Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54648.1
JCVISYN3A_0165
Oligopeptide ABC transporter permease.
M. mycoides homolog: Q6MU61.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 70
Unique PROST Go: 36
Unique BLAST Go: 0
Unique Foldseek Go: 3
Total Homologs: 324
Unique PROST Homologs: 141
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 47
Literature
Danchin and Fang [1]: oligopeptide transporter, permease|PP conserved, consseved in Streptococci and Lactobacilli
Yang and Tsui [2]: Oligopeptide transport system permease protein OppB
Antczak et al. [3]: oppB; Oligopeptide ABC transporter, permease
Zhang et al. [4]: GO:0042626|ATPase activity, coupled to transmembrane movement of substances
Bianchi et al. [5]: Oligopeptide transport system permease
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P0A4N8
(Oligopeptide transport system permease protein OppB) with a FATCAT P-Value: 0 and RMSD of 2.68 angstrom. The sequence alignment identity is 23.4%.
Structural alignment shown in left. Query protein AVX54648.1 colored as red in alignment, homolog P0A4N8 colored as blue.
Query protein AVX54648.1 is also shown in right top, homolog P0A4N8 showed in right bottom. They are colored based on secondary structures.
AVX54648.1 MKSTLKTKQEVLNLNSELLLDDFSLLNETNQQHKVSKWTTFKYWYYDTSANIYKYFLRHPLYGYSFKRILYGLITL-LLSIIILYVVIRLITPDTKYLPP 99 P0A4N8 ---------------------------------------------------MWKVIIR---------RILLMIPQLFILSILVFFF--------AKLMPG 32 AVX54648.1 DIEKTGLSRAQQDKLLEDRMKR-FGVYGPLIPQILTYLKNITPFIPKQIVLGSEVTILQNGNAIIDSSKLITETRWVY-LGVTTATTIAEEGSDALSIFL 197 P0A4N8 D-PFSGLIGPHTDPHEVEALRRAAGLYDPWWEQ---YLR----------WLGNAI----HGN--LGMS---------YNLKEPVMTVI---GHRAINTFW 100 AVX54648.1 KAMPYSFAIGSVSVLISYALAILIGVRAAKKKGKLFDNV---FNGISALLLAIPSIV--IIIGTFIFSVAVLGN---SGIYNT------G---SFATRFW 280 P0A4N8 --M--SL----LSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSIT---FGIPPYVFYLLI-IFIFGYSL--NWFPTG--GTVSPDAMGIIPVFFSKIY 184 AVX54648.1 ----PIFAIVVINLPGIATFVRRYIVDEMTVDYAKFALAKGTSSNKTYYVHIFRNAGVRIIRSIPSEIILT-VFGSSMIVETQWAIPGMGRL-IKESAGG 374 P0A4N8 HMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFG--FVITGLLGGAIFAETIFGYPGLGQLFIT-SISG 281 AVX54648.1 NDFFVFLGFTVLSSFVSIFAKLLADLVHVLLDPRVSLTKD 414 P0A4N8 RDYSMITALILLNGFLGLLGALLSDIIMAMVDPRIRIQ-- 319
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0034775 | glutathione transmembrane transport |
1. PBF | GO:0055085 | transmembrane transport |
1. PBF | GO:0015031 | protein transport |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0030435 | sporulation resulting in formation of a cellular spore |
1. PBF | GO:0015675 | nickel cation transport |
1. PBF | GO:0015099 | nickel cation transmembrane transporter activity |
1. PBF | GO:0015833 | peptide transport |
1. PBF | GO:0071916 | dipeptide transmembrane transporter activity |
1. PBF | GO:0006829 | zinc ion transport |
1. PBF | GO:0030420 | establishment of competence for transformation |
1. PBF | GO:0006824 | cobalt ion transport |
1. PBF | GO:0034634 | glutathione transmembrane transporter activity |
2. PF | GO:0015419 | ABC-type sulfate transporter activity |
2. PF | GO:0022857 | transmembrane transporter activity |
2. PF | GO:0005315 | inorganic phosphate transmembrane transporter activity |
2. PF | GO:0005887 | integral component of plasma membrane |
2. PF | GO:0042956 | maltodextrin transport |
2. PF | GO:0015098 | molybdate ion transmembrane transporter activity |
2. PF | GO:0035435 | phosphate ion transmembrane transport |
2. PF | GO:0006865 | amino acid transport |
2. PF | GO:0006817 | phosphate ion transport |
2. PF | GO:0008643 | carbohydrate transport |
2. PF | GO:0015423 | ABC-type maltose transporter activity |
2. PF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
2. PF | GO:1990060 | maltose transport complex |
2. PF | GO:0055072 | iron ion homeostasis |
3. BF | GO:0006825 | copper ion transport |
4. PB | GO:0042884 | microcin transport |
4. PB | GO:0035672 | oligopeptide transmembrane transport |
5. P | GO:0042918 | alkanesulfonate transport |
5. P | GO:0005314 | high-affinity glutamate transmembrane transporter activity |
5. P | GO:0043953 | protein transport by the Tat complex |
5. P | GO:0098796 | membrane protein complex |
5. P | GO:0015879 | carnitine transport |
5. P | GO:0015810 | aspartate transmembrane transport |
5. P | GO:0015847 | putrescine transport |
5. P | GO:0042935 | achromobactin transport |
5. P | GO:0046872 | metal ion binding |
5. P | GO:0015889 | cobalamin transport |
5. P | GO:0051701 | biological process involved in interaction with host |
