A8FJU1 Translation initiation factor IF-2 4.26e-05 NA 1.81e-07 NA
7. B Q0BUQ2 Elongation factor Tu 1.22e-05 NA 2.87e-11 NA
7. B C1ET37 Elongation factor Tu 9.79e-06 NA 7.87e-11 NA
7. B A4VZZ3 Elongation factor Tu 2.89e-05 NA 2.77e-07 NA
7. B Q9HGI4 Eukaryotic peptide chain release factor GTP-binding subunit 3.70e-04 NA 0.033 NA
7. B Q6MJ00 Elongation factor Tu 1.27e-05 NA 2.43e-07 NA
7. B B2JKT4 Translation initiation factor IF-2 2.45e-03 NA 4.09e-04 NA
7. B Q8UJ51 Translation initiation factor IF-2 8.69e-04 NA 4.10e-04 NA
7. B B8HG54 Translation initiation factor IF-2 5.19e-05 NA 2.02e-07 NA
7. B B0SQH4 Translation initiation factor IF-2 8.03e-05 NA 6.47e-06 NA
7. B B0TC54 Elongation factor Tu 1.56e-05 NA 1.66e-11 NA
7. B P55875 Translation initiation factor IF-2 1.60e-03 NA 6.06e-05 NA
7. B A1S204 Elongation factor Tu 1.60e-05 NA 4.27e-10 NA
7. B A4G9U0 Elongation factor Tu 1.33e-05 NA 4.98e-11 NA
7. B P46280 Elongation factor Tu, chloroplastic 2.67e-05 NA 9.11e-11 NA
7. B Q11Q98 Elongation factor Tu 1.64e-05 NA 5.70e-10 NA
7. B Q3YX73 Translation initiation factor IF-2 2.14e-04 NA 0.018 NA
7. B A8LQ56 Translation initiation factor IF-2 5.93e-04 NA 7.70e-05 NA
7. B A7Z0N5 Elongation factor Tu 2.80e-05 NA 3.40e-11 NA
7. B Q1BWS7 Translation initiation factor IF-2 2.24e-04 NA 2.65e-04 NA
7. B Q6AG49 Translation initiation factor IF-2 1.19e-04 NA 2.30e-06 NA
7. B A9BHA7 Elongation factor Tu 1.23e-05 NA 2.37e-09 NA
7. B A1KB29 Elongation factor Tu 1.37e-05 NA 7.57e-09 NA
7. B Q7VRP0 Elongation factor Tu 1.58e-05 NA 5.52e-10 NA
7. B P49462 Elongation factor Tu, chloroplastic 6.60e-06 NA 3.00e-05 NA
7. B Q1JAC1 Translation initiation factor IF-2 9.68e-04 NA 8.74e-06 NA
7. B Q4URC5 Elongation factor Tu 2 1.38e-05 NA 1.68e-08 NA
7. B Q7MYE8 Elongation factor Tu 2 1.71e-05 NA 2.53e-09 NA
7. B A7I3U7 Elongation factor Tu 1.69e-05 NA 1.02e-07 NA
7. B Q43364 Elongation factor TuB, chloroplastic 2.32e-05 NA 1.11e-10 NA
7. B P60339 Elongation factor Tu-B 1.55e-05 NA 2.08e-09 NA
7. B B1LQ72 Sulfate adenylyltransferase subunit 1 2.01e-04 NA 4.03e-04 NA
7. B A2S7F9 Elongation factor Tu 1.51e-05 NA 2.18e-10 NA
7. B Q4A7K0 Elongation factor Tu 1.04e-05 NA 2.57e-09 NA
7. B P43926 Elongation factor Tu 1.75e-05 NA 1.25e-08 NA
7. B Q2A1G8 Translation initiation factor IF-2 1.36e-03 NA 3.08e-06 NA
7. B Q7MPF2 Sulfate adenylyltransferase subunit 1 1.51e-04 NA 0.001 NA
7. B Q97S57 Translation initiation factor IF-2 1.05e-03 NA 7.47e-07 NA
7. B Q5ZZV6 Translation initiation factor IF-2 1.20e-04 NA 6.61e-11 NA
7. B A8EZL8 Elongation factor Tu 1.15e-05 NA 1.90e-12 NA
7. B Q04LW0 Translation initiation factor IF-2 9.24e-04 NA 7.60e-07 NA
7. B P18905 Elongation factor Tu, chloroplastic 8.76e-06 NA 0.002 NA
7. B B2G6V6 Translation initiation factor IF-2 9.21e-06 NA 2.50e-08 NA
7. B Q2RMS0 Translation initiation factor IF-2 6.23e-04 NA 2.48e-06 NA
7. B Q48D34 Elongation factor Tu 1.90e-05 NA 1.41e-08 NA
7. B Q6AP73 Elongation factor Tu 2 1.61e-05 NA 1.45e-10 NA
7. B Q2RQV8 Elongation factor Tu 1 1.31e-05 NA 1.60e-10 NA
7. B Q04B37 Elongation factor Tu 1.18e-05 NA 8.45e-10 NA
7. B A3D7K6 Translation initiation factor IF-2 1.11e-04 NA 5.53e-07 NA
7. B A9N732 Translation initiation factor IF-2 5.05e-04 NA 0.027 NA
7. B A1QZR2 Elongation factor Tu 1.35e-05 NA 3.45e-10 NA
7. B C0QVZ4 Elongation factor Tu 1.38e-04 NA 1.31e-06 NA
7. B Q67JU1 Elongation factor Tu 1.13e-05 NA 2.04e-09 NA
7. B Q21IS6 Sulfate adenylyltransferase subunit 1 2.86e-04 NA 5.82e-04 NA
7. B Q2G0N0 Elongation factor Tu 1.07e-05 NA 6.03e-09 NA
7. B Q66FQ9 Elongation factor Tu 1 1.60e-05 NA 4.34e-09 NA
7. B P0A1H5 Elongation factor Tu 1.90e-05 NA 4.42e-09 NA
7. B P33169 Elongation factor Tu 1.72e-05 NA 3.51e-10 NA
7. B B5XSX4 Translation initiation factor IF-2 5.15e-04 NA 0.027 NA
7. B Q835U8 Translation initiation factor IF-2 4.12e-04 NA 5.92e-07 NA
7. B Q5L627 Translation initiation factor IF-2 8.36e-04 NA 7.94e-05 NA
7. B C0QT02 GTPase Der 2.69e-02 NA 0.004 NA
7. B Q0TCC0 Elongation factor Tu 1 1.85e-05 NA 4.50e-09 NA
7. B Q04N79 Elongation factor Tu 1.97e-05 NA 2.82e-07 NA
7. B B6IZ61 Translation initiation factor IF-2 7.01e-05 NA 0.047 NA
7. B Q18BH4 Translation initiation factor IF-2 7.61e-06 NA 1.37e-06 NA
7. B Q0SM50 Translation initiation factor IF-2 4.24e-04 NA 3.76e-07 NA
7. B O21245 Elongation factor Tu, mitochondrial 1.06e-05 NA 6.77e-10 NA
7. B Q89J82 Elongation factor Tu 1.30e-05 NA 1.05e-12 NA
7. B A6UF29 Translation initiation factor IF-2 8.23e-04 NA 1.90e-05 NA
7. B P23568 Elongation factor Tu 1.01e-05 NA 1.77e-11 NA
7. B B9IVA1 Translation initiation factor IF-2 1.74e-05 NA 3.21e-07 NA
7. B B2S0H9 Elongation factor Tu 1.21e-05 NA 3.87e-10 NA
7. B Q8CQ81 Elongation factor Tu 1.06e-05 NA 9.74e-10 NA
7. B A3CP09 Elongation factor Tu 1.93e-05 NA 4.69e-07 NA
7. B Q5WFU2 Translation initiation factor IF-2 2.81e-05 NA 1.83e-06 NA
7. B A1WLI3 Translation initiation factor IF-2 1.78e-03 NA 5.26e-04 NA
7. B Q88VE0 Elongation factor Tu 1.61e-05 NA 1.30e-07 NA
7. B A9ABD5 Translation initiation factor IF-2 2.16e-04 NA 5.42e-04 NA
7. B Q6NCN5 Translation initiation factor IF-2 4.90e-04 NA 1.71e-05 NA
7. B B8ZM93 Translation initiation factor IF-2 8.88e-04 NA 7.66e-07 NA
7. B Q0SY20 Elongation factor Tu 2 1.80e-05 NA 4.42e-09 NA
7. B B8CW72 Translation initiation factor IF-2 6.13e-05 NA 9.72e-10 NA
7. B A5WGK9 Elongation factor Tu 1 1.74e-05 NA 5.71e-09 NA
7. B O84098 Translation initiation factor IF-2 1.09e-03 NA 4.84e-04 NA
7. B A1VG83 Translation initiation factor IF-2 1.94e-03 NA 9.57e-06 NA
7. B A5F3K0 Elongation factor Tu 1.51e-05 NA 4.97e-10 NA
7. B Q877P8 Elongation factor Tu 1.75e-05 NA 5.46e-09 NA
7. B Q0RDS4 Translation initiation factor IF-2 1.47e-04 NA 0.001 NA
7. B Q3AZB7 Translation initiation factor IF-2 4.97e-04 NA 3.59e-08 NA
7. B Q2II78 Elongation factor Tu 1.42e-05 NA 8.72e-11 NA
7. B Q38WR7 Elongation factor Tu 1.10e-05 NA 5.61e-09 NA
7. B O31298 Elongation factor Tu 1.88e-05 NA 3.64e-09 NA
7. B Q9ZK19 Elongation factor Tu 1.41e-05 NA 2.85e-07 NA
7. B A0KQ95 Elongation factor Tu 1.71e-05 NA 4.58e-09 NA
7. B Q5GWR8 Elongation factor Tu 1.50e-05 NA 5.46e-09 NA
7. B Q1XDK1 Elongation factor Tu, chloroplastic 1.04e-05 NA 8.77e-10 NA
7. B Q5L5H6 Elongation factor Tu 1.46e-05 NA 2.72e-09 NA
7. B Q71WB9 Elongation factor Tu 1.45e-05 NA 1.72e-10 NA
7. B P65132 Translation initiation factor IF-2 3.99e-05 NA 6.28e-07 NA
7. B A7ZSL4 Elongation factor Tu 1 1.86e-05 NA 4.50e-09 NA
7. B Q2GD83 Elongation factor Tu 2.45e-05 NA 6.19e-07 NA
7. B A9NAK7 Elongation factor Tu 2.70e-05 NA 7.02e-09 NA
7. B Q6GBT9 Elongation factor Tu 1.04e-05 NA 6.03e-09 NA
7. B A6TEI7 Translation initiation factor IF-2 1.85e-04 NA 0.026 NA
7. B B5FI13 Translation initiation factor IF-2 6.76e-05 NA 0.027 NA
7. B P64029 Elongation factor Tu 1.05e-05 NA 6.03e-09 NA
7. B Q73IX6 Elongation factor Tu 1 1.16e-05 NA 1.18e-10 NA
7. B Q16D38 Translation initiation factor IF-2 6.43e-04 NA 1.48e-04 NA
7. B B7IUH1 Translation initiation factor IF-2 1.64e-05 NA 3.32e-07 NA
7. B Q8XFP8 Elongation factor Tu 1.29e-05 NA 8.16e-09 NA
7. B B3QZH5 Elongation factor Tu 1.14e-05 NA 1.61e-08 NA
7. B Q5SHN6 Elongation factor Tu-A 1.50e-05 NA 2.00e-08 NA
7. B P64028 Elongation factor Tu 1.10e-05 NA 6.03e-09 NA
7. B Q8KTA1 Elongation factor Tu 1.24e-05 NA 1.83e-12 NA
7. B P42478 Elongation factor Tu (Fragment) 1.86e-05 NA 2.04e-10 NA
7. B Q4KIF6 Translation initiation factor IF-2 7.95e-04 NA 6.80e-07 NA
7. B Q2KDZ5 Translation initiation factor IF-2 8.92e-05 NA 3.86e-05 NA
7. B P0A3K6 Translation initiation factor IF-2 9.01e-04 NA 6.71e-06 NA
7. B Q28UW7 Elongation factor Tu 1.41e-05 NA 4.03e-10 NA
7. B P33168 Elongation factor Tu 1.50e-05 NA 2.59e-06 NA
7. B C0QHM2 Translation initiation factor IF-2 1.59e-03 NA 7.85e-04 NA
7. B Q3BRP5 Translation initiation factor IF-2 3.23e-03 NA 4.83e-08 NA
