Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54647.1
JCVISYN3A_0164
Uncharacterized protein.
M. mycoides homolog: Q6MU62.
TIGRfam Classification: 1=Unknown.
Category: Quasiessential.
Statistics
Total GO Annotation: 35
Unique PROST Go: 35
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 90
Unique PROST Homologs: 90
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
P59841
(Fumarate reductase subunit C) with a FATCAT P-Value: 2.51e-06 and RMSD of 1.18 angstrom. The sequence alignment identity is 21.1%.
Structural alignment shown in left. Query protein AVX54647.1 colored as red in alignment, homolog P59841 colored as blue.
Query protein AVX54647.1 is also shown in right top, homolog P59841 showed in right bottom. They are colored based on secondary structures.
AVX54647.1 M-KKSKVF-KELKDIDKFTKEQHEKQVNKSISQVYDSDDFKMNFYDYQQAKKLRLIGWLIVFLIFIIGSLIGVLVGYLTLNVSSLDNWKGINYF-NVLYT 97 P59841 MTTKRKAYVREMK-ANWWTK------L----------DFYRM--YMIREATCIATI-W---F------CLV-LLYGVISLGGRHIENF--ISFSQNPL-V 67 AVX54647.1 TILFFIGFIIGVIKNRQATKFFNDRRRRYQKTLELSEAKL---IRLKKIFY-LSGLLMLVLTIILFLVFKI 164 P59841 VILNIIS-LAGLL-YHAATLYV---MTPQVLTIVVKNERLNPNI-LKNALWAITGLVSLLALVLVYI---- 128
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0070584 | mitochondrion morphogenesis |
| 5. P | GO:0031305 | integral component of mitochondrial inner membrane |
| 5. P | GO:0018279 | protein N-linked glycosylation via asparagine |
| 5. P | GO:0009535 | chloroplast thylakoid membrane |
| 5. P | GO:0097250 | mitochondrial respirasome assembly |
| 5. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 5. P | GO:0006915 | apoptotic process |
| 5. P | GO:0045050 | protein insertion into ER membrane by stop-transfer membrane-anchor sequence |
| 5. P | GO:0008250 | oligosaccharyltransferase complex |
| 5. P | GO:0030094 | plasma membrane-derived photosystem I |
| 5. P | GO:0009538 | photosystem I reaction center |
| 5. P | GO:0048489 | synaptic vesicle transport |
| 5. P | GO:0005746 | mitochondrial respirasome |
| 5. P | GO:0031647 | regulation of protein stability |
| 5. P | GO:0042775 | mitochondrial ATP synthesis coupled electron transport |
| 5. P | GO:0004129 | cytochrome-c oxidase activity |
| 5. P | GO:0015097 | mercury ion transmembrane transporter activity |
| 5. P | GO:0006487 | protein N-linked glycosylation |
| 5. P | GO:0001824 | blastocyst development |
| 5. P | GO:0006106 | fumarate metabolic process |
| 5. P | GO:0031676 | plasma membrane-derived thylakoid membrane |
| 5. P | GO:0045284 | plasma membrane fumarate reductase complex |
| 5. P | GO:0000104 | succinate dehydrogenase activity |
| 5. P | GO:0043066 | negative regulation of apoptotic process |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0007584 | response to nutrient |
| 5. P | GO:0071816 | tail-anchored membrane protein insertion into ER membrane |
| 5. P | GO:0072546 | EMC complex |
| 5. P | GO:0007005 | mitochondrion organization |
| 5. P | GO:0042493 | |
| 5. P | GO:0015979 | photosynthesis |
| 5. P | GO:0009061 | anaerobic respiration |
| 5. P | GO:0008047 | enzyme activator activity |
| 5. P | GO:0006486 | protein glycosylation |
| 5. P | GO:0007007 | inner mitochondrial membrane organization |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | B6EMS0 | Fumarate reductase subunit C | 1.22e-04 | 3.20e-04 | NA | NA |
| 5. P | P37277 | Photosystem I reaction center subunit XI | 2.28e-04 | 2.06e-04 | NA | NA |
| 5. P | A8G719 | Photosystem I reaction center subunit XI | 1.16e-03 | 5.51e-04 | NA | NA |
| 5. P | P61804 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 1.33e-04 | 1.46e-02 | NA | NA |
| 5. P | A0T0U5 | Photosystem I reaction center subunit XI | 1.39e-04 | 1.82e-04 | NA | NA |
| 5. P | O78469 | Photosystem I reaction center subunit XI | 2.92e-04 | 5.51e-04 | NA | NA |