5. P | GO:0015226 | carnitine transmembrane transporter activity |
5. P | GO:0015183 | L-aspartate transmembrane transporter activity |
5. P | GO:0015489 | putrescine transmembrane transporter activity |
5. P | GO:0015199 | amino-acid betaine transmembrane transporter activity |
5. P | GO:0033281 | TAT protein transport complex |
5. P | GO:0031460 | glycine betaine transport |
5. P | GO:0010436 | carotenoid dioxygenase activity |
5. P | GO:0001504 | neurotransmitter uptake |
5. P | GO:0098712 | L-glutamate import across plasma membrane |
5. P | GO:0016121 | carotene catabolic process |
5. P | GO:0015416 | ABC-type phosphonate transporter activity |
5. P | GO:0070297 | regulation of phosphorelay signal transduction system |
5. P | GO:0035444 | nickel cation transmembrane transport |
5. P | GO:0045881 | positive regulation of sporulation resulting in formation of a cellular spore |
5. P | GO:0033214 | siderophore-dependent iron import into cell |
5. P | GO:0009977 | proton motive force dependent protein transmembrane transporter activity |
5. P | GO:0042959 | alkanesulfonate transmembrane transporter activity |
5. P | GO:0015768 | maltose transport |
5. P | GO:0015112 | nitrate transmembrane transporter activity |
5. P | GO:0010438 | cellular response to sulfur starvation |
5. P | GO:0090482 | vitamin transmembrane transporter activity |
5. P | GO:0015620 | ferric-enterobactin transmembrane transporter activity |
5. P | GO:0015685 | ferric-enterobactin import into cell |
5. P | GO:0003834 | beta-carotene 15,15'-dioxygenase activity |
5. P | GO:0010921 | regulation of phosphatase activity |
6. F | GO:0048473 | D-methionine transport |
6. F | GO:0033223 | 2-aminoethylphosphonate transport |
6. F | GO:0003333 | amino acid transmembrane transport |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0005886 | plasma membrane |
GO:0016020 | membrane |
GO:0055085 | transmembrane transport |
GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | P0A4M7 | Oligopeptide transport system permease protein AmiC | 5.33e-09 | 3.10e-09 | 3.35e-28 | 0.6925 |
1. PBF | P47324 | Oligopeptide transport system permease protein OppC | 3.06e-07 | 2.27e-32 | 0.012 | 0.4886 |
1. PBF | P0AFH3 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 3.44e-18 | 1.14e-10 | 0.8061 |
1. PBF | Q83S25 | Glutathione transport system permease protein GsiD | 9.73e-08 | 3.10e-06 | 0.016 | 0.6629 |
1. PBF | P75553 | Oligopeptide transport system permease protein OppC | 2.82e-08 | 8.68e-31 | 0.044 | 0.4988 |
1. PBF | Q2FH55 | Nickel import system permease protein NikB | 0.00e+00 | 5.43e-11 | 4.11e-06 | 0.7495 |
1. PBF | Q8FWN8 | Putative peptide permease protein BRA0408/BS1330_II0405 | 0.00e+00 | 2.55e-13 | 1.27e-11 | 0.8213 |
1. PBF | Q8Z862 | Glutathione transport system permease protein GsiC | 0.00e+00 | 4.49e-13 | 1.37e-06 | 0.8329 |
1. PBF | P26903 | Dipeptide transport system permease protein DppB | 0.00e+00 | 1.84e-16 | 5.46e-19 | 0.7941 |
1. PBF | Q7A5Q6 | Nickel import system permease protein NikB | 0.00e+00 | 2.35e-11 | 4.38e-06 | 0.7584 |
1. PBF | Q2YXY7 | Nickel import system permease protein NikB | 0.00e+00 | 9.22e-12 | 1.65e-06 | 0.7592 |
1. PBF | Q8FJK9 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.14e-12 | 2.32e-06 | 0.8342 |
1. PBF | P0A4N7 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 4.55e-16 | 1.04e-14 | 0.7784 |
1. PBF | P0AFU1 | Inner membrane ABC transporter permease protein YejB | 0.00e+00 | 4.14e-18 | 1.35e-14 | 0.6567 |
1. PBF | Q0T6D1 | Glutathione transport system permease protein GsiC | 0.00e+00 | 8.98e-13 | 2.73e-06 | 0.8337 |
1. PBF | Q32IB8 | Glutathione transport system permease protein GsiD | 8.92e-08 | 3.18e-06 | 0.005 | 0.6855 |
1. PBF | Q1RE93 | Glutathione transport system permease protein GsiD | 5.48e-09 | 3.52e-06 | 0.031 | 0.6657 |
1. PBF | Q3Z3V2 | Glutathione transport system permease protein GsiC | 0.00e+00 | 7.20e-13 | 2.65e-06 | 0.8082 |
1. PBF | Q6D3B1 | Glutathione transport system permease protein GsiC | 0.00e+00 | 3.44e-13 | 4.28e-07 | 0.8628 |
1. PBF | Q5PGP5 | Glutathione transport system permease protein GsiC | 0.00e+00 | 5.05e-13 | 1.20e-06 | 0.8134 |
1. PBF | Q8X6V6 | Glutathione transport system permease protein GsiD | 1.01e-07 | 4.75e-06 | 0.018 | 0.5479 |
1. PBF | Q5HG38 | Nickel import system permease protein NikB | 0.00e+00 | 5.43e-11 | 4.11e-06 | 0.7594 |
1. PBF | A1A971 | Glutathione transport system permease protein GsiD | 5.71e-09 | 3.52e-06 | 0.031 | 0.6883 |
1. PBF | P45096 | Dipeptide transport system permease protein DppB | 0.00e+00 | 1.98e-10 | 1.94e-06 | 0.782 |