7. B B0T167 Translation initiation factor IF-2 1.99e-03 NA 1.85e-07 NA
7. B Q2YM08 Elongation factor Tu 1.44e-05 NA 6.69e-11 NA
7. B Q83JX8 Sulfate adenylyltransferase subunit 1 1.49e-04 NA 4.07e-04 NA
7. B Q5NID9 Elongation factor Tu 1.31e-05 NA 1.56e-09 NA
7. B B7MZ52 Sulfate adenylyltransferase subunit 1 1.14e-04 NA 4.03e-04 NA
7. B Q5JGR9 Probable translation initiation factor IF-2 9.97e-03 NA 0.010 NA
7. B Q0AYI8 Translation initiation factor IF-2 6.22e-05 NA 1.23e-07 NA
7. B Q0I3P5 Translation initiation factor IF-2 1.34e-03 NA 4.59e-04 NA
7. B A7H4R3 Elongation factor Tu 1.46e-05 NA 1.26e-08 NA
7. B Q5HX30 Translation initiation factor IF-2 5.58e-04 NA 1.77e-07 NA
7. B A4W5A0 Elongation factor Tu 1.93e-05 NA 2.79e-09 NA
7. B Q2L2G6 Elongation factor Tu 3.02e-05 NA 8.72e-11 NA
7. B A7ZC69 Translation initiation factor IF-2 3.27e-04 NA 6.87e-07 NA
7. B Q2GKQ2 Translation initiation factor IF-2 5.15e-04 NA 0.028 NA
7. B A4XYE0 Translation initiation factor IF-2 7.69e-04 NA 5.61e-06 NA
7. B Q5ZRV4 Translation initiation factor IF-2 1.73e-03 NA 6.59e-07 NA
7. B P75022 Elongation factor Tu 1.38e-05 NA 2.52e-10 NA
7. B Q3A9P8 Elongation factor Tu 2 1.32e-05 NA 9.31e-10 NA
7. B Q3J8Q0 Elongation factor Tu 1.52e-05 NA 1.44e-09 NA
7. B A1USL2 Elongation factor Tu 2 1.31e-05 NA 1.70e-10 NA
7. B Q9KP20 Sulfate adenylyltransferase subunit 1 1.57e-04 NA 7.72e-04 NA
7. B A9MF24 Sulfate adenylyltransferase subunit 1 1.22e-04 NA 8.61e-05 NA
7. B A3NUL0 Translation initiation factor IF-2 2.51e-03 NA 6.66e-04 NA
7. B Q0VSL7 Elongation factor Tu 1.55e-05 NA 6.51e-08 NA
7. B Q5GS99 Translation initiation factor IF-2 4.50e-04 NA 0.011 NA
7. B A6QEK0 Elongation factor Tu 1.04e-05 NA 6.03e-09 NA
7. B Q1GDV0 Elongation factor Tu 1.43e-05 NA 5.17e-11 NA
7. B B3EFB1 Translation initiation factor IF-2 7.45e-04 NA 0.002 NA
7. B Q3Z7U3 Translation initiation factor IF-2 1.04e-04 NA 2.40e-05 NA
7. B C3PH19 Translation initiation factor IF-2 6.36e-05 NA 6.33e-06 NA
7. B Q0SZX8 Elongation factor Tu 1 1.88e-05 NA 4.87e-09 NA
7. B Q8DQV2 Translation initiation factor IF-2 9.18e-04 NA 7.60e-07 NA
7. B Q6B8Y0 Elongation factor Tu, chloroplastic 1.12e-05 NA 1.10e-08 NA
7. B Q57710 Probable translation initiation factor IF-2 3.12e-02 NA 0.038 NA
7. B Q2P0X1 Translation initiation factor IF-2 3.11e-03 NA 5.89e-08 NA
7. B P29541 Elongation factor G (Fragment) 0.00e+00 NA 1.43e-133 NA
7. B A8Z5T8 Elongation factor Tu 1.33e-05 NA 3.09e-09 NA
7. B Q7MH43 Elongation factor Tu 1 1.54e-05 NA 5.24e-10 NA
7. B A4Y9C0 Translation initiation factor IF-2 6.61e-04 NA 5.68e-07 NA
7. B Q4A9A2 Translation initiation factor IF-2 1.22e-04 NA 6.61e-11 NA
7. B A1ST45 Translation initiation factor IF-2 2.33e-04 NA 1.25e-08 NA
7. B A1K7B9 Translation initiation factor IF-2 2.11e-03 NA 0.001 NA
7. B Q1QUF9 Sulfate adenylyltransferase subunit 1 2.45e-04 NA 0.004 NA
7. B Q7VA20 Translation initiation factor IF-2 3.97e-04 NA 7.22e-08 NA
7. B A5IJ09 Translation initiation factor IF-2 1.42e-05 NA 8.52e-10 NA
7. B B9K884 Elongation factor Tu 1.27e-05 NA 3.09e-08 NA
7. B B5F415 Sulfate adenylyltransferase subunit 1 1.39e-04 NA 6.15e-05 NA
7. B Q43467 Elongation factor Tu, chloroplastic 2.78e-05 NA 1.86e-07 NA
7. B Q5WZL4 Elongation factor Tu 3.79e-05 NA 5.52e-10 NA
7. B Q63PZ6 Elongation factor Tu 1.27e-05 NA 2.18e-10 NA
7. B Q81VT2 Elongation factor Tu 1.20e-05 NA 7.87e-11 NA
7. B A3P0B5 Elongation factor Tu 1.60e-05 NA 2.18e-10 NA
7. B Q31VV0 Elongation factor Tu 1.85e-05 NA 4.50e-09 NA
7. B Q6F1H1 Translation initiation factor IF-2 9.69e-06 NA 7.86e-08 NA
7. B B7VKY2 Sulfate adenylyltransferase subunit 1 1.34e-04 NA 9.04e-05 NA
7. B C4ZB99 Elongation factor Tu 9.04e-06 NA 3.47e-09 NA
7. B A5CSZ4 Translation initiation factor IF-2 1.97e-04 NA 1.86e-07 NA
7. B Q13EL8 Translation initiation factor IF-2 3.16e-03 NA 1.47e-07 NA
7. B Q2SSW8 Elongation factor Tu 1.21e-05 NA 5.90e-10 NA
7. B B2TJ55 Translation initiation factor IF-2 9.63e-06 NA 2.42e-07 NA
7. B P0A1H6 Elongation factor Tu 1.89e-05 NA 4.42e-09 NA
7. B A6VU29 Translation initiation factor IF-2 1.22e-03 NA 5.19e-05 NA
7. B Q0VSS1 Translation initiation factor IF-2 1.57e-04 NA 4.34e-06 NA
7. B B0RB36 Elongation factor Tu 2.17e-05 NA 1.03e-04 NA
7. B Q2EEV7 Elongation factor Tu, plastid 1.06e-05 NA 4.32e-10 NA
7. B P64031 Elongation factor Tu 1.86e-05 NA 2.82e-07 NA
7. B P31018 Elongation factor 1-alpha 2.76e-05 NA 5.15e-06 NA
7. B Q086H2 Translation initiation factor IF-2 1.07e-04 NA 9.99e-07 NA
7. B Q6FF40 Translation initiation factor IF-2 2.06e-03 NA 1.49e-06 NA
7. B P55972 Translation initiation factor IF-2 1.21e-04 NA 1.05e-05 NA
7. B A0Q6F0 Sulfate adenylyltransferase subunit 1 3.80e-04 NA 3.12e-05 NA
7. B Q2KXY7 Translation initiation factor IF-2 2.53e-03 NA 2.17e-04 NA
7. B Q5GXU9 Translation initiation factor IF-2 1.26e-04 NA 5.89e-08 NA
7. B A4W3R7 Translation initiation factor IF-2 9.53e-04 NA 7.37e-07 NA
7. B Q5FTY1 Elongation factor Tu 1.59e-05 NA 8.85e-12 NA
7. B A8MLC4 Elongation factor Tu 1.62e-05 NA 1.41e-09 NA
7. B Q2NW23 Translation initiation factor IF-2 1.74e-04 NA 0.034 NA
7. B B5E266 Translation initiation factor IF-2 9.37e-04 NA 7.86e-07 NA
7. B B3ETZ7 Elongation factor Tu 1.53e-05 NA 2.78e-09 NA
7. B P13537 Elongation factor Tu 1.21e-05 NA 3.89e-08 NA
7. B A0KP35 Sulfate adenylyltransferase subunit 1 2.29e-04 NA 6.22e-05 NA
7. B Q62KK9 Translation initiation factor IF-2 8.85e-05 NA 6.95e-04 NA
7. B C3K259 Translation initiation factor IF-2 7.93e-04 NA 6.30e-07 NA
7. B Q82K53 Translation initiation factor IF-2 2.03e-04 NA 2.99e-07 NA
7. B A9VP75 Elongation factor Tu 1.20e-05 NA 8.57e-11 NA
7. B Q605B0 Elongation factor Tu 1.72e-05 NA 5.77e-10 NA
7. B B2UUW8 Elongation factor Tu 1.46e-05 NA 9.81e-09 NA
7. B Q5FKR8 Elongation factor Tu 1.14e-05 NA 2.53e-10 NA
7. B O07309 Bifunctional enzyme NodQ 3.43e-04 NA 0.002 NA
7. B Q12QI1 Translation initiation factor IF-2 1.23e-04 NA 9.18e-07 NA
7. B P17746 Elongation factor Tu, chloroplastic 9.41e-06 NA 6.97e-10 NA
7. B C1D8X2 Translation initiation factor IF-2 2.13e-03 NA 2.98e-06 NA
7. B P40175 Elongation factor Tu-3 6.59e-06 NA 3.86e-07 NA
7. B B8D9G2 Translation initiation factor IF-2 4.95e-04 NA 1.21e-06 NA
7. B P0DB85 Translation initiation factor IF-2 9.87e-04 NA 8.74e-06 NA
7. B A4SCQ7 Elongation factor Tu 1.41e-05 NA 2.32e-10 NA
7. B A8GT71 Elongation factor Tu 1.15e-05 NA 1.53e-12 NA
7. B B5RPI0 Elongation factor Tu 7.59e-06 NA 6.05e-11 NA
7. B A3DJ00 Elongation factor Tu 1.34e-05 NA 2.87e-10 NA
7. B Q812X7 Translation initiation factor IF-2 3.71e-05 NA 3.65e-07 NA
7. B Q7MI09 Translation initiation factor IF-2 1.74e-04 NA 4.83e-07 NA
7. B Q01W31 Translation initiation factor IF-2 1.52e-03 NA 4.91e-06 NA
7. B P42482 Elongation factor Tu 1.38e-05 NA 1.32e-08 NA
7. B Q5NQ27 Translation initiation factor IF-2 1.43e-03 NA 8.20e-04 NA
7. B A3QGU5 Translation initiation factor IF-2 1.97e-04 NA 3.86e-06 NA
7. B A5I4J3 Translation initiation factor IF-2 1.79e-04 NA 1.87e-08 NA
7. B Q042T5 Elongation factor Tu 1.28e-05 NA 1.51e-10 NA
7. B B9DRL9 Elongation factor Tu 1.89e-05 NA 2.49e-07 NA
7. B B3E156 Elongation factor Tu 1.08e-05 NA 9.11e-11 NA
7. B B8FCY5 Translation initiation factor IF-2 1.68e-03 NA 5.82e-07 NA
7. B Q0TCU1 Translation initiation factor IF-2 5.05e-04 NA 0.019 NA
7. B A4YSJ0 Elongation factor Tu 1.33e-05 NA 2.82e-12 NA
7. B A9M9Z4 Translation initiation factor IF-2 1.88e-04 NA 7.90e-06 NA
7. B B7LHN3 Translation initiation factor IF-2 1.99e-04 NA 0.019 NA
7. B B9EBE9 Translation initiation factor IF-2 3.24e-05 NA 2.08e-06 NA
7. B Q6G0P2 Translation initiation factor IF-2 4.58e-05 NA 6.48e-07 NA
7. B Q2NZX1 Elongation factor Tu 1.50e-05 NA 5.46e-09 NA
7. B G0S8G9 Eukaryotic translation initiation factor 5B 2.36e-03 NA 6.34e-04 NA
7. B B0JU67 Translation initiation factor IF-2 2.62e-04 NA 4.82e-07 NA