| 5. P | Q9CP58 | Fumarate reductase subunit C | 6.63e-05 | 8.81e-07 | NA | NA |
| 5. P | Q5R8X3 | Transmembrane protein 230 | 2.72e-03 | 3.95e-02 | NA | NA |
| 5. P | Q4G3B5 | Photosystem I reaction center subunit XI | 2.70e-04 | 3.84e-03 | NA | NA |
| 5. P | P44892 | Fumarate reductase subunit C | 3.33e-05 | 1.22e-03 | NA | NA |
| 5. P | Q8DGB4 | Photosystem I reaction center subunit XI | 2.55e-04 | 3.36e-03 | NA | NA |
| 5. P | Q9BU79 | Transmembrane protein 243 | 3.66e-05 | 2.40e-04 | NA | NA |
| 5. P | P61805 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 1.32e-04 | 1.46e-02 | NA | NA |
| 5. P | P51273 | Uncharacterized protein ycf36 | 6.89e-05 | 4.88e-02 | NA | NA |
| 5. P | P58577 | Photosystem I reaction center subunit XI | 7.49e-04 | 1.91e-08 | NA | NA |
| 5. P | Q8DCX4 | Fumarate reductase subunit D | 4.37e-04 | 6.27e-03 | NA | NA |
| 5. P | Q45130 | Uncharacterized protein BpOF4_21044 | 2.03e-04 | 4.54e-07 | NA | NA |
| 5. P | A2BYP5 | Photosystem I reaction center subunit XI | 2.05e-03 | 2.94e-03 | NA | NA |
| 5. P | O31872 | SPbeta prophage-derived uncharacterized membrane protein YosW | 2.33e-04 | 3.58e-08 | NA | NA |
| 5. P | Q9TM17 | Photosystem I reaction center subunit XI | 3.09e-04 | 2.13e-04 | NA | NA |
| 5. P | Q9M3T9 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 5.77e-05 | 6.99e-05 | NA | NA |
| 5. P | P46141 | Inner membrane protein YgbE | 1.50e-04 | 3.36e-04 | NA | NA |
| 5. P | Q8DCX3 | Fumarate reductase subunit C | 1.11e-04 | 7.68e-05 | NA | NA |
| 5. P | P94700 | Mercuric transport protein MerT | 1.11e-04 | 1.64e-02 | NA | NA |
| 5. P | P46967 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 | 8.96e-05 | 2.48e-02 | NA | NA |
| 5. P | P49486 | Photosystem I reaction center subunit XI | 1.87e-04 | 1.51e-05 | NA | NA |
| 5. P | Q1ZXH4 | ER membrane protein complex subunit 6 | 6.95e-05 | 1.22e-03 | NA | NA |
| 5. P | O31126 | Photosystem I reaction center subunit XI | 1.18e-03 | 1.29e-09 | NA | NA |
| 5. P | O94596 | Putative uncharacterized membrane protein C622.06c | 7.61e-06 | 2.83e-03 | NA | NA |
| 5. P | P61803 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 1.04e-04 | 1.46e-02 | NA | NA |
| 5. P | A0JNK6 | Transmembrane protein 243 | 8.78e-05 | 5.50e-03 | NA | NA |
| 5. P | B2J591 | Photosystem I reaction center subunit XI | 5.81e-04 | 4.25e-08 | NA | NA |
| 5. P | P31084 | Photosystem I reaction center subunit XI | 1.56e-03 | 1.39e-02 | NA | NA |
| 5. P | A2XSY1 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 8.84e-05 | 2.83e-03 | NA | NA |
| 5. P | P46964 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 | 8.25e-06 | 3.85e-07 | NA | NA |
| 5. P | P81311 | Uncharacterized protein MJ0703.1 | 2.04e-06 | 9.33e-04 | NA | NA |
| 5. P | A9BCL5 | Photosystem I reaction center subunit XI | 6.34e-04 | 2.22e-08 | NA | NA |
| 5. P | Q7MZY2 | Fumarate reductase subunit C | 2.60e-05 | 4.30e-03 | NA | NA |
| 5. P | P31092 | Photosystem I reaction center subunit XI | 8.41e-04 | 2.67e-10 | NA | NA |
| 5. P | Q54FB6 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 | 1.27e-04 | 8.62e-04 | NA | NA |
| 5. P | Q6B8P4 | Photosystem I reaction center subunit XI | 2.11e-04 | 3.11e-03 | NA | NA |
| 5. P | Q7MGX5 | Fumarate reductase subunit C | 6.84e-05 | 7.68e-05 | NA | NA |
| 5. P | Q8IQ56 | Transmembrane protein 11 homolog, mitochondrial | 1.73e-04 | 2.57e-02 | NA | NA |
| 5. P | Q04452 | Cytochrome c oxidase subunit 4B | 2.95e-04 | 2.52e-03 | NA | NA |
| 5. P | P25902 | Photosystem I reaction center subunit XI | 3.05e-04 | 3.30e-04 | NA | NA |
| 5. P | P95822 | Photosystem I reaction center subunit XI | 1.39e-03 | 1.26e-02 | NA | NA |
| 5. P | Q9ZRA3 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 5.34e-06 | 6.89e-03 | NA | NA |
| 5. P | P61806 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 1.35e-04 | 1.46e-02 | NA | NA |