1. PBF | Q8YBN9 | Putative peptide permease protein BMEII0860 | 0.00e+00 | 6.69e-13 | 4.20e-11 | 0.8149 |
1. PBF | Q2YJK1 | Putative peptide transport system permease protein BAB2_1050 | 0.00e+00 | 2.52e-14 | 5.24e-12 | 0.828 |
1. PBF | P08005 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 4.00e-18 | 8.66e-12 | 0.8129 |
1. PBF | Q57RB0 | Glutathione transport system permease protein GsiC | 0.00e+00 | 4.49e-13 | 1.37e-06 | 0.8342 |
1. PBF | P0A4N8 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 4.55e-16 | 1.04e-14 | 0.7678 |
1. PBF | Q8NWT4 | Nickel import system permease protein NikB | 0.00e+00 | 6.23e-11 | 5.19e-06 | 0.752 |
1. PBF | P0AEG0 | Dipeptide transport system permease protein DppB | 0.00e+00 | 1.43e-09 | 5.23e-10 | 0.7529 |
1. PBF | Q323W3 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.20e-12 | 2.80e-06 | 0.833 |
1. PBF | Q6GH25 | Nickel import system permease protein NikB | 0.00e+00 | 1.80e-10 | 1.52e-06 | 0.7436 |
1. PBF | P45286 | Peptide transport system permease protein SapB | 0.00e+00 | 2.03e-05 | 0.018 | 0.6583 |
1. PBF | Q323W2 | Glutathione transport system permease protein GsiD | 5.02e-09 | 4.75e-06 | 0.018 | 0.6713 |
1. PBF | Q0TJL7 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.68e-12 | 2.58e-06 | 0.8333 |
1. PBF | Q3Z3V1 | Glutathione transport system permease protein GsiD | 4.46e-09 | 4.75e-06 | 0.018 | 0.672 |
1. PBF | Q8VQK4 | Putative peptide transport system permease protein BruAb2_1031 | 0.00e+00 | 2.52e-14 | 5.24e-12 | 0.8295 |
1. PBF | Q0TJL6 | Glutathione transport system permease protein GsiD | 9.22e-08 | 3.36e-06 | 0.020 | 0.6633 |
1. PBF | P45054 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 4.89e-18 | 1.80e-12 | 0.846 |
1. PBF | Q32IB7 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.68e-12 | 2.58e-06 | 0.8328 |
1. PBF | A2RI75 | Dipeptide transport system permease protein DppB | 0.00e+00 | 2.01e-10 | 3.68e-17 | 0.8086 |
1. PBF | Q8FUX0 | Putative peptide transport system permease protein BRA1092/BS1330_II1084 | 0.00e+00 | 4.51e-14 | 9.99e-12 | 0.8284 |
1. PBF | P42062 | Oligopeptide transport system permease protein AppB | 0.00e+00 | 3.27e-18 | 3.15e-18 | 0.7994 |
1. PBF | A0A0H3K104 | Metal-staphylopine import system permease protein CntB | 0.00e+00 | 6.72e-17 | 9.39e-13 | 0.78 |
1. PBF | A0A0H2ZGW7 | Di/tripeptide transport system permease protein DppB | 0.00e+00 | 1.85e-11 | 4.44e-09 | 0.7407 |
1. PBF | P0A4M8 | Oligopeptide transport system permease protein AmiC | 1.37e-08 | 3.10e-09 | 3.35e-28 | 0.6977 |
1. PBF | Q8ZQM2 | Glutathione transport system permease protein GsiC | 0.00e+00 | 5.21e-13 | 1.21e-06 | 0.8721 |
1. PBF | P0AFH4 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 3.44e-18 | 1.14e-10 | 0.8044 |
1. PBF | A0A0H2ZFV0 | Di/tripeptide transport system permease protein DppC | 4.06e-07 | 9.07e-05 | 0.024 | 0.7186 |
1. PBF | Q8X6V7 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.76e-12 | 2.63e-06 | 0.8357 |
1. PBF | P9WFZ6 | Putative peptide transport permease protein MT1320 | 0.00e+00 | 2.29e-12 | 6.67e-05 | 0.7089 |
1. PBF | Q8FJK8 | Glutathione transport system permease protein GsiD | 9.54e-08 | 3.36e-06 | 0.020 | 0.548 |
1. PBF | A5VU90 | Putative peptide permease protein BOV_A0351 | 0.00e+00 | 6.69e-13 | 4.20e-11 | 0.7738 |
1. PBF | P0C2L2 | Glutathione transport system permease protein GsiD | 1.00e-07 | 3.10e-06 | 0.016 | 0.676 |
1. PBF | P0AEF9 | Dipeptide transport system permease protein DppB | 0.00e+00 | 1.43e-09 | 5.23e-10 | 0.7478 |
1. PBF | P66967 | Putative peptide transport permease protein Mb1314c | 0.00e+00 | 2.29e-12 | 6.67e-05 | 0.7828 |
1. PBF | Q99UA0 | Nickel import system permease protein NikB | 0.00e+00 | 2.35e-11 | 4.38e-06 | 0.7507 |
1. PBF | Q1RE94 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.68e-12 | 2.58e-06 | 0.8306 |
1. PBF | Q83S26 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.71e-12 | 2.77e-06 | 0.8231 |
1. PBF | A1A970 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.68e-12 | 2.58e-06 | 0.8291 |
1. PBF | P24138 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 2.67e-13 | 4.17e-12 | 0.7915 |
1. PBF | Q6G9H8 | Nickel import system permease protein NikB | 0.00e+00 | 6.23e-11 | 5.19e-06 | 0.7497 |
1. PBF | Q8YDG7 | Putative peptide transport system permease protein BMEII0209 | 0.00e+00 | 1.74e-14 | 5.96e-12 | 0.8245 |
1. PBF | P94311 | Dipeptide transport system permease protein DppB | 0.00e+00 | 2.21e-09 | 1.96e-06 | 0.7053 |
1. PBF | Q53191 | Probable peptide ABC transporter permease protein y4tP | 0.00e+00 | 1.26e-12 | 1.12e-11 | 0.8262 |