7. B B2RL52 Elongation factor Tu 1.30e-05 NA 2.63e-10 NA
7. B Q3B6G3 Elongation factor Tu 1.48e-05 NA 2.01e-11 NA
7. B Q73F98 Elongation factor Tu 1.22e-05 NA 7.66e-11 NA
7. B Q01698 Elongation factor Tu 1.17e-05 NA 1.98e-08 NA
7. B B2GKR5 Translation initiation factor IF-2 3.09e-04 NA 1.59e-07 NA
7. B A2C6Q5 Translation initiation factor IF-2 3.83e-04 NA 4.91e-08 NA
7. B C5BFB7 Translation initiation factor IF-2 5.57e-04 NA 5.71e-06 NA
7. B Q1MPT8 Elongation factor Tu 1.58e-05 NA 1.44e-10 NA
7. B A1UER8 Translation initiation factor IF-2 1.02e-04 NA 0.001 NA
7. B A1T7H8 Translation initiation factor IF-2 1.12e-04 NA 4.11e-08 NA
7. B Q2G2D0 Translation initiation factor IF-2 2.37e-05 NA 2.51e-06 NA
7. B Q7UZZ9 Translation initiation factor IF-2 4.88e-04 NA 1.66e-08 NA
7. B C4ZSQ9 Translation initiation factor IF-2 1.65e-04 NA 0.019 NA
7. B Q8DE73 Sulfate adenylyltransferase subunit 1 1.60e-04 NA 0.001 NA
7. B A1RGX5 Translation initiation factor IF-2 1.14e-04 NA 5.68e-07 NA
7. B A4WW80 Translation initiation factor IF-2 6.25e-04 NA 1.68e-06 NA
7. B Q3MDM5 Elongation factor Tu 1.42e-05 NA 6.98e-11 NA
7. B B3QQI2 Translation initiation factor IF-2 6.85e-04 NA 0.012 NA
7. B Q1JKH1 Translation initiation factor IF-2 1.01e-03 NA 8.74e-06 NA
7. B A3PY75 Translation initiation factor IF-2 1.05e-04 NA 0.001 NA
7. B Q66EC7 Sulfate adenylyltransferase subunit 1 8.55e-04 NA 1.40e-05 NA
7. B A3DE44 Translation initiation factor IF-2 1.16e-03 NA 3.84e-05 NA
7. B P51257 Translation initiation factor IF-2, chloroplastic 1.38e-03 NA 0.010 NA
7. B O51741 Translation initiation factor IF-2 1.33e-04 NA 1.16e-06 NA
7. B P17745 Elongation factor Tu, chloroplastic 2.46e-05 NA 8.06e-11 NA
7. B Q118Z2 Elongation factor Tu 1.24e-05 NA 3.29e-09 NA
7. B P84172 Elongation factor Tu, mitochondrial (Fragment) 5.65e-07 NA 6.79e-06 NA
7. B Q25820 Elongation factor Tu, apicoplast 1.86e-05 NA 0.002 NA
7. B B3H163 Translation initiation factor IF-2 1.37e-03 NA 4.49e-04 NA
7. B Q31LL9 Translation initiation factor IF-2 1.41e-03 NA 5.82e-06 NA
7. B A7ZCN0 Elongation factor Tu 1.69e-05 NA 4.92e-08 NA
7. B Q5HPS2 Translation initiation factor IF-2 2.44e-05 NA 3.79e-07 NA
7. B B1MD87 Translation initiation factor IF-2 1.56e-04 NA 1.66e-07 NA
7. B P50743 GTPase Der 2.85e-02 NA 0.048 NA
7. B A3Q968 Elongation factor Tu 1 1.73e-05 NA 1.96e-09 NA
7. B P72483 Elongation factor Tu 2.20e-05 NA 4.08e-07 NA
7. B B7MKM5 Sulfate adenylyltransferase subunit 1 4.96e-04 NA 4.32e-04 NA
7. B Q5LWL4 Translation initiation factor IF-2 5.88e-04 NA 8.46e-05 NA
7. B B0BY61 Translation initiation factor IF-2 5.97e-04 NA 9.45e-05 NA
7. B A6LP48 Translation initiation factor IF-2 6.28e-05 NA 1.52e-08 NA
7. B A1WVC4 Elongation factor Tu 1 1.16e-05 NA 1.32e-09 NA
7. B B5ZC31 Elongation factor Tu 9.37e-06 NA 4.83e-10 NA
7. B P0CD71 Elongation factor Tu 1.53e-05 NA 1.70e-09 NA
7. B P0A3B0 Elongation factor Tu 1.16e-05 NA 2.42e-12 NA
7. B B0SH18 Translation initiation factor IF-2 8.28e-04 NA 6.47e-06 NA
7. B Q7N8L0 Sulfate adenylyltransferase subunit 1 1.67e-04 NA 1.02e-05 NA
7. B B1KWK7 Translation initiation factor IF-2 1.78e-04 NA 1.79e-08 NA
7. B C0ZIH6 Elongation factor Tu 1.19e-05 NA 5.40e-11 NA
7. B Q73VV4 Translation initiation factor IF-2 3.40e-05 NA 1.89e-06 NA
7. B A1VNU2 Translation initiation factor IF-2 1.15e-03 NA 4.63e-05 NA
7. B P33170 Elongation factor Tu 1.85e-05 NA 2.58e-07 NA
7. B Q1GCH2 Translation initiation factor IF-2 5.55e-04 NA 2.33e-06 NA
7. B P0DA82 Elongation factor Tu 1.84e-05 NA 4.33e-07 NA
7. B Q9CEI0 Elongation factor Tu 1.67e-05 NA 7.47e-07 NA
7. B A9H3R7 Elongation factor Tu 1.49e-05 NA 4.48e-11 NA
7. B Q8NWZ1 Translation initiation factor IF-2 2.59e-06 NA 2.55e-06 NA
7. B A6TRK7 Translation initiation factor IF-2 3.40e-05 NA 7.60e-07 NA
7. B Q21RV6 Elongation factor Tu 2 1.59e-05 NA 6.83e-12 NA
7. B B5QZV8 Translation initiation factor IF-2 1.25e-04 NA 0.027 NA
7. B A0Q0Q7 Translation initiation factor IF-2 1.17e-05 NA 7.75e-07 NA
7. B Q6FZL2 Elongation factor Tu 2 1.32e-05 NA 1.03e-10 NA
7. B A1W2Q5 Elongation factor Tu 1 1.34e-05 NA 4.98e-11 NA
7. B Q8A463 Elongation factor Tu 1.11e-05 NA 1.51e-10 NA
7. B Q98BI8 Translation initiation factor IF-2 6.21e-04 NA 3.45e-05 NA
7. B C3P9Q3 Elongation factor Tu 1.20e-05 NA 7.87e-11 NA
7. B A7HZ93 Translation initiation factor IF-2 8.98e-04 NA 1.09e-06 NA
7. B B2IIJ7 Translation initiation factor IF-2 1.32e-03 NA 2.56e-06 NA
7. B P84318 Elongation factor 1-alpha (Fragment) 1.12e-04 NA 1.01e-04 NA
7. B Q2FJ92 Elongation factor Tu 1.08e-05 NA 6.03e-09 NA
7. B Q600B6 Elongation factor Tu 2.01e-05 NA 2.57e-09 NA
7. B P47388 Translation initiation factor IF-2 4.72e-05 NA 5.11e-08 NA
7. B Q32BG5 Translation initiation factor IF-2 1.46e-04 NA 0.019 NA
7. B A0LIH6 Elongation factor Tu 1.61e-05 NA 7.84e-10 NA
7. B A7MXE4 Elongation factor Tu 1.50e-05 NA 2.58e-09 NA
7. B A6TEX7 Elongation factor Tu 1.85e-05 NA 3.16e-09 NA
7. B Q7V500 Elongation factor Tu 9.95e-06 NA 1.90e-08 NA
7. B Q8A2A1 Translation initiation factor IF-2 1.80e-03 NA 1.15e-04 NA
7. B P42480 Elongation factor Tu 1.46e-05 NA 1.55e-10 NA
7. B Q9ZEU3 Elongation factor Tu 1.16e-05 NA 3.37e-08 NA
7. B A8A4Y4 Translation initiation factor IF-2 1.48e-04 NA 0.019 NA
7. B Q1KVS9 Elongation factor Tu, chloroplastic 1.13e-05 NA 1.56e-11 NA
7. B Q1WUF4 Translation initiation factor IF-2 1.70e-05 NA 5.45e-07 NA
7. B Q05D44 Eukaryotic translation initiation factor 5B 5.58e-03 NA 1.15e-04 NA
7. B B1AJG3 Elongation factor Tu 9.30e-06 NA 3.98e-10 NA
7. B B2UAA3 Translation initiation factor IF-2 2.20e-03 NA 0.001 NA
7. B Q4G342 Elongation factor Tu, chloroplastic 1.75e-05 NA 8.54e-09 NA
7. B Q03WH4 Translation initiation factor IF-2 5.20e-04 NA 1.26e-05 NA
7. B Q46J13 Translation initiation factor IF-2 4.76e-04 NA 3.45e-07 NA
7. B Q211E6 Elongation factor Tu 1.29e-05 NA 6.77e-12 NA
7. B Q727D5 Elongation factor Tu 1.65e-05 NA 1.04e-09 NA
7. B Q81ZS3 Elongation factor Tu 1.59e-05 NA 3.87e-08 NA
7. B B6ENE2 Translation initiation factor IF-2 2.21e-05 NA 1.86e-07 NA
7. B P50064 Elongation factor Tu 8.96e-06 NA 1.91e-09 NA
7. B B6JN44 Elongation factor Tu 1.46e-05 NA 1.01e-08 NA
7. B P74227 Elongation factor Tu 1.07e-05 NA 1.13e-09 NA
7. B Q81WM3 Translation initiation factor IF-2 2.24e-05 NA 2.31e-07 NA
7. B Q6G4W7 Translation initiation factor IF-2 6.92e-04 NA 9.11e-06 NA
7. B Q31W47 Translation initiation factor IF-2 1.62e-04 NA 0.019 NA
7. B C1CJ39 Translation initiation factor IF-2 9.44e-04 NA 7.22e-07 NA
7. B Q8U1R8 Probable translation initiation factor IF-2 2.75e-03 NA 0.008 NA
7. B P23845 Sulfate adenylyltransferase subunit 1 4.51e-04 NA 4.03e-04 NA
7. B Q0K9B9 Translation initiation factor IF-2 9.62e-04 NA 1.19e-04 NA
7. B C5BWS3 Translation initiation factor IF-2 7.40e-04 NA 8.02e-08 NA
7. B Q0TEA7 Sulfate adenylyltransferase subunit 1 5.02e-04 NA 4.03e-04 NA
7. B Q03M88 Translation initiation factor IF-2 1.00e-03 NA 5.71e-05 NA
7. B B0CH34 Elongation factor Tu 1.43e-05 NA 6.99e-11 NA
7. B Q7W9A5 Translation initiation factor IF-2 1.88e-03 NA 2.69e-04 NA
7. B B8G1W4 Elongation factor Tu 1.40e-05 NA 8.14e-11 NA
7. B B0BBV3 Elongation factor Tu 1.55e-05 NA 1.93e-09 NA
7. B A8ZZ65 Translation initiation factor IF-2 7.30e-04 NA 7.74e-07 NA
7. B Q6LLV5 Elongation factor Tu 2 1.67e-05 NA 2.36e-09 NA
7. B Q2NIQ6 Translation initiation factor IF-2 9.27e-05 NA 1.71e-05 NA
7. B B2UQY9 Elongation factor Tu 9.66e-06 NA 2.17e-11 NA
7. B P9WKK0 Translation initiation factor IF-2 2.77e-05 NA 6.28e-07 NA
7. B Q0S219 Translation initiation factor IF-2 2.70e-04 NA 1.61e-06 NA
7. B O67825 Translation initiation factor IF-2 4.59e-04 NA 6.82e-09 NA
7. B Q87M02 Translation initiation factor IF-2 1.48e-04 NA 4.43e-07 NA
7. B Q9P9Q9 Elongation factor Tu 1.70e-05 NA 5.71e-09 NA
7. B B9L7I8 Elongation factor Tu 1.13e-05 NA 1.10e-10 NA
7. B Q3AW53 Elongation factor Tu 1.11e-05 NA 1.58e-08 NA