| 5. P | Q116L4 | Photosystem I reaction center subunit XI | 2.62e-04 | 4.42e-04 | NA | NA |
| 5. P | O83109 | Uncharacterized protein TP_0070 | 5.32e-05 | 8.94e-03 | NA | NA |
| 5. P | Q5ENP6 | Photosystem I reaction center subunit XI | 3.60e-04 | 1.62e-06 | NA | NA |
| 5. P | Q9SME8 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 | 1.01e-04 | 3.66e-03 | NA | NA |
| 5. P | Q7MGX4 | Fumarate reductase subunit D | 4.26e-04 | 7.35e-03 | NA | NA |
| 5. P | P24013 | Cytochrome c oxidase subunit 4B | 1.12e-05 | 5.41e-07 | NA | NA |
| 5. P | A8G8T5 | Fumarate reductase subunit C | 4.29e-05 | 8.62e-04 | NA | NA |
| 5. P | Q1XDL3 | Uncharacterized protein ycf36 | 7.12e-05 | 4.79e-02 | NA | NA |
| 5. P | C3LS87 | Fumarate reductase subunit C | 6.65e-05 | 1.41e-03 | NA | NA |
| 5. P | O87787 | Photosystem I reaction center subunit XI | 1.32e-03 | 9.74e-06 | NA | NA |
| 5. P | Q9CQT9 | Respirasome Complex Assembly Factor 1 | 7.72e-04 | 6.40e-04 | NA | NA |
| 5. P | B1WPZ7 | Photosystem I reaction center subunit XI | 4.22e-04 | 4.46e-04 | NA | NA |
| 5. P | Q9SMC4 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 4.03e-06 | 4.33e-07 | NA | NA |
| 5. P | P59841 | Fumarate reductase subunit C | 2.51e-06 | 6.26e-06 | NA | NA |
| 5. P | Q39080 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 3.78e-05 | 3.11e-03 | NA | NA |
| 5. P | Q0JDK9 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 9.60e-05 | 2.83e-03 | NA | NA |
| 5. P | Q7UZX6 | Photosystem I reaction center subunit XI | 1.13e-03 | 4.59e-02 | NA | NA |
| 5. P | Q87KY1 | Fumarate reductase subunit D | 3.96e-04 | 1.84e-02 | NA | NA |
| 5. P | Q85FP8 | Photosystem I reaction center subunit XI | 3.50e-04 | 4.36e-08 | NA | NA |
| 5. P | Q7NIE7 | Photosystem I reaction center subunit XI | 1.26e-03 | 7.14e-04 | NA | NA |
| 5. P | A0T0M6 | Photosystem I reaction center subunit XI | 1.66e-04 | 1.26e-04 | NA | NA |
| 5. P | Q6LM13 | Fumarate reductase subunit C | 5.58e-05 | 1.25e-02 | NA | NA |
| 5. P | O24060 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 3.71e-05 | 2.29e-07 | NA | NA |
| 5. P | Q9KNS3 | Fumarate reductase subunit C | 6.90e-05 | 1.41e-03 | NA | NA |
| 5. P | Q9VLM5 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 9.32e-05 | 2.77e-04 | NA | NA |
| 5. P | Q54753 | Photosystem I reaction center subunit XI | 3.78e-04 | 5.66e-06 | NA | NA |
| 5. P | Q5E2B5 | Fumarate reductase subunit C | 1.25e-04 | 1.07e-04 | NA | NA |
| 5. P | Q87KY2 | Fumarate reductase subunit C | 1.09e-04 | 4.10e-03 | NA | NA |
| 5. P | Q9ZWQ7 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 2.28e-05 | 1.30e-04 | NA | NA |
| 5. P | B8HRF0 | Photosystem I reaction center subunit XI | 8.71e-04 | 1.39e-07 | NA | NA |
| 5. P | Q03440 | Cytochrome c oxidase subunit 4B | 7.57e-05 | 3.39e-03 | NA | NA |
| 5. P | P52872 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 | 4.86e-05 | 1.27e-03 | NA | NA |
| 5. P | B7VHR5 | Fumarate reductase subunit C | 6.13e-05 | 1.42e-02 | NA | NA |
| 5. P | Q6NWH5 | Transmembrane protein 11, mitochondrial | 3.65e-04 | 2.33e-05 | NA | NA |
| 5. P | Q9SME9 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 1.61e-04 | 7.21e-03 | NA | NA |
| 5. P | O65085 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | 2.41e-05 | 2.98e-04 | NA | NA |
| 5. P | A7MZ43 | Fumarate reductase subunit C | 8.81e-05 | 6.15e-03 | NA | NA |
| 5. P | A3PF09 | Photosystem I reaction center subunit XI | 1.97e-03 | 5.87e-03 | NA | NA |
| 5. P | A5F4Z1 | Fumarate reductase subunit C | 6.62e-05 | 1.41e-03 | NA | NA |
| 5. P | A9QYP6 | Fumarate reductase subunit C | 4.22e-05 | 1.78e-02 | NA | NA |
| 5. P | B5FBS7 | Fumarate reductase subunit C | 8.59e-05 | 1.07e-04 | NA | NA |
| 5. P | O22622 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 | 3.95e-05 | 3.73e-03 | NA | NA |