1. PBF | P0AFH5 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 3.44e-18 | 1.14e-10 | 0.8037 |
2. PF | Q53192 | Probable peptide ABC transporter permease protein y4tQ | 5.93e-11 | 6.42e-05 | NA | 0.5705 |
2. PF | P0A627 | Phosphate transport system permease protein PstA 2 | 1.08e-08 | 2.52e-03 | NA | 0.643 |
2. PF | Q74RF9 | Maltose/maltodextrin transport system permease protein MalF | 5.74e-05 | 4.28e-06 | NA | 0.5144 |
2. PF | P0AGH4 | Peptide transport system permease protein SapB | 0.00e+00 | 2.95e-07 | NA | 0.6494 |
2. PF | Q50097 | Phosphate transport system permease protein PstA | 7.78e-09 | 4.30e-04 | NA | 0.731 |
2. PF | Q57RA9 | Glutathione transport system permease protein GsiD | 6.41e-09 | 1.64e-06 | NA | 0.6811 |
2. PF | P26904 | Dipeptide transport system permease protein DppC | 3.97e-08 | 3.41e-08 | NA | 0.5177 |
2. PF | Q50098 | Phosphate transport system permease protein PstC | 1.16e-07 | 1.51e-02 | NA | 0.6157 |
2. PF | P9WFZ8 | Putative peptide transport permease protein MT1319 | 1.41e-07 | 2.45e-04 | NA | 0.6467 |
2. PF | O69062 | Putative phosphite transport system permease protein HtxC | 1.11e-09 | 3.41e-05 | NA | 0.6985 |
2. PF | Q9PBK2 | Phosphate transport system permease protein PstC | 2.05e-08 | 1.66e-06 | NA | 0.635 |
2. PF | Q5PGP6 | Glutathione transport system permease protein GsiD | 4.39e-07 | 1.64e-06 | NA | 0.5523 |
2. PF | P46339 | Probable ABC transporter permease protein YqgH | 6.46e-08 | 1.73e-07 | NA | 0.5733 |
2. PF | P66965 | Putative peptide transport permease protein Mb1313c | 1.18e-07 | 2.45e-04 | NA | 0.631 |
2. PF | Q8FWN9 | Putative peptide permease protein BRA0407/BS1330_II0404 | 1.54e-08 | 7.72e-05 | NA | 0.508 |
2. PF | Q8XF88 | Glutathione transport system permease protein GsiD | 5.05e-09 | 1.64e-06 | NA | 0.6786 |
2. PF | P0AFH7 | Oligopeptide transport system permease protein OppC | 8.03e-08 | 3.18e-06 | NA | 0.6231 |
2. PF | P0A2J5 | Peptide transport system permease protein SapC | 2.87e-08 | 9.18e-06 | NA | 0.643 |
2. PF | Q8FUW9 | Putative peptide transport system permease protein BRA1093/BS1330_II1085 | 2.46e-07 | 2.90e-05 | NA | 0.5529 |
2. PF | P94312 | Dipeptide transport system permease protein DppC | 7.13e-08 | 1.54e-06 | NA | 0.673 |
2. PF | P0AEG2 | Dipeptide transport system permease protein DppC | 2.58e-08 | 2.05e-04 | NA | 0.5404 |
2. PF | Q8VQK5 | Putative peptide transport system permease protein BruAb2_1032 | 1.43e-08 | 5.17e-05 | NA | 0.5541 |
2. PF | P0AGH7 | Peptide transport system permease protein SapC | 2.98e-09 | 1.11e-05 | NA | 0.6417 |
2. PF | Q7CQV4 | Glutathione transport system permease protein GsiD | 7.56e-09 | 1.64e-06 | NA | 0.5506 |
2. PF | P0AFB0 | Nickel transport system permease protein NikC | 6.58e-09 | 1.80e-03 | NA | 0.5597 |
2. PF | Q577J7 | Putative peptide permease protein BruAb2_0794 | 2.01e-08 | 1.25e-04 | NA | 0.5059 |
2. PF | A2RI76 | Dipeptide transport system permease protein DppC | 1.57e-07 | 6.50e-19 | NA | 0.5311 |
2. PF | P0AEG3 | Dipeptide transport system permease protein DppC | 1.86e-08 | 2.05e-04 | NA | 0.6602 |
2. PF | Q9Z3R7 | Alpha-glucoside transport system permease protein AglG | 8.80e-06 | 4.97e-06 | NA | 0.5422 |
2. PF | P0AGH6 | Peptide transport system permease protein SapC | 3.21e-09 | 1.11e-05 | NA | 0.6646 |
2. PF | Q6D3B2 | Glutathione transport system permease protein GsiD | 5.40e-09 | 1.03e-05 | NA | 0.5507 |
2. PF | P9WG08 | Phosphate transport system permease protein PstA 2 | 9.27e-09 | 2.52e-03 | NA | 0.6934 |
2. PF | A5VU89 | Putative peptide permease protein BOV_A0350 | 1.50e-08 | 3.89e-05 | NA | 0.5095 |
2. PF | Q2YK65 | Putative peptide permease protein BAB2_0815 | 1.56e-07 | 1.25e-04 | NA | 0.5056 |
2. PF | P9WG04 | Phosphate transport system permease protein PstC 2 | 4.54e-08 | 5.29e-04 | NA | 0.5925 |
2. PF | P0A2J3 | Peptide transport system permease protein SapB | 0.00e+00 | 6.68e-07 | NA | 0.6569 |
2. PF | Q8YBN8 | Putative peptide permease protein BMEII0861 | 1.94e-08 | 1.25e-04 | NA | 0.5165 |
2. PF | P08006 | Oligopeptide transport system permease protein OppC | 1.09e-07 | 1.19e-06 | NA | 0.6449 |
2. PF | Q8YDG8 | Putative peptide transport system permease protein BMEII0207/BMEII0208 | 1.78e-08 | 5.17e-05 | NA | 0.6582 |
2. PF | Q2YJK0 | Putative peptide transport system permease protein BAB2_1051 | 1.01e-07 | 5.17e-05 | NA | 0.5547 |
2. PF | P9WG10 | Phosphate transport system permease protein PstA 1 | 4.05e-09 | 7.15e-05 | NA | 0.7104 |