7. B Q9PQH1 Translation initiation factor IF-2 1.09e-05 NA 8.38e-08 NA
7. B C4K2I2 Elongation factor Tu 1.15e-05 NA 1.53e-12 NA
7. B Q0SSD4 Translation initiation factor IF-2 4.25e-06 NA 1.75e-07 NA
7. B C4K4F8 Elongation factor Tu 1.65e-05 NA 5.82e-10 NA
7. B O69303 Elongation factor Tu 1.49e-05 NA 1.26e-08 NA
7. B Q2SSE6 Translation initiation factor IF-2 3.90e-05 NA 3.29e-09 NA
7. B Q6GJC0 Elongation factor Tu 1.07e-05 NA 6.03e-09 NA
7. B B0BNR5 Translation initiation factor IF-2 1.48e-03 NA 5.56e-04 NA
7. B Q3A9R3 Elongation factor Tu 1 1.33e-05 NA 1.01e-09 NA
7. B B2GBC2 Elongation factor Tu 1.54e-05 NA 6.68e-08 NA
7. B O74774 Elongation factor 1 alpha-like protein 3.85e-04 NA 4.58e-04 NA
7. B Q5PLB0 Translation initiation factor IF-2 5.04e-04 NA 0.026 NA
7. B Q4UL51 Translation initiation factor IF-2 6.76e-04 NA 8.67e-05 NA
7. B B0VE81 Translation initiation factor IF-2 1.98e-03 NA 2.34e-06 NA
7. B A4YJE9 Translation initiation factor IF-2 2.31e-03 NA 8.25e-07 NA
7. B A0LE19 Translation initiation factor IF-2 8.14e-04 NA 9.09e-08 NA
7. B C5D3R5 Elongation factor Tu 1.25e-05 NA 1.41e-11 NA
7. B B0RDY9 Translation initiation factor IF-2 1.11e-04 NA 1.98e-07 NA
7. B Q9MUP0 Elongation factor Tu, chloroplastic 1.33e-05 NA 3.54e-10 NA
7. B Q5HIC7 Elongation factor Tu 1.06e-05 NA 6.03e-09 NA
7. B A3PEY3 Translation initiation factor IF-2 4.08e-04 NA 4.36e-09 NA
7. B Q32B27 Elongation factor Tu 1.87e-05 NA 4.50e-09 NA
7. B Q83ES6 Elongation factor Tu 1.19e-05 NA 7.02e-09 NA
7. B B2I2M7 Translation initiation factor IF-2 2.05e-03 NA 2.34e-06 NA
7. B Q9X764 Translation initiation factor IF-2 1.26e-04 NA 4.15e-06 NA
7. B Q7VHF6 Translation initiation factor IF-2 3.03e-05 NA 1.58e-05 NA
7. B B3PMU1 Elongation factor Tu 1.38e-05 NA 1.13e-09 NA
7. B Q1BA94 Translation initiation factor IF-2 1.17e-04 NA 0.001 NA
7. B A5VJE0 Translation initiation factor IF-2 9.47e-06 NA 2.50e-08 NA
7. B Q2YQR7 Translation initiation factor IF-2 1.03e-03 NA 7.19e-06 NA
7. B Q8EX18 Elongation factor Tu 1.09e-05 NA 1.38e-11 NA
7. B Q8KT97 Elongation factor Tu 1.21e-05 NA 1.78e-12 NA
7. B Q609C0 Translation initiation factor IF-2 2.49e-03 NA 8.10e-07 NA
7. B Q9JYD2 Translation initiation factor IF-2 2.67e-04 NA 3.62e-04 NA
7. B B9DKV8 Elongation factor Tu 9.29e-06 NA 4.60e-09 NA
7. B A5IHR6 Elongation factor Tu 1.90e-05 NA 5.38e-10 NA
7. B Q8E645 Elongation factor Tu 2.01e-05 NA 3.80e-07 NA
7. B A6KYK9 Elongation factor Tu 1.17e-05 NA 1.38e-10 NA
7. B B7V1F6 Translation initiation factor IF-2 8.69e-05 NA 1.80e-05 NA
7. B A8G6Z5 Translation initiation factor IF-2 4.03e-04 NA 1.38e-08 NA
7. B B5ZBC9 Translation initiation factor IF-2 1.33e-05 NA 8.73e-07 NA
7. B B8HUA9 Translation initiation factor IF-2 2.10e-04 NA 7.91e-07 NA
7. B A9WGP6 Translation initiation factor IF-2 3.45e-04 NA 9.51e-06 NA
7. B Q8NZU7 Translation initiation factor IF-2 1.06e-03 NA 8.23e-06 NA
7. B Q8NP40 Translation initiation factor IF-2 2.32e-04 NA 1.17e-05 NA
7. B Q87EV4 Translation initiation factor IF-2 2.88e-03 NA 2.57e-06 NA
7. B Q4A578 Translation initiation factor IF-2 7.43e-04 NA 3.34e-12 NA
7. B A7FNJ0 Elongation factor Tu 1 1.65e-05 NA 4.34e-09 NA
7. B Q4L5X1 Translation initiation factor IF-2 6.98e-04 NA 1.05e-06 NA
7. B B7HQU2 Elongation factor Tu 1.21e-05 NA 7.66e-11 NA
7. B Q493T7 Translation initiation factor IF-2 1.14e-04 NA 1.58e-07 NA
7. B Q3A6P9 Elongation factor Tu 2 1.57e-05 NA 5.17e-10 NA
7. B A1VXL9 Translation initiation factor IF-2 5.00e-04 NA 1.78e-07 NA
7. B Q8EHL5 Translation initiation factor IF-2 1.60e-04 NA 5.05e-07 NA
7. B P51287 Elongation factor Tu, chloroplastic 1.08e-05 NA 9.24e-10 NA
7. B Q0C1F4 Elongation factor Tu 1 1.22e-05 NA 5.18e-08 NA
7. B A7GK18 Elongation factor Tu 1.15e-05 NA 6.77e-11 NA
7. B B5E653 Elongation factor Tu 1.94e-05 NA 2.82e-07 NA
7. B Q26487 Elongation factor 1-alpha (Fragment) 1.09e-04 NA 1.02e-04 NA
7. B B5RM34 Elongation factor Tu 1.23e-05 NA 6.05e-11 NA
7. B Q5ZYP5 Elongation factor Tu 3.53e-05 NA 5.38e-10 NA
7. B Q2NVM8 Sulfate adenylyltransferase subunit 1 5.03e-03 NA 3.51e-04 NA
7. B Q6YQV8 Elongation factor Tu 1.32e-05 NA 4.20e-10 NA
7. B Q2GGQ8 Translation initiation factor IF-2 6.77e-05 NA 0.001 NA
7. B O50306 Elongation factor Tu 1.22e-05 NA 7.20e-11 NA
7. B A6U188 Translation initiation factor IF-2 2.40e-05 NA 2.62e-06 NA
7. B Q1RIX0 Translation initiation factor IF-2 5.76e-04 NA 4.19e-05 NA
7. B Q2NQL7 Elongation factor Tu 1.60e-05 NA 3.87e-09 NA
7. B A8G907 Translation initiation factor IF-2 1.74e-04 NA 3.13e-06 NA
7. B Q83JF9 Translation initiation factor IF-2 1.41e-04 NA 0.019 NA
7. B B5YS58 Translation initiation factor IF-2 1.78e-05 NA 0.019 NA
7. B B0B9K4 Translation initiation factor IF-2 7.32e-04 NA 5.65e-04 NA
7. B B8I5N8 Elongation factor Tu 1.52e-05 NA 6.54e-10 NA
7. B Q8KAH0 Elongation factor Tu 1.41e-05 NA 1.70e-11 NA
7. B Q3BWY6 Elongation factor Tu 1.47e-05 NA 7.38e-09 NA
7. B Q0I1U9 Elongation factor Tu 1.79e-05 NA 1.07e-08 NA
7. B Q9PK73 Elongation factor Tu NA NA 1.75e-09 NA
7. B Q4K519 Elongation factor Tu 1.87e-05 NA 3.12e-08 NA
7. B B7LEG9 Sulfate adenylyltransferase subunit 1 3.37e-04 NA 4.36e-04 NA
7. B B7NKN7 Translation initiation factor IF-2 1.47e-04 NA 0.019 NA
7. B A5GAW4 Elongation factor Tu 1.64e-05 NA 6.09e-10 NA
7. B Q17VM8 Elongation factor Tu 1.48e-05 NA 1.16e-08 NA
7. B Q3SLQ1 Elongation factor Tu 1.67e-05 NA 1.09e-07 NA
7. B C3L0B6 Translation initiation factor IF-2 1.04e-05 NA 1.93e-08 NA
7. B A3PGI1 Elongation factor Tu 1.32e-05 NA 6.45e-10 NA
7. B A5IQA2 Elongation factor Tu 1.07e-05 NA 6.03e-09 NA
7. B Q044B7 Translation initiation factor IF-2 1.87e-04 NA 1.79e-07 NA
7. B Q65PA9 Elongation factor Tu 1.33e-05 NA 2.36e-12 NA
7. B Q03F25 Elongation factor Tu 1.44e-05 NA 3.54e-07 NA
7. B B9JYK6 Translation initiation factor IF-2 9.51e-04 NA 2.57e-04 NA
7. B A1BDF1 Translation initiation factor IF-2 8.03e-04 NA 7.47e-04 NA
7. B A9M5Q2 Elongation factor Tu 1.46e-05 NA 6.69e-11 NA
7. B P59506 Elongation factor Tu 1.81e-05 NA 8.89e-09 NA
7. B Q0A797 Translation initiation factor IF-2 1.70e-03 NA 5.49e-08 NA
7. B Q2S1P8 Elongation factor Tu 1.56e-05 NA 1.75e-09 NA
7. B Q3AMT6 Elongation factor Tu 9.48e-06 NA 2.04e-08 NA
7. B Q1QN32 Elongation factor Tu 1.41e-05 NA 4.28e-11 NA
7. B Q2RJM5 Translation initiation factor IF-2 7.89e-04 NA 1.27e-06 NA
7. B A1ALS6 Elongation factor Tu 1.74e-05 NA 1.39e-09 NA
7. B Q8DCQ7 Elongation factor Tu 2 1.50e-05 NA 2.36e-09 NA
7. B B8J1Y4 Translation initiation factor IF-2 1.17e-03 NA 4.83e-05 NA
7. B Q8R050 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A 2.55e-04 NA 0.043 NA
7. B B4SBU5 Elongation factor Tu 1.37e-05 NA 1.99e-11 NA
7. B B4TFX1 Sulfate adenylyltransferase subunit 1 1.38e-04 NA 1.18e-04 NA
7. B B6JKX5 Translation initiation factor IF-2 6.68e-04 NA 2.49e-06 NA
7. B Q2IPZ7 Translation initiation factor IF-2 1.08e-03 NA 1.69e-04 NA
7. B Q5E830 Sulfate adenylyltransferase subunit 1 3.28e-04 NA 2.33e-04 NA
7. B A6Q226 Translation initiation factor IF-2 3.68e-05 NA 7.74e-08 NA
7. B A0R8H8 Elongation factor Tu 1.23e-05 NA 7.87e-11 NA
7. B A5VJ92 Elongation factor Tu 1.53e-05 NA 1.58e-07 NA
7. B Q2W2H3 Elongation factor Tu 1.44e-05 NA 4.74e-12 NA
7. B Q92SW4 Translation initiation factor IF-2 1.06e-04 NA 4.46e-05 NA
7. B B0KK53 Elongation factor Tu 2.14e-05 NA 7.79e-08 NA
7. B A2CC87 Elongation factor Tu 1.01e-05 NA 2.15e-08 NA
7. B Q10XM3 Translation initiation factor IF-2 2.13e-03 NA 5.14e-07 NA
7. B Q0TMN0 Elongation factor Tu 1.28e-05 NA 8.16e-09 NA
7. B A8YVQ7 Translation initiation factor IF-2 1.08e-04 NA 1.33e-08 NA
7. B Q3JSY9 Translation initiation factor IF-2 5.93e-03 NA 6.89e-04 NA
7. B Q8EB10 Sulfate adenylyltransferase subunit 1 5.69e-05 NA 2.51e-06 NA
7. B Q74JU6 Elongation factor Tu 1.21e-05 NA 1.42e-10 NA
7. B Q2RQU6 Elongation factor Tu 2 1.33e-05 NA 1.77e-10 NA