2. PF | Q57SD8 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 2.56e-10 | 6.21e-03 | NA | 0.5934 |
2. PF | Q5PFQ5 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 1.71e-10 | 1.04e-02 | NA | 0.586 |
2. PF | P24139 | Oligopeptide transport system permease protein OppC | 5.26e-09 | 2.30e-09 | NA | 0.5438 |
2. PF | P18812 | Maltose/maltodextrin transport system permease protein MalF | 1.13e-05 | 7.22e-08 | NA | 0.4268 |
2. PF | P0A4P0 | Oligopeptide transport system permease protein OppC | 5.61e-12 | 2.52e-03 | NA | 0.6451 |
2. PF | P51000 | Dipeptide transport system permease protein DppC | 1.80e-08 | 6.92e-06 | NA | 0.5557 |
2. PF | Q8Z1U2 | Maltose/maltodextrin transport system permease protein MalF | 1.80e-05 | 3.45e-07 | NA | 0.4232 |
2. PF | Q7N984 | Maltose/maltodextrin transport system permease protein MalF | 3.85e-05 | 2.35e-06 | NA | 0.4919 |
2. PF | P0A2J4 | Peptide transport system permease protein SapB | 0.00e+00 | 6.68e-07 | NA | 0.644 |
2. PF | P45053 | Oligopeptide transport system permease protein OppC | 2.37e-08 | 1.86e-07 | NA | 0.6539 |
2. PF | P45190 | Phosphate transport system permease protein PstA | 3.12e-08 | 2.21e-03 | NA | 0.6258 |
2. PF | P0A4N9 | Oligopeptide transport system permease protein OppC | 7.11e-12 | 2.72e-03 | NA | 0.6628 |
2. PF | P0A4N0 | Oligopeptide transport system permease protein AmiD | 4.10e-08 | 7.85e-10 | NA | 0.7028 |
2. PF | P0A4M9 | Oligopeptide transport system permease protein AmiD | 2.02e-09 | 7.85e-10 | NA | 0.6827 |
2. PF | P0A2J6 | Peptide transport system permease protein SapC | 3.80e-08 | 9.18e-06 | NA | 0.6546 |
2. PF | P42063 | Oligopeptide transport system permease protein AppC | 8.50e-08 | 1.42e-05 | NA | 0.6539 |
3. BF | P75554 | Oligopeptide transport system permease protein OppB | 0.00e+00 | NA | 1.34e-12 | 0.7056 |
3. BF | P47323 | Oligopeptide transport system permease protein OppB | 0.00e+00 | NA | 6.35e-10 | 0.7067 |
4. PB | P77308 | Probable D,D-dipeptide transport system permease protein DdpB | 0.00e+00 | 1.77e-10 | 0.004 | NA |
4. PB | P0AFH2 | Oligopeptide transport system permease protein OppB | 0.00e+00 | 3.44e-18 | 1.14e-10 | NA |
4. PB | P0AEF8 | Dipeptide transport system permease protein DppB | 0.00e+00 | 1.43e-09 | 5.23e-10 | NA |
4. PB | P75798 | Glutathione transport system permease protein GsiC | 0.00e+00 | 1.68e-12 | 2.58e-06 | NA |
4. PB | P9WFZ7 | Putative peptide transport permease protein Rv1283c | 0.00e+00 | 2.29e-12 | 6.67e-05 | NA |
4. PB | P33591 | Nickel transport system permease protein NikB | 0.00e+00 | 1.04e-13 | 4.89e-10 | NA |
4. PB | P0AFU0 | Inner membrane ABC transporter permease protein YejB | 0.00e+00 | 4.14e-18 | 1.35e-14 | NA |
4. PB | Q2FVE8 | Metal-staphylopine import system permease protein CntB | 0.00e+00 | 9.78e-17 | 1.33e-12 | NA |
4. PB | Q2FYQ5 | Nickel import system permease protein NikB | 0.00e+00 | 5.43e-11 | 4.11e-06 | NA |
4. PB | P75799 | Glutathione transport system permease protein GsiD | 9.60e-08 | 4.14e-06 | 0.014 | NA |
5. P | D4GPW2 | Glucose ABC transporter permease protein TsgB13 | 6.19e-03 | 4.06e-03 | NA | NA |
5. P | B4T4N5 | Vitamin B12 import system permease protein BtuC | 4.40e-03 | 3.23e-02 | NA | NA |
5. P | Q98FL4 | Phosphate transport system permease protein PstA | 2.45e-08 | 1.60e-02 | NA | NA |
5. P | B4TGH8 | Vitamin B12 import system permease protein BtuC | 4.67e-03 | 3.09e-02 | NA | NA |
5. P | P68184 | Maltose/maltodextrin transport system permease protein MalG | 2.58e-07 | 6.23e-04 | NA | NA |
5. P | P0AGH5 | Putrescine export system permease protein SapC | 2.95e-09 | 1.11e-05 | NA | NA |
5. P | P0A631 | Phosphate transport system permease protein PstC 2 | 3.08e-08 | 5.29e-04 | NA | NA |
5. P | O58967 | Probable ABC transporter permease protein PH1216 | 4.77e-09 | 2.45e-02 | NA | NA |
5. P | A9N235 | Vitamin B12 import system permease protein BtuC | 4.39e-03 | 3.09e-02 | NA | NA |
5. P | P94529 | Arabinooligosaccharides transport system permease protein AraP | 6.04e-08 | 1.02e-02 | NA | NA |
5. P | P9WG06 | Phosphate transport system permease protein PstC 1 | 1.22e-06 | 6.61e-06 | NA | NA |
5. P | P45191 | Phosphate transport system permease protein PstC | 8.64e-08 | 7.55e-05 | NA | NA |
5. P | P18795 | Probable transport system permease protein NifC | 7.18e-09 | 1.98e-02 | NA | NA |
5. P | P0AFH6 | Oligopeptide transport system permease protein OppC | 8.09e-08 | 3.18e-06 | NA | NA |
5. P | Q55106 | Bicarbonate transport system permease protein CmpB | 1.89e-06 | 4.43e-03 | NA | NA |
5. P | P26467 | Maltose/maltodextrin transport system permease protein MalF | 1.99e-05 | 2.35e-07 | NA | NA |