7. B Q8KTA6 Elongation factor Tu 1.25e-05 NA 2.00e-12 NA
7. B P84319 Elongation factor 1-alpha (Fragment) 1.04e-04 NA 1.01e-04 NA
7. B P84321 Elongation factor 1-alpha (Fragment) 1.01e-04 NA 1.01e-04 NA
7. B Q2S8Z8 Elongation factor Tu 1.66e-05 NA 4.25e-07 NA
7. B P56003 Elongation factor Tu 1.44e-05 NA 9.72e-09 NA
7. B A2RD01 Translation initiation factor IF-2 1.01e-03 NA 8.09e-06 NA
7. B Q39VA6 Translation initiation factor IF-2 1.69e-04 NA 5.90e-05 NA
7. B Q9AC25 Translation initiation factor IF-2 1.62e-03 NA 1.36e-07 NA
7. B Q7NBZ4 Translation initiation factor IF-2 2.17e-05 NA 7.37e-12 NA
7. B Q2JUX4 Elongation factor Tu 1.13e-05 NA 1.63e-09 NA
7. B Q87SX9 Sulfate adenylyltransferase subunit 1 1.30e-04 NA 7.65e-04 NA
7. B Q03QN5 Elongation factor Tu 1.49e-05 NA 1.02e-07 NA
7. B C1KZK6 Elongation factor Tu 1.37e-05 NA 1.72e-10 NA
7. B A7H1L5 Translation initiation factor IF-2 5.60e-04 NA 1.80e-07 NA
7. B Q21WJ5 Translation initiation factor IF-2 2.13e-04 NA 9.83e-06 NA
7. B O83217 Elongation factor Tu 2.09e-05 NA 3.73e-11 NA
7. B Q83NT9 Elongation factor Tu 1.41e-05 NA 4.80e-05 NA
7. B A6W7Z2 Translation initiation factor IF-2 3.36e-04 NA 9.89e-07 NA
7. B A8YZP5 Elongation factor Tu 1.05e-05 NA 6.03e-09 NA
7. B B2V4G9 Translation initiation factor IF-2 9.73e-06 NA 2.03e-07 NA
7. B P0CE47 Elongation factor Tu 1 1.83e-05 NA 4.50e-09 NA
7. B Q5M1B9 Translation initiation factor IF-2 1.11e-03 NA 5.33e-05 NA
7. B A8AQ58 Translation initiation factor IF-2 5.07e-04 NA 0.029 NA
7. B Q5RDE1 Eukaryotic translation initiation factor 5B 5.64e-03 NA 0.016 NA
7. B Q8KT95 Elongation factor Tu 1.14e-05 NA 7.72e-12 NA
7. B C1CLI6 Elongation factor Tu 1.80e-05 NA 2.82e-07 NA
7. B A6W394 Elongation factor Tu 1.28e-05 NA 6.28e-09 NA
7. B Q8X7X7 Sulfate adenylyltransferase subunit 1 5.02e-04 NA 4.07e-04 NA
7. B Q98QG1 Elongation factor Tu 9.61e-06 NA 1.89e-09 NA
7. B A6WWW5 Translation initiation factor IF-2 1.08e-03 NA 1.46e-05 NA
7. B C3LRM1 Sulfate adenylyltransferase subunit 1 1.41e-04 NA 7.72e-04 NA
7. B Q73FL0 Translation initiation factor IF-2 3.62e-04 NA 0.022 NA
7. B Q79G84 Elongation factor Tu 1.51e-05 NA 1.37e-10 NA
7. B Q72GW4 Elongation factor Tu 1.50e-05 NA 1.10e-08 NA
7. B B8HVR7 Elongation factor Tu 1.28e-05 NA 1.86e-09 NA
7. B O24310 Elongation factor Tu, chloroplastic NA NA 8.13e-10 NA
7. B A9IMT5 Translation initiation factor IF-2 5.73e-04 NA 3.21e-06 NA
7. B A5IM81 Elongation factor Tu 1.23e-05 NA 3.09e-08 NA
7. B Q72ER1 Translation initiation factor IF-2 1.94e-03 NA 1.02e-05 NA
7. B B2HKS2 Translation initiation factor IF-2 1.08e-04 NA 1.44e-07 NA
7. B Q839G8 Elongation factor Tu 2.78e-05 NA 2.07e-11 NA
7. B B3QUN2 Translation initiation factor IF-2 1.80e-03 NA 8.31e-05 NA
7. B Q2YXP7 Translation initiation factor IF-2 2.40e-05 NA 2.62e-06 NA
7. B Q40450 Elongation factor TuA, chloroplastic 2.49e-05 NA 1.44e-10 NA
7. B Q149F3 Eukaryotic peptide chain release factor GTP-binding subunit ERF3B 2.53e-04 NA 0.010 NA
7. B A5FV21 Translation initiation factor IF-2 7.62e-04 NA 2.28e-06 NA
7. B A0RQJ3 Elongation factor Tu 1.55e-05 NA 9.72e-09 NA
7. B C1F697 Translation initiation factor IF-2 3.39e-04 NA 1.07e-06 NA
7. B B1YGU8 Elongation factor Tu 1.52e-05 NA 7.98e-10 NA
7. B B3EAE7 Translation initiation factor IF-2 6.46e-05 NA 2.61e-05 NA
7. B A5FZW7 Elongation factor Tu 1.30e-05 NA 3.91e-12 NA
7. B B4U1E8 Translation initiation factor IF-2 9.86e-04 NA 4.22e-06 NA
7. B Q3JMP6 Elongation factor Tu 1.21e-05 NA 2.18e-10 NA
7. B A6TZ25 Elongation factor Tu 1.05e-05 NA 6.03e-09 NA
7. B A4JDX1 Translation initiation factor IF-2 7.46e-04 NA 3.36e-04 NA
7. B B8ZL95 Elongation factor Tu 1.92e-05 NA 2.82e-07 NA
7. B A9NEN4 Elongation factor Tu 8.30e-06 NA 2.46e-09 NA
7. B A5WH42 Elongation factor Tu 2 1.69e-05 NA 5.81e-09 NA
7. B Q64VQ9 Sulfate adenylyltransferase subunit 1 1.24e-03 NA 2.91e-05 NA
7. B A8A5E6 Elongation factor Tu 1 1.84e-05 NA 4.50e-09 NA
7. B C4KZP9 Elongation factor Tu 1.50e-05 NA 5.31e-10 NA
7. B Q6A7M5 Translation initiation factor IF-2 6.02e-04 NA 9.51e-07 NA
7. B Q92HF5 Translation initiation factor IF-2 8.48e-04 NA 2.85e-04 NA
7. B A8F223 Translation initiation factor IF-2 7.46e-04 NA 1.97e-04 NA
7. B Q24UI6 Translation initiation factor IF-2 1.12e-03 NA 1.11e-05 NA
7. B B2U207 Translation initiation factor IF-2 7.37e-05 NA 0.019 NA
7. B Q48E77 Translation initiation factor IF-2 8.36e-04 NA 6.20e-07 NA
7. B P84320 Elongation factor 1-alpha (Fragment) 6.97e-05 NA 1.01e-04 NA
7. B Q6F0J5 Elongation factor Tu 1.35e-05 NA 9.65e-10 NA
7. B P84322 Elongation factor 1-alpha (Fragment) 6.24e-05 NA 1.01e-04 NA
7. B Q1LLR6 Translation initiation factor IF-2 8.42e-05 NA 0.001 NA
7. B Q72KE8 Translation initiation factor IF-2 7.04e-05 NA 2.07e-05 NA
7. B Q30X13 Elongation factor Tu 1.48e-05 NA 3.23e-10 NA
7. B B7MB89 Translation initiation factor IF-2 2.74e-04 NA 0.019 NA
7. B B2J5B1 Elongation factor Tu 1.24e-05 NA 5.35e-11 NA
7. B Q1LSY4 Elongation factor Tu 1.20e-05 NA 6.61e-11 NA
7. B Q0AIJ7 Elongation factor Tu 1 1.56e-05 NA 4.87e-08 NA
7. B A4SGG2 Translation initiation factor IF-2 5.70e-04 NA 1.68e-04 NA
7. B P02992 Elongation factor Tu, mitochondrial 2.16e-05 NA 2.64e-09 NA
7. B B7LXG3 Sulfate adenylyltransferase subunit 1 3.92e-04 NA 4.36e-04 NA
7. B A1UU50 Translation initiation factor IF-2 5.63e-04 NA 2.57e-06 NA
7. B Q9TKZ5 Elongation factor Tu, chloroplastic 8.70e-06 NA 3.61e-10 NA
7. B Q63TP8 Translation initiation factor IF-2 2.31e-03 NA 6.89e-04 NA
7. B B1KMH4 Sulfate adenylyltransferase subunit 1 1.52e-04 NA 7.02e-05 NA
7. B Q5FQM3 Translation initiation factor IF-2 8.76e-04 NA 7.94e-06 NA
7. B Q9KV37 Elongation factor Tu-A 1.49e-05 NA 5.98e-10 NA
7. B A7FVZ3 Translation initiation factor IF-2 1.25e-04 NA 1.87e-08 NA
7. B Q79GC6 Elongation factor Tu 2.97e-05 NA 1.37e-10 NA
7. B Q0BYB2 Elongation factor Tu 2 1.22e-05 NA 5.04e-08 NA
7. B B8J1A0 Elongation factor Tu 1.43e-05 NA 1.85e-08 NA
7. B B4S5M9 Elongation factor Tu 1.36e-05 NA 1.85e-10 NA
7. B Q14K20 Translation initiation factor IF-2 1.18e-03 NA 3.02e-06 NA
7. B A1AVJ8 Elongation factor Tu 1 1.35e-05 NA 3.09e-07 NA
7. B Q4FLK5 Elongation factor Tu 1.16e-05 NA 9.09e-08 NA
7. B C1CQ48 Translation initiation factor IF-2 8.72e-04 NA 7.53e-07 NA
7. B A5GF86 Translation initiation factor IF-2 7.50e-04 NA 2.13e-05 NA
7. B Q83GW1 Elongation factor Tu 1.43e-05 NA 4.36e-05 NA
7. B Q1JFG4 Translation initiation factor IF-2 1.06e-03 NA 8.74e-06 NA
7. B Q2FHG9 Translation initiation factor IF-2 2.40e-05 NA 2.51e-06 NA
7. B B5FA79 Translation initiation factor IF-2 8.07e-05 NA 1.57e-07 NA
7. B Q5GRY3 Elongation factor Tu 2 1.22e-05 NA 3.42e-10 NA
7. B Q21H61 Translation initiation factor IF-2 2.14e-03 NA 1.18e-07 NA
7. B A1T056 Elongation factor Tu 1.45e-05 NA 5.18e-09 NA
7. B Q482Z9 Sulfate adenylyltransferase subunit 1 4.39e-05 NA 2.12e-04 NA
7. B P42472 Elongation factor Tu (Fragment) 7.94e-05 NA 2.75e-06 NA
7. B A1WCN6 Elongation factor Tu 2 1.09e-05 NA 6.22e-11 NA
7. B A9BJ54 Translation initiation factor IF-2 2.58e-05 NA 1.70e-10 NA
7. B A6MVX8 Translation initiation factor IF-2, chloroplastic 2.68e-05 NA 1.22e-07 NA
7. B O31300 Elongation factor Tu (Fragment) 4.83e-05 NA 2.42e-07 NA
7. B B8D7R4 Translation initiation factor IF-2 4.90e-04 NA 1.24e-06 NA
7. B Q6ACZ0 Elongation factor Tu 1.46e-05 NA 7.96e-05 NA
7. B P84317 Elongation factor 1-alpha (Fragment) 1.04e-04 NA 1.01e-04 NA
7. B Q2J2J9 Translation initiation factor IF-2 4.90e-04 NA 5.09e-07 NA
7. B B8D9K1 Sulfate adenylyltransferase subunit 1 5.11e-04 NA 0.002 NA
7. B Q3J5S4 Elongation factor Tu 1.31e-05 NA 6.45e-10 NA
7. B Q4QMT5 Elongation factor Tu 2 1.82e-05 NA 1.25e-08 NA
7. B P57498 Sulfate adenylyltransferase subunit 1 7.68e-04 NA 0.002 NA
7. B Q8ZBP2 Sulfate adenylyltransferase subunit 1 4.17e-05 NA 1.40e-05 NA
7. B P13927 Elongation factor Tu 1.03e-05 NA 1.51e-10 NA