5. P | Q7N3Q3 | Vitamin B12 import system permease protein BtuC | 2.38e-03 | 8.20e-04 | NA | NA |
5. P | O32261 | Galactooligosaccharides transport system permease protein GanP | 1.83e-06 | 5.58e-07 | NA | NA |
5. P | P02916 | Maltose/maltodextrin transport system permease protein MalF | 3.50e-05 | 7.26e-07 | NA | NA |
5. P | P96065 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 1.64e-10 | 1.34e-02 | NA | NA |
5. P | Q8Z8X0 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 1.85e-10 | 2.83e-03 | NA | NA |
5. P | P31135 | Putrescine transport system permease protein PotH | 2.74e-07 | 3.15e-03 | NA | NA |
5. P | Q8D3U8 | Maltose/maltodextrin transport system permease protein MalF | 1.17e-04 | 5.58e-05 | NA | NA |
5. P | B5RAW6 | Vitamin B12 import system permease protein BtuC | 4.40e-03 | 3.23e-02 | NA | NA |
5. P | B5BA35 | Vitamin B12 import system permease protein BtuC | 4.37e-03 | 3.80e-02 | NA | NA |
5. P | A8AHA4 | Vitamin B12 import system permease protein BtuC | 3.98e-03 | 1.91e-02 | NA | NA |
5. P | P0AGH3 | Putrescine export system permease protein SapB | 0.00e+00 | 2.95e-07 | NA | NA |
5. P | Q6D656 | Vitamin B12 import system permease protein BtuC | 1.62e-03 | 1.57e-02 | NA | NA |
5. P | O06990 | Maltodextrin transport system permease protein MdxF | 2.14e-06 | 1.75e-08 | NA | NA |
5. P | D4GP37 | Xylose/arabinose import permease protein XacI | 1.12e-07 | 3.77e-02 | NA | NA |
5. P | Q83P81 | Maltose/maltodextrin transport system permease protein MalF | 5.37e-06 | 1.19e-06 | NA | NA |
5. P | P55603 | Probable ABC transporter permease protein y4oR | 6.07e-08 | 8.85e-03 | NA | NA |
5. P | P58655 | Phosphate transport system permease protein PstA | 4.98e-10 | 4.34e-05 | NA | NA |
5. P | Q89AW1 | Putative transport protein bbp_117 | 3.58e-04 | 2.41e-02 | NA | NA |
5. P | Q8ZDX4 | Vitamin B12 import system permease protein BtuC | 1.42e-03 | 1.73e-02 | NA | NA |
5. P | Q321G8 | Vitamin B12 import system permease protein BtuC | 6.39e-03 | 4.40e-02 | NA | NA |
5. P | P9WG09 | Phosphate transport system permease protein PstA 2 | 8.07e-09 | 2.52e-03 | NA | NA |
5. P | O34382 | Uncharacterized membrane protein YvoD | 7.39e-03 | 4.43e-03 | NA | NA |
5. P | O07011 | Galactooligosaccharides transport system permease protein GanQ | 1.89e-06 | 4.48e-02 | NA | NA |
5. P | Q57130 | Molybdate import system permease protein MolB | 4.66e-03 | 4.56e-02 | NA | NA |
5. P | Q9N1R2 | Excitatory amino acid transporter 4 | 2.11e-03 | 3.95e-03 | NA | NA |
5. P | Q87GB7 | Maltose/maltodextrin transport system permease protein MalF | 2.99e-05 | 5.58e-05 | NA | NA |
5. P | Q92WD8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 6.95e-10 | 1.28e-02 | NA | NA |
5. P | Q7N983 | Maltose/maltodextrin transport system permease protein MalG | 9.42e-05 | 4.53e-04 | NA | NA |
5. P | B1JJ25 | Vitamin B12 import system permease protein BtuC | 1.25e-03 | 1.73e-02 | NA | NA |
5. P | P94418 | Petrobactin import system permease protein YclN | 2.24e-03 | 3.03e-02 | NA | NA |
5. P | Q9CNJ6 | Phosphate transport system permease protein PstA | 5.67e-09 | 7.82e-03 | NA | NA |
5. P | Q97UY9 | Glucose import system permease protein GlcU | 9.51e-06 | 1.04e-02 | NA | NA |
5. P | Q9CNJ5 | Phosphate transport system permease protein PstC | 3.50e-07 | 2.25e-05 | NA | NA |
5. P | P0AGH8 | Phosphate transport system permease protein PstC | 1.30e-07 | 3.23e-05 | NA | NA |
5. P | P18814 | Maltose/maltodextrin transport system permease protein MalG | 4.01e-05 | 9.08e-04 | NA | NA |
5. P | B5FJA1 | Vitamin B12 import system permease protein BtuC | 4.70e-03 | 3.09e-02 | NA | NA |
5. P | P0A4N1 | Maltodextrin transport system permease protein MalC | 1.25e-06 | 5.16e-08 | NA | NA |
5. P | Q5PH87 | Vitamin B12 import system permease protein BtuC | 3.73e-03 | 3.80e-02 | NA | NA |
5. P | P0AEG1 | Dipeptide transport system permease protein DppC | 1.45e-08 | 2.05e-04 | NA | NA |
5. P | Q7MFC2 | Maltose/maltodextrin transport system permease protein MalF | 1.30e-04 | 5.58e-05 | NA | NA |
5. P | P39128 | Protein LplB | 5.65e-08 | 1.63e-04 | NA | NA |
5. P | A9MFB6 | Vitamin B12 import system permease protein BtuC | 4.95e-03 | 1.81e-02 | NA | NA |
5. P | P16701 | Sulfate transport system permease protein CysT | 2.39e-09 | 4.99e-02 | NA | NA |
5. P | P75263 | Probable ABC transporter permease protein MG188 homolog | 5.07e-08 | 2.16e-02 | NA | NA |
5. P | P27370 | Sulfate transport system permease protein CysW | 3.91e-07 | 4.48e-02 | NA | NA |
5. P | Q52814 | General L-amino acid transport system permease protein AapM | 5.01e-06 | 3.20e-15 | NA | NA |