7. B A1JIH3 Elongation factor Tu 1 1.90e-05 NA 3.02e-09 NA
7. B B2SEW7 Translation initiation factor IF-2 1.10e-03 NA 2.97e-06 NA
7. B C0M8P7 Translation initiation factor IF-2 9.72e-04 NA 5.33e-06 NA
7. B P69952 Elongation factor Tu 1.80e-05 NA 4.04e-07 NA
7. B A8GSP4 Translation initiation factor IF-2 5.92e-04 NA 9.45e-05 NA
7. B B5YHT8 Translation initiation factor IF-2 3.36e-05 NA 4.41e-06 NA
7. B B1II49 Translation initiation factor IF-2 1.28e-05 NA 1.67e-08 NA
7. B Q5HVZ7 Elongation factor Tu 1.23e-05 NA 1.26e-08 NA
7. B Q65JI1 Translation initiation factor IF-2 2.41e-05 NA 1.22e-06 NA
7. B A6VNE0 Translation initiation factor IF-2 1.17e-04 NA 7.84e-05 NA
7. B Q8RA37 Translation initiation factor IF-2 2.29e-04 NA 9.43e-07 NA
7. B Q3YWT3 Elongation factor Tu 1 1.87e-05 NA 4.50e-09 NA
7. B A9BCI5 Translation initiation factor IF-2 4.32e-04 NA 9.17e-09 NA
7. B A1SLK7 Translation initiation factor IF-2 1.66e-04 NA 4.62e-06 NA
7. B A4QEZ2 Translation initiation factor IF-2 3.17e-04 NA 1.27e-05 NA
7. B B4TWD8 Translation initiation factor IF-2 5.07e-04 NA 0.026 NA
7. B B7NDF4 Translation initiation factor IF-2 1.51e-04 NA 0.019 NA
7. B A0QIY2 Translation initiation factor IF-2 3.59e-04 NA 8.42e-06 NA
7. B A1VYI6 Elongation factor Tu 1.45e-05 NA 1.26e-08 NA
7. B A7MZI5 Translation initiation factor IF-2 1.43e-04 NA 5.52e-07 NA
7. B A9KD33 Elongation factor Tu 2.63e-05 NA 7.02e-09 NA
7. B Q1MIE3 Elongation factor Tu 1.46e-05 NA 1.20e-10 NA
7. B Q4ZMP2 Elongation factor Tu 2.04e-05 NA 7.65e-08 NA
7. B Q8FPA7 Translation initiation factor IF-2 1.23e-03 NA 8.57e-05 NA
7. B A8GVB2 Elongation factor Tu 1.51e-05 NA 3.33e-12 NA
7. B B7GG75 Translation initiation factor IF-2 1.63e-05 NA 5.55e-08 NA
7. B Q3K302 Translation initiation factor IF-2 8.93e-04 NA 6.71e-06 NA
7. B Q748X8 Elongation factor Tu 1.64e-05 NA 1.38e-10 NA
7. B B7HDT6 Translation initiation factor IF-2 2.14e-05 NA 3.65e-07 NA
7. B B1XGY0 Translation initiation factor IF-2 1.33e-04 NA 0.019 NA
7. B B1MZH4 Translation initiation factor IF-2 3.30e-05 NA 1.57e-06 NA
7. B B0CCD0 Elongation factor Tu 1.29e-05 NA 1.55e-10 NA
7. B B7GJ65 Elongation factor Tu 2.28e-05 NA 1.73e-11 NA
7. B C6C171 Elongation factor Tu 1.61e-05 NA 2.13e-09 NA
7. B Q8P7U7 Translation initiation factor IF-2 3.62e-03 NA 1.80e-07 NA
7. B A8G8E0 Elongation factor Tu 1 1.94e-05 NA 3.98e-09 NA
7. B B5BGJ5 Translation initiation factor IF-2 5.00e-04 NA 0.026 NA
7. B B7LR37 Translation initiation factor IF-2 3.37e-03 NA 0.019 NA
7. B Q8R603 Elongation factor Tu 1.33e-05 NA 6.48e-10 NA
7. B B1AIV8 Translation initiation factor IF-2 9.28e-06 NA 8.38e-08 NA
7. B C1L2N1 Translation initiation factor IF-2 1.94e-05 NA 2.00e-05 NA
7. B B8DAY7 Elongation factor Tu 1.42e-05 NA 5.18e-11 NA
7. B P75590 Translation initiation factor IF-2 2.51e-05 NA 6.16e-08 NA
7. B A0K6X5 Translation initiation factor IF-2 2.39e-04 NA 2.65e-04 NA
7. B Q8YP63 Elongation factor Tu 1.43e-05 NA 6.86e-11 NA
7. B A4VHM8 Elongation factor Tu 2 1.89e-05 NA 1.80e-08 NA
7. B A8EWR6 Sulfate adenylyltransferase subunit 1 6.58e-04 NA 0.001 NA
7. B A1AEU5 Sulfate adenylyltransferase subunit 1 5.01e-04 NA 4.32e-04 NA
7. B Q8IYD1 Eukaryotic peptide chain release factor GTP-binding subunit ERF3B 2.55e-04 NA 0.017 NA
7. B Q1QEP5 Translation initiation factor IF-2 1.92e-04 NA 4.99e-06 NA
7. B A4WEY3 Translation initiation factor IF-2 1.88e-04 NA 0.014 NA
7. B Q9WZN3 Translation initiation factor IF-2 2.01e-05 NA 8.43e-10 NA
7. B Q30SS6 Translation initiation factor IF-2 3.87e-05 NA 9.75e-10 NA
7. B A1BJ36 Elongation factor Tu 1.38e-05 NA 3.03e-11 NA
7. B Q8XZV6 Translation initiation factor IF-2 2.09e-03 NA 3.69e-04 NA
7. B B3PII1 Sulfate adenylyltransferase subunit 1 6.21e-04 NA 1.43e-04 NA
7. B Q3IJV1 Elongation factor Tu 2 1.57e-05 NA 8.60e-10 NA
7. B B4T461 Sulfate adenylyltransferase subunit 1 6.15e-04 NA 6.88e-05 NA
7. B Q46ZP1 Translation initiation factor IF-2 2.57e-04 NA 4.96e-05 NA
7. B Q8TXJ4 Elongation factor 2 3.54e-13 NA 7.53e-49 NA
7. B Q5FCW3 Putative elongation factor Tu-like protein 6.91e-05 NA 9.11e-06 NA
7. B Q0BPG2 Translation initiation factor IF-2 9.20e-04 NA 2.79e-05 NA
7. B B2GBN7 Translation initiation factor IF-2 1.75e-05 NA 3.08e-07 NA
7. B Q6LUJ2 Translation initiation factor IF-2 1.31e-04 NA 3.66e-07 NA
7. B B8GAE2 Translation initiation factor IF-2 2.03e-04 NA 7.71e-06 NA
7. B Q82WD0 Translation initiation factor IF-2 6.44e-05 NA 7.60e-06 NA
7. B Q9R342 Elongation factor Tu 1.62e-05 NA 6.86e-11 NA
7. B A5D2S0 Translation initiation factor IF-2 1.87e-04 NA 1.31e-08 NA
7. B P22679 Elongation factor Tu 1.12e-05 NA 8.41e-10 NA
7. B A3N246 Elongation factor Tu 1.85e-05 NA 6.88e-09 NA
7. B A1VAK4 Elongation factor Tu 1.66e-05 NA 1.04e-09 NA
7. B Q3KI84 Translation initiation factor IF-2 7.83e-04 NA 7.22e-07 NA
7. B A6LPP6 Elongation factor Tu 1.33e-05 NA 2.10e-08 NA
7. B Q31GK5 Translation initiation factor IF-2 4.05e-05 NA 7.38e-04 NA
7. B Q1R5U4 Elongation factor Tu 2 1.77e-05 NA 4.42e-09 NA
7. B Q039K9 Elongation factor Tu 1.25e-05 NA 1.56e-08 NA
7. B C3PPA9 Elongation factor Tu 1.14e-05 NA 1.53e-12 NA
7. B B1LFS0 Translation initiation factor IF-2 1.46e-04 NA 0.019 NA
7. B B6I6E1 Sulfate adenylyltransferase subunit 1 3.79e-04 NA 4.28e-04 NA
7. B B1ICR4 Elongation factor Tu 1.84e-05 NA 2.82e-07 NA
7. B Q0ABH7 Elongation factor Tu 1.37e-05 NA 8.96e-09 NA
7. B Q6MTQ0 Translation initiation factor IF-2 4.75e-05 NA 3.15e-08 NA
7. B B1LBP2 Elongation factor Tu 1.24e-05 NA 3.09e-08 NA
7. B A7MWE9 Sulfate adenylyltransferase subunit 1 1.43e-04 NA 5.42e-04 NA
7. B A4J5X2 Translation initiation factor IF-2 1.42e-04 NA 5.54e-07 NA
7. B O26859 Uncharacterized protein MTH_765 7.80e-03 NA 0.001 NA
7. B P60338 Elongation factor Tu-A 1.23e-05 NA 2.00e-08 NA
7. B A4X4N7 Translation initiation factor IF-2 2.35e-03 NA 7.43e-07 NA
7. B A6TWJ8 Elongation factor Tu 2 1.66e-05 NA 7.92e-07 NA
7. B Q7VLI2 Translation initiation factor IF-2 1.36e-03 NA 2.73e-04 NA
7. B Q0T0B3 Translation initiation factor IF-2 4.83e-04 NA 0.019 NA
7. B B0RU84 Elongation factor Tu 1 1.44e-05 NA 1.71e-08 NA
7. B B8E6N2 Translation initiation factor IF-2 1.23e-04 NA 5.53e-07 NA
7. B P9WKK1 Translation initiation factor IF-2 6.06e-05 NA 6.28e-07 NA
7. B B1MY04 Elongation factor Tu 1.75e-05 NA 2.46e-08 NA
7. B Q03FS3 Translation initiation factor IF-2 8.79e-04 NA 2.34e-07 NA
7. B B3WE38 Elongation factor Tu 1.25e-05 NA 1.56e-08 NA
7. B B1HR05 Translation initiation factor IF-2 3.41e-05 NA 2.64e-07 NA
7. B B5EI57 Translation initiation factor IF-2 1.81e-04 NA 1.55e-05 NA
7. B A6VCK1 Translation initiation factor IF-2 8.63e-05 NA 1.71e-05 NA
7. B B2G6R2 Elongation factor Tu 1.59e-05 NA 1.58e-07 NA
7. B C1FS59 Translation initiation factor IF-2 1.64e-05 NA 1.09e-08 NA
7. B Q6B8S2 Translation initiation factor IF-2, chloroplastic 5.90e-05 NA 5.73e-06 NA
7. B B0KHX8 Translation initiation factor IF-2 8.04e-04 NA 1.66e-06 NA
7. B Q4FVL5 Translation initiation factor IF-2 1.97e-04 NA 5.44e-06 NA
7. B A8FKQ5 Elongation factor Tu 1.49e-05 NA 1.26e-08 NA
7. B A5D5K0 Elongation factor Tu 1 1.62e-05 NA 3.07e-09 NA
7. B A0Q874 Elongation factor Tu 1.57e-05 NA 1.56e-09 NA
7. B P49410 Elongation factor Tu, mitochondrial 2.42e-05 NA 2.89e-07 NA
7. B O78489 Translation initiation factor IF-2, chloroplastic 1.99e-05 NA 1.54e-07 NA
7. B B9KEV0 Translation initiation factor IF-2 1.11e-04 NA 1.09e-07 NA
7. B B8ZRT4 Translation initiation factor IF-2 8.03e-05 NA 3.06e-07 NA
7. B C1AFV3 Translation initiation factor IF-2 6.10e-05 NA 6.28e-07 NA
7. B Q39Y08 Elongation factor Tu 1.61e-05 NA 4.40e-11 NA
7. B O66429 Elongation factor Tu 1.10e-05 NA 3.82e-08 NA
7. B Q9KA77 Translation initiation factor IF-2 1.77e-05 NA 2.67e-08 NA
7. B Q8ZJB2 Elongation factor Tu-A 1.94e-05 NA 4.05e-09 NA
7. B Q6HF02 Translation initiation factor IF-2 3.90e-05 NA 3.29e-07 NA