5. P | Q98FL3 | Phosphate transport system permease protein PstC | 1.17e-07 | 7.61e-07 | NA | NA |
5. P | Q2FZE5 | Probable heme-iron transport system permease protein IsdF | 2.38e-03 | 2.62e-02 | NA | NA |
5. P | B5QVW1 | Vitamin B12 import system permease protein BtuC | 3.00e-03 | 3.23e-02 | NA | NA |
5. P | P68185 | Maltose/maltodextrin transport system permease protein MalG | 2.21e-07 | 6.23e-04 | NA | NA |
5. P | P23877 | Ferric enterobactin transport system permease protein FepG | 2.86e-03 | 4.32e-02 | NA | NA |
5. P | Q9KL06 | Maltose/maltodextrin transport system permease protein MalF | 3.75e-05 | 5.18e-04 | NA | NA |
5. P | P9WG05 | Phosphate transport system permease protein PstC 2 | 6.15e-07 | 5.29e-04 | NA | NA |
5. P | P0AGI0 | Phosphate transport system permease protein PstC | 1.16e-07 | 3.23e-05 | NA | NA |
5. P | P49936 | Iron(3+)-hydroxamate import system permease protein FhuB | 1.07e-02 | 2.32e-05 | NA | NA |
5. P | Q8D3U7 | Maltose/maltodextrin transport system permease protein MalG | 7.33e-05 | 7.41e-04 | NA | NA |
5. P | Q58420 | Probable phosphate transport system permease protein PstC | 2.55e-07 | 1.82e-05 | NA | NA |
5. P | P68183 | Maltose/maltodextrin transport system permease protein MalG | 1.70e-06 | 6.23e-04 | NA | NA |
5. P | A8GDR2 | Vitamin B12 import system permease protein BtuC | 1.46e-03 | 6.91e-03 | NA | NA |
5. P | Q7A937 | Maltose/maltodextrin transport system permease protein MalF | 4.91e-05 | 2.03e-07 | NA | NA |
5. P | A6TAH6 | Vitamin B12 import system permease protein BtuC | 3.41e-03 | 7.04e-03 | NA | NA |
5. P | Q8ZPS8 | Vitamin B12 import system permease protein BtuC | 3.06e-03 | 3.09e-02 | NA | NA |
5. P | Q57PU6 | Vitamin B12 import system permease protein BtuC | 3.03e-03 | 3.67e-02 | NA | NA |
5. P | P0AFA9 | Nickel transport system permease protein NikC | 7.17e-09 | 1.80e-03 | NA | NA |
5. P | A7FHG9 | Vitamin B12 import system permease protein BtuC | 1.49e-03 | 1.73e-02 | NA | NA |
5. P | Q04454 | Putative transport protein BpOF4_00890 | 8.83e-04 | 1.10e-02 | NA | NA |
5. P | O34876 | Cell division protein FtsX | 3.17e-04 | 2.82e-02 | NA | NA |
5. P | P75262 | Probable ABC transporter permease protein MG189 homolog | 5.80e-06 | 1.33e-02 | NA | NA |
5. P | Q5MZ55 | Bicarbonate transport system permease protein CmpB | 2.12e-07 | 4.43e-03 | NA | NA |
5. P | Q8Z1U3 | Maltose/maltodextrin transport system permease protein MalG | 3.87e-05 | 1.39e-03 | NA | NA |
5. P | P9WFZ9 | Putative peptide transport permease protein Rv1282c | 1.54e-07 | 2.45e-04 | NA | NA |
5. P | A0A140NFA3 | Phosphonate transport system permease protein PhnE | 2.35e-09 | 2.89e-03 | NA | NA |
5. P | Q9KL07 | Maltose/maltodextrin transport system permease protein MalG | 8.38e-05 | 4.63e-04 | NA | NA |
5. P | P37738 | Ferric-anguibactin transport system permease protein FatD | 3.07e-03 | 3.23e-02 | NA | NA |
5. P | Q74RF8 | Maltose/maltodextrin transport system permease protein MalG | 4.39e-06 | 5.59e-03 | NA | NA |
5. P | O30143 | Molybdate/tungstate transport system permease protein WtpB | 2.35e-09 | 4.94e-02 | NA | NA |
5. P | Q00750 | Multiple sugar-binding transport system permease protein MsmF | 7.42e-10 | 3.51e-03 | NA | NA |
5. P | Q52665 | Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC | 6.63e-06 | 3.23e-10 | NA | NA |
5. P | O32154 | Probable ABC transporter permease protein YurM | 7.34e-07 | 6.04e-03 | NA | NA |
5. P | P0AGH9 | Phosphate transport system permease protein PstC | 1.24e-07 | 3.23e-05 | NA | NA |
5. P | O31520 | Probable ABC transporter permease protein YesQ | 9.16e-05 | 3.48e-03 | NA | NA |
5. P | Q8FB38 | Maltose/maltodextrin transport system permease protein MalF | 5.12e-06 | 2.70e-06 | NA | NA |
5. P | A1JPQ9 | Vitamin B12 import system permease protein BtuC | 1.05e-03 | 1.15e-02 | NA | NA |
5. P | P44872 | Cell division protein FtsX | 4.45e-04 | 1.07e-02 | NA | NA |
5. P | P33361 | Glycine betaine uptake system permease protein YehY | 9.78e-08 | 1.02e-09 | NA | NA |
5. P | A9R099 | Vitamin B12 import system permease protein BtuC | 9.61e-04 | 1.73e-02 | NA | NA |
5. P | P33915 | Inner membrane ABC transporter permease protein YejE | 1.19e-07 | 2.03e-16 | NA | NA |
5. P | Q47086 | Achromobactin transport system permease protein CbrC | 9.15e-03 | 2.68e-05 | NA | NA |
5. P | P68186 | Maltose/maltodextrin transport system permease protein MalG | 3.37e-07 | 6.23e-04 | NA | NA |
5. P | O69053 | Phosphite transport system permease protein PtxC | 7.54e-09 | 3.77e-05 | NA | NA |