7. B A8GW31 Translation initiation factor IF-2 6.24e-04 NA 4.33e-05 NA
7. B Q2J728 Translation initiation factor IF-2 2.11e-04 NA 0.009 NA
7. B B1HMZ0 Elongation factor Tu 2.60e-05 NA 1.88e-10 NA
7. B Q1CCT9 Elongation factor Tu 2 1.95e-05 NA 4.05e-09 NA
7. B C4ZZQ5 Sulfate adenylyltransferase subunit 1 1.99e-04 NA 4.03e-04 NA
7. B P42475 Elongation factor Tu 9.18e-06 NA 1.17e-09 NA
7. B P85834 Elongation factor Tu, mitochondrial 9.54e-06 NA 2.51e-07 NA
7. B Q97I51 Translation initiation factor IF-2 4.86e-05 NA 3.48e-07 NA
7. B Q98R05 Translation initiation factor IF-2 4.05e-05 NA 1.23e-11 NA
7. B Q1GVI9 Translation initiation factor IF-2 1.41e-03 NA 1.61e-04 NA
7. B A3N8V8 Translation initiation factor IF-2 2.57e-03 NA 6.89e-04 NA
7. B Q049V5 Translation initiation factor IF-2 7.34e-04 NA 2.91e-08 NA
7. B Q04ZJ5 Translation initiation factor IF-2 4.12e-04 NA 1.10e-04 NA
7. B Q0AUG3 Elongation factor Tu 2 1.21e-05 NA 2.21e-09 NA
7. B B1JDW6 Elongation factor Tu 2.41e-05 NA 7.79e-08 NA
7. B Q31IY4 Elongation factor Tu 1.35e-05 NA 6.39e-11 NA
7. B O60841 Eukaryotic translation initiation factor 5B 5.10e-03 NA 8.93e-05 NA
7. B B5RDQ7 Sulfate adenylyltransferase subunit 1 1.38e-04 NA 8.54e-05 NA
7. B C4Z2R9 Elongation factor Tu 1.31e-05 NA 6.90e-09 NA
7. B A8AVQ2 Translation initiation factor IF-2 1.01e-03 NA 1.72e-06 NA
7. B Q6G9U4 Translation initiation factor IF-2 1.90e-05 NA 2.55e-06 NA
7. B Q83HG7 Translation initiation factor IF-2 5.82e-04 NA 4.25e-07 NA
7. B Q57JH9 Translation initiation factor IF-2 1.73e-04 NA 0.026 NA
7. B Q9HV55 Translation initiation factor IF-2 8.97e-05 NA 1.76e-05 NA
7. B P68158 Elongation factor Tu, chloroplastic 2.46e-05 NA 1.44e-10 NA
7. B A9VT50 Translation initiation factor IF-2 3.75e-05 NA 5.02e-07 NA
7. B Q2IXR2 Elongation factor Tu 1.35e-05 NA 2.84e-11 NA
7. B Q5L3Z9 Elongation factor Tu 1.26e-05 NA 1.21e-10 NA
7. B P13442 Bifunctional enzyme NodQ 5.69e-04 NA 0.005 NA
7. B Q73PN3 Elongation factor Tu 2.90e-05 NA 6.03e-11 NA
7. B Q2GFN6 Elongation factor Tu 1.86e-05 NA 1.79e-05 NA
7. B P33171 Elongation factor Tu 1.19e-05 NA 7.28e-10 NA
7. B A8ANW5 Sulfate adenylyltransferase subunit 1 5.20e-04 NA 4.84e-05 NA
7. B B3ELN8 Translation initiation factor IF-2 5.00e-04 NA 0.003 NA
7. B C0MDY5 Translation initiation factor IF-2 1.03e-03 NA 6.49e-06 NA
7. B Q5HB61 Translation initiation factor IF-2 2.68e-05 NA 5.26e-04 NA
7. B Q5XAH1 Translation initiation factor IF-2 1.01e-03 NA 8.74e-06 NA
7. B Q4L3K9 Elongation factor Tu 1.05e-05 NA 1.07e-09 NA
7. B A4FM34 Translation initiation factor IF-2 1.01e-04 NA 2.11e-06 NA
7. B A5W987 Translation initiation factor IF-2 8.25e-04 NA 1.79e-06 NA
7. B Q9KU80 Translation initiation factor IF-2 1.59e-04 NA 9.63e-07 NA
7. B Q6YR66 Translation initiation factor IF-2 7.99e-05 NA 1.52e-05 NA
7. B Q0TA85 Elongation factor Tu 2 1.88e-05 NA 4.42e-09 NA
7. B B0UV21 Elongation factor Tu 1.80e-05 NA 1.07e-08 NA
7. B Q6MMS6 Translation initiation factor IF-2 1.20e-03 NA 1.60e-05 NA
7. B B6JET1 Elongation factor Tu 1.31e-05 NA 4.21e-11 NA
7. B Q06SH3 Elongation factor Tu, chloroplastic 7.56e-06 NA 1.90e-11 NA
7. B Q8R5Z1 Translation initiation factor IF-2 1.48e-05 NA 1.34e-06 NA
7. B A5ISF3 Translation initiation factor IF-2 1.78e-05 NA 2.62e-06 NA
7. B A5VXN3 Elongation factor Tu 2.29e-05 NA 7.79e-08 NA
7. B Q6AP86 Elongation factor Tu 1 1.56e-05 NA 1.46e-10 NA
7. B C1CUQ9 Translation initiation factor IF-2 8.26e-05 NA 0.005 NA
7. B Q07V78 Translation initiation factor IF-2 1.90e-03 NA 1.16e-06 NA
7. B Q3IUD8 Elongation factor 1-alpha 1.01e-04 NA 4.01e-13 NA
7. B Q1MQY8 Translation initiation factor IF-2 1.18e-03 NA 4.22e-05 NA
7. B P59587 Translation initiation factor IF-2 1.86e-04 NA 0.019 NA
7. B P25038 Translation initiation factor IF-2, mitochondrial 2.76e-04 NA 8.93e-04 NA
7. B Q250N4 Elongation factor Tu 1.44e-05 NA 8.14e-11 NA
7. B P44323 Translation initiation factor IF-2 1.24e-03 NA 4.18e-04 NA
7. B Q0BFY3 Translation initiation factor IF-2 2.29e-04 NA 4.23e-04 NA
7. B Q2S1N7 Translation initiation factor IF-2 2.03e-03 NA 0.003 NA
7. B A6T0Y8 Translation initiation factor IF-2 2.43e-03 NA 1.54e-05 NA
7. B Q9Y450 HBS1-like protein 4.13e-04 NA 3.74e-04 NA
7. B B9IZJ2 Elongation factor Tu 1.21e-05 NA 7.66e-11 NA
7. B Q57KJ0 Sulfate adenylyltransferase subunit 1 5.94e-04 NA 4.24e-05 NA
7. B Q1CN86 Elongation factor Tu 1 1.68e-05 NA 4.42e-09 NA
7. B P02991 Elongation factor Tu, chloroplastic 9.74e-06 NA 6.44e-10 NA
7. B B5XHV3 Translation initiation factor IF-2 1.02e-03 NA 7.12e-06 NA
7. B B3R1E4 Translation initiation factor IF-2 7.95e-04 NA 6.14e-05 NA
7. B Q3AHW1 Translation initiation factor IF-2 4.07e-04 NA 2.84e-07 NA
7. B Q7MGR1 Elongation factor Tu 2 1.54e-05 NA 2.36e-09 NA
7. B Q7UZY7 Elongation factor Tu 8.46e-06 NA 5.37e-08 NA
7. B B1IA80 Translation initiation factor IF-2 1.04e-03 NA 6.57e-07 NA
7. B A1WXV1 Translation initiation factor IF-2 1.14e-03 NA 3.68e-07 NA
7. B B6YQ04 Elongation factor Tu 1.27e-05 NA 8.91e-11 NA
7. B C1DFK9 Translation initiation factor IF-2 8.93e-05 NA 9.17e-07 NA
7. B Q9Z5I9 Translation initiation factor IF-2 6.17e-05 NA 3.06e-07 NA
7. B B2VG01 Sulfate adenylyltransferase subunit 1 1.24e-04 NA 1.45e-04 NA
7. B B4T6Z8 Translation initiation factor IF-2 9.88e-05 NA 0.027 NA
7. B P65133 Translation initiation factor IF-2 2.32e-05 NA 2.62e-06 NA
7. B Q5PIW4 Elongation factor Tu 1.91e-05 NA 4.42e-09 NA
7. B Q65SK9 Translation initiation factor IF-2 1.13e-04 NA 7.10e-05 NA
7. B O74718 Eukaryotic peptide chain release factor GTP-binding subunit 3.89e-04 NA 0.002 NA
7. B A6LLL1 Elongation factor Tu 2.74e-05 NA 3.28e-10 NA
7. B Q0ID59 Elongation factor Tu 1.05e-05 NA 2.07e-08 NA
7. B Q69ZS7 HBS1-like protein 4.19e-04 NA 6.04e-04 NA
7. B B7HJ46 Elongation factor Tu 1.23e-05 NA 7.87e-11 NA
7. B A9MT05 Elongation factor Tu 1.92e-05 NA 4.42e-09 NA
7. B A7NS01 Elongation factor Tu 2 1.49e-05 NA 5.36e-08 NA
7. B A8Z3U9 Translation initiation factor IF-2 2.57e-06 NA 2.51e-06 NA
7. B C0QTL9 Translation initiation factor IF-2 4.88e-05 NA 2.60e-08 NA
7. B A0Q8F3 Translation initiation factor IF-2 1.52e-05 NA 3.02e-06 NA
7. B A1AIF3 Elongation factor Tu 2 1.85e-05 NA 4.42e-09 NA
7. B A5FJF9 Translation initiation factor IF-2 8.68e-04 NA 8.26e-05 NA
7. B Q6MU81 Elongation factor Tu 1.23e-05 NA 5.90e-10 NA
7. B Q5HRK4 Elongation factor Tu 1.07e-05 NA 9.74e-10 NA
7. B B2IME4 Translation initiation factor IF-2 9.80e-04 NA 7.41e-07 NA
7. B B6YW69 Translation initiation factor 2 subunit gamma 3.40e-05 NA 0.006 NA
7. B A9BCK0 Elongation factor Tu 8.62e-06 NA 1.85e-08 NA
7. B A2SH40 Translation initiation factor IF-2 1.05e-03 NA 1.66e-05 NA
7. B A5USJ1 Elongation factor Tu 1 1.50e-05 NA 6.74e-08 NA
7. B B1XI09 Translation initiation factor IF-2 1.59e-04 NA 1.87e-08 NA
7. B A4IXZ5 Sulfate adenylyltransferase subunit 1 2.57e-04 NA 2.74e-05 NA
7. B A9ITX6 Translation initiation factor IF-2 1.97e-03 NA 1.46e-04 NA
7. B Q8G3Y5 Translation initiation factor IF-2 2.47e-04 NA 1.19e-05 NA
7. B Q5WLR4 Elongation factor Tu 2.49e-05 NA 8.76e-10 NA
7. B A6LE88 Elongation factor Tu 2.40e-05 NA 1.69e-10 NA
7. B Q28WF7 Translation initiation factor IF-2 5.20e-04 NA 4.11e-07 NA
7. B A2BYN4 Elongation factor Tu 9.13e-06 NA 3.31e-08 NA
7. B Q31XB3 Sulfate adenylyltransferase subunit 1 2.29e-04 NA 4.17e-04 NA
7. B A8F4Q9 Elongation factor Tu 1.32e-05 NA 1.36e-08 NA
7. B Q8CST4 Translation initiation factor IF-2 2.17e-05 NA 3.79e-07 NA
7. B Q07KJ2 Elongation factor Tu 1.31e-05 NA 2.16e-11 NA
7. B Q49X54 Translation initiation factor IF-2 1.79e-05 NA 1.67e-06 NA
7. B Q3YRK7 Elongation factor Tu 1.80e-05 NA 2.05e-05 NA
7. B B4RTW4 Sulfate adenylyltransferase subunit 1 5.51e-04 NA 2.86e-04 NA
7. B B2SFC9 Elongation factor Tu 2.90e-05 NA 1.56e-09 NA
7. B B3EUG6 Translation initiation factor IF-2 8.22e-04 NA 1.38e-06 NA
7. B Q9TLV8 Elongation factor Tu, chloroplastic 1.26e-05 NA 2.03e-08 NA
7. B Q8PJ55 Translation initiation factor IF-2 2.34e-03 NA 4.63e-08 NA
7. B Q74IS8 Translation initiation factor IF-2 6.35e-04 NA 2.94e-07 NA
7. B Q8Y422 Elongation factor Tu 1.44e-05 NA 1.72e-10 NA
7. B A5ELM9 Elongation factor Tu 1.28e-05 NA 2.82e-12 NA
7. B A5FQQ5 Elongation factor Tu 1.09e-05 NA 4.64e-06 NA
7. B Q9KUZ6 Elongation factor Tu-B 1.54e-05 NA 4.97e-10 NA
7. B Q30TQ5 Elongation factor Tu 1.57e-05 NA 6.12e-10 NA
7. B Q8UE16 Elongation factor Tu 1.29e-05 NA 2.16e-10 NA
7. B A6T3K6 Elongation factor Tu 1.32e-05 NA 7.98e-11 NA
7. B B1XY67 Translation initiation factor IF-2 1.37e-03 NA 5.59e-04 NA
7. B A1AMM1 Translation initiation factor IF-2 3.98e-05 NA 5.05e-06 NA
7. B Q8D2X6 Translation initiation factor IF-2 7.34e-04 NA 6.41e-06 NA
7. B A5VR08 Elongation factor Tu 1.43e-05 NA 6.69e-11 NA
7. B Q8DK04 Translation initiation factor IF-2 8.61e-05 NA 2.92e-07 NA
7. B Q6GHG6 Translation initiation factor IF-2 1.64e-05 NA 2.64e-06 NA
7. B Q030K2 Translation initiation factor IF-2 7.41e-05 NA 6.31e-06 NA
7. B A5VTB2 Translation initiation factor IF-2 8.81e-04 NA 6.66e-06 NA
7. B Q0AFJ3 Translation initiation factor IF-2 2.44e-04 NA 1.81e-04 NA
7. B B8DLL9 Elongation factor Tu 1.81e-05 NA 6.49e-09 NA
7. B Q02FS8 Translation initiation factor IF-2 9.31e-05 NA 1.80e-05 NA
7. B P0A6N3 Elongation factor Tu 1.83e-05 NA 4.42e-09 NA
7. B B0K9Q0 Translation initiation factor IF-2 2.29e-04 NA 2.42e-06 NA
7. B Q9UZK7 Probable translation initiation factor IF-2 1.19e-02 NA 0.016 NA
7. B B8DG02 Translation initiation factor IF-2 8.29e-05 NA 4.75e-06 NA
7. B Q0T1I2 Sulfate adenylyltransferase subunit 1 3.04e-04 NA 4.25e-04 NA
7. B Q3B1Z8 Translation initiation factor IF-2 4.74e-04 NA 7.77e-05 NA
7. B B0K1D6 Translation initiation factor IF-2 1.39e-04 NA 2.20e-06 NA
7. B Q8XJR8 Translation initiation factor IF-2 1.63e-05 NA 1.78e-07 NA
7. B B7IT17 Elongation factor Tu 1.04e-05 NA 8.76e-11 NA
7. B Q5M5I8 Elongation factor Tu 2.03e-05 NA 9.56e-08 NA
7. B Q7TT91 Elongation factor Tu 1.51e-05 NA 1.37e-10 NA
7. B A1ST27 Sulfate adenylyltransferase subunit 1 1.57e-04 NA 1.63e-04 NA
7. B B9LBJ2 Translation initiation factor IF-2 3.55e-04 NA 9.51e-06 NA
7. B Q9TMM9 Elongation factor Tu, apicoplast 2.70e-05 NA 1.13e-07 NA
7. B Q4URD7 Elongation factor Tu 1 1.45e-05 NA 1.68e-08 NA
7. B Q3J9B6 Translation initiation factor IF-2 7.69e-05 NA 1.25e-05 NA
7. B Q2JMX7 Elongation factor Tu 1.11e-05 NA 7.50e-07 NA
7. B Q10251 Eukaryotic translation initiation factor 5B 1.61e-03 NA 2.62e-04 NA
7. B Q8YQJ1 Translation initiation factor IF-2 2.62e-04 NA 4.01e-08 NA
7. B A7ZS65 Translation initiation factor IF-2 1.49e-04 NA 0.019 NA
7. B A4IW92 Elongation factor Tu 1.56e-05 NA 1.56e-09 NA
7. B A4VXH3 Translation initiation factor IF-2 9.62e-04 NA 7.37e-07 NA
7. B Q2G8Y2 Elongation factor Tu 1.04e-05 NA 1.03e-10 NA
7. B A0AIC6 Translation initiation factor IF-2 2.09e-05 NA 2.14e-05 NA
7. B A4IMD7 Translation initiation factor IF-2 4.34e-05 NA 2.12e-07 NA
7. B Q46WC7 Elongation factor Tu 1.19e-05 NA 8.96e-11 NA
7. B B4S4S6 Translation initiation factor IF-2 5.56e-04 NA 0.002 NA
7. B A7HM54 Elongation factor Tu 1.11e-05 NA 3.07e-08 NA
7. B Q5LIN1 Translation initiation factor IF-2 1.20e-03 NA 5.03e-04 NA
7. B B0S1E5 Translation initiation factor IF-2 8.20e-05 NA 1.66e-07 NA
7. B Q1IF43 Translation initiation factor IF-2 8.23e-04 NA 1.80e-06 NA
7. B Q1JCT6 Elongation factor Tu 2.36e-05 NA 1.24e-05 NA
7. B B0CK11 Translation initiation factor IF-2 1.43e-04 NA 7.19e-06 NA
7. B Q04U31 Translation initiation factor IF-2 3.88e-04 NA 1.13e-04 NA
7. B B1L7T1 Translation initiation factor IF-2 1.67e-05 NA 8.65e-10 NA
7. B Q661E5 Elongation factor Tu 1.23e-05 NA 6.44e-11 NA
7. B Q0AK69 Translation initiation factor IF-2 6.09e-04 NA 0.007 NA
7. B Q1C2U1 Elongation factor Tu 1 1.93e-05 NA 4.05e-09 NA
7. B B1IUS8 Sulfate adenylyltransferase subunit 1 4.60e-04 NA 4.10e-04 NA
7. B A5VCZ5 Translation initiation factor IF-2 6.14e-04 NA 3.00e-05 NA
7. B A6QBQ5 Translation initiation factor IF-2 8.93e-05 NA 2.94e-06 NA
7. B P23081 Elongation factor G (Fragment) 3.19e-01 NA 3.41e-19 NA
7. B A8IG20 Translation initiation factor IF-2 2.01e-03 NA 1.06e-05 NA
7. B C3LSP8 Translation initiation factor IF-2 1.25e-04 NA 9.63e-07 NA
7. B Q3APH1 Elongation factor Tu 1.47e-05 NA 1.04e-10 NA
7. B Q3MBZ7 Translation initiation factor IF-2 6.01e-04 NA 3.50e-08 NA
7. B B6ELP3 Sulfate adenylyltransferase subunit 1 8.68e-05 NA 1.01e-04 NA
7. B A0JUU0 Translation initiation factor IF-2 9.86e-05 NA 2.10e-07 NA
7. B A1TSK3 Translation initiation factor IF-2 1.45e-03 NA 0.001 NA
7. B Q1J7N4 Elongation factor Tu 1.85e-05 NA 4.33e-07 NA
7. B Q732Q9 Translation initiation factor IF-2 1.24e-05 NA 3.55e-07 NA
7. B Q30WJ0 Translation initiation factor IF-2 1.83e-03 NA 7.58e-05 NA
7. B A8GNW1 Translation initiation factor IF-2 6.07e-04 NA 1.87e-04 NA
7. B A7NEI8 Translation initiation factor IF-2 1.21e-03 NA 3.29e-06 NA
7. B Q8BFR5 Elongation factor Tu, mitochondrial 9.42e-06 NA 2.58e-07 NA
7. B B0UU13 Translation initiation factor IF-2 1.29e-03 NA 4.55e-04 NA
7. B Q01SX2 Elongation factor Tu 1.62e-05 NA 3.59e-08 NA
7. B P15170 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A 7.98e-05 NA 0.040 NA
7. B B2GUV7 Eukaryotic translation initiation factor 5B 4.68e-03 NA 1.20e-04 NA
7. B Q5M101 Elongation factor Tu 2.01e-05 NA 9.56e-08 NA
7. B Q1GXD6 Translation initiation factor IF-2 1.89e-04 NA 2.43e-04 NA
7. B P17245 Elongation factor Tu, cyanelle 1.21e-05 NA 1.36e-06 NA
7. B P32769 Elongation factor 1 alpha-like protein 5.74e-04 NA 5.05e-05 NA
7. B Q5QTY8 Translation initiation factor IF-2 1.26e-04 NA 2.38e-06 NA
7. B Q6KI66 Elongation factor Tu 1.16e-05 NA 3.00e-10 NA
7. B P48865 Elongation factor Tu 1.18e-05 NA 4.99e-12 NA
7. B A4XZ92 Elongation factor Tu 1.89e-05 NA 2.15e-08 NA
7. B B7UHH0 Sulfate adenylyltransferase subunit 1 4.55e-04 NA 4.28e-04 NA
7. B Q8DBW0 Translation initiation factor IF-2 2.03e-04 NA 4.79e-07 NA
7. B Q1LI13 Elongation factor Tu 2.56e-05 NA 9.53e-11 NA
7. B Q92GW4 Elongation factor Tu 1.15e-05 NA 4.48e-12 NA
7. B B5FTS9 Sulfate adenylyltransferase subunit 1 6.18e-04 NA 1.20e-04 NA
7. B Q8KFT1 Translation initiation factor IF-2 4.95e-04 NA 0.002 NA
7. B A5UBT6 Translation initiation factor IF-2 1.14e-03 NA 4.22e-04 NA
7. B P72339 Bifunctional enzyme NodQ 3.19e-04 NA 5.53e-04 NA
7. B A2BT83 Elongation factor Tu 8.43e-06 NA 3.65e-08 NA
7. B P64025 Elongation factor Tu 1.42e-05 NA 6.69e-11 NA
7. B Q5X873 Elongation factor Tu 3.51e-05 NA 5.38e-10 NA
7. B B4RXT8 Translation initiation factor IF-2 1.37e-03 NA 1.29e-07 NA
7. B P29544 Elongation factor Tu-3 6.01e-06 NA 9.46e-07 NA
7. B A1TYJ5 Elongation factor Tu 1.68e-05 NA 3.87e-09 NA
7. B Q17WQ8 Translation initiation factor IF-2 1.13e-03 NA 7.16e-06 NA
7. B A1AGM6 Elongation factor Tu 1 1.91e-05 NA 4.50e-09 NA
7. B Q7MXE4 Translation initiation factor IF-2 1.33e-03 NA 1.03e-04 NA
7. B A0LHL8 Translation initiation factor IF-2 1.34e-03 NA 3.33e-04 NA
7. B B2USN4 Translation initiation factor IF-2 1.57e-04 NA 1.04e-05 NA
7. B Q8R7V2 Elongation factor Tu-A 1.19e-05 NA 1.12e-08 NA
7. B Q5L0I8 Translation initiation factor IF-2 1.38e-05 NA 3.87e-07 NA
7. B B0TQA2 Translation initiation factor IF-2 5.52e-04 NA 6.38e-07 NA
7. B A7GG06 Translation initiation factor IF-2 2.18e-05 NA 5.33e-08 NA
7. B P29543 Elongation factor Tu-2 1.34e-05 NA 4.25e-07 NA
7. B Q4A597 Elongation factor Tu 9.80e-06 NA 2.20e-09 NA
7. B A1KMI2 Translation initiation factor IF-2 2.74e-05 NA 6.28e-07 NA
7. B Q814C4 Elongation factor Tu 1.23e-05 NA 7.87e-11 NA
7. B Q3AQK7 Translation initiation factor IF-2 8.70e-04 NA 0.001 NA
7. B B7NT95 Sulfate adenylyltransferase subunit 1 2.21e-04 NA 4.03e-04 NA
7. B P48515 Translation initiation factor IF-2 7.96e-05 NA 2.07e-05 NA