5. P | P9WG11 | Phosphate transport system permease protein PstA 1 | 3.29e-09 | 6.56e-05 | NA | NA |
5. P | B2K660 | Vitamin B12 import system permease protein BtuC | 1.27e-03 | 1.73e-02 | NA | NA |
5. P | P66896 | Sec-independent protein translocase protein TatC | 1.59e-03 | 9.64e-03 | NA | NA |
5. P | P45767 | Putative amino-acid ABC transporter permease protein YhdX | 3.56e-05 | 1.75e-08 | NA | NA |
5. P | P0A4N2 | Maltodextrin transport system permease protein MalC | 2.98e-06 | 5.16e-08 | NA | NA |
5. P | Q52813 | General L-amino acid transport system permease protein AapQ | 2.69e-05 | 5.63e-08 | NA | NA |
5. P | Q81XB1 | Petrobactin import system permease protein FatD | 3.81e-03 | 1.83e-03 | NA | NA |
5. P | Q9HNE6 | Probable beta-carotene 15,15'-dioxygenase Blh | 2.08e-04 | 1.06e-02 | NA | NA |
5. P | P26468 | Maltose/maltodextrin transport system permease protein MalG | 3.44e-05 | 1.13e-03 | NA | NA |
5. P | P9WG07 | Phosphate transport system permease protein PstC 1 | 1.88e-06 | 6.61e-06 | NA | NA |
5. P | P9WG96 | Sec-independent protein translocase protein TatC | 3.56e-03 | 9.64e-03 | NA | NA |
5. P | Q9Z3R6 | Alpha-glucoside transport system permease protein AglF | 5.17e-06 | 1.32e-04 | NA | NA |
5. P | P45768 | Inner membrane amino-acid ABC transporter permease protein YhdY | 6.10e-06 | 1.76e-12 | NA | NA |
5. P | Q9RR45 | Glycine betaine/carnitine transport permease protein GbuB | 5.02e-08 | 1.08e-03 | NA | NA |
5. P | P77463 | Probable D,D-dipeptide transport system permease protein DdpC | 7.49e-08 | 1.13e-03 | NA | NA |
5. P | B4TUF7 | Vitamin B12 import system permease protein BtuC | 4.40e-03 | 3.09e-02 | NA | NA |
5. P | P07654 | Phosphate transport system permease protein PstA | 2.61e-09 | 7.12e-04 | NA | NA |
5. P | Q52664 | Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB | 4.26e-05 | 7.00e-06 | NA | NA |
5. P | C0SPB3 | Polygalacturonan/rhamnogalacturonan transport system permease protein YteP | 9.74e-09 | 1.24e-04 | NA | NA |
5. P | P9WG97 | Sec-independent protein translocase protein TatC | 1.53e-03 | 9.64e-03 | NA | NA |
5. P | O27279 | Putative transport protein MTH_1211 | 3.13e-03 | 1.42e-02 | NA | NA |
5. P | P0A629 | Phosphate transport system permease protein PstC 1 | 1.16e-06 | 6.61e-06 | NA | NA |
5. P | P23876 | Ferric enterobactin transport system permease protein FepD | 2.92e-03 | 3.06e-02 | NA | NA |
5. P | P48664 | Excitatory amino acid transporter 4 | 4.64e-03 | 3.67e-02 | NA | NA |
5. P | Q47539 | Taurine transport system permease protein TauC | 2.00e-08 | 1.11e-04 | NA | NA |
5. P | B5F7F5 | Vitamin B12 import system permease protein BtuC | 3.07e-03 | 3.09e-02 | NA | NA |
5. P | Q9KEF0 | Arabinooligosaccharides transport system permease protein AraP | 5.88e-06 | 1.81e-02 | NA | NA |
5. P | P77716 | Inner membrane ABC transporter permease protein YcjP | 2.69e-07 | 1.07e-03 | NA | NA |
5. P | Q8Z6I5 | Vitamin B12 import system permease protein BtuC | 7.28e-03 | 3.77e-02 | NA | NA |
5. P | P45287 | Peptide transport system permease protein SapC | 9.41e-11 | 1.89e-04 | NA | NA |
5. P | Q669Z9 | Vitamin B12 import system permease protein BtuC | 9.68e-04 | 1.73e-02 | NA | NA |
5. P | A9WGD1 | Riboflavin transport system permease protein RibX | 6.59e-08 | 2.70e-04 | NA | NA |
5. P | Q87GB8 | Maltose/maltodextrin transport system permease protein MalG | 9.34e-05 | 7.88e-04 | NA | NA |
5. P | Q7MFC1 | Maltose/maltodextrin transport system permease protein MalG | 8.65e-05 | 7.41e-04 | NA | NA |
5. P | Q87C90 | Phosphate transport system permease protein PstC | 1.42e-08 | 2.07e-06 | NA | NA |
6. F | O57893 | Molybdate/tungstate transport system permease protein WtpB | 2.70e-09 | NA | NA | 0.6633 |
6. F | Q93KD5 | Tungstate uptake system permease protein TupB | 4.15e-12 | NA | NA | 0.6621 |
6. F | A0A0H3JU73 | Metal-staphylopine import system permease protein CntC | 1.59e-10 | NA | NA | 0.6812 |
6. F | Q01895 | Sulfate transport system permease protein CysT | 3.56e-07 | NA | NA | 0.6423 |
6. F | Q6G9H9 | Nickel import system permease protein NikC | 2.84e-09 | NA | NA | 0.6712 |
6. F | P0AEQ9 | Glutamine transport system permease protein GlnP | 4.81e-14 | NA | NA | 0.6879 |
6. F | Q9TKU8 | Probable sulfate transport system permease protein cysT | 6.58e-08 | NA | NA | 0.6332 |
6. F | Q8ZRN0 | D-methionine transport system permease protein MetI | 2.00e-15 | NA | NA | 0.7066 |
6. F | P0AE36 | Arginine ABC transporter permease protein ArtQ | 5.62e-14 | NA | NA | 0.6469 |
6. F | P45322 | Molybdenum transport system permease protein ModB | 8.35e-11 | NA | NA | 0.6194 |
6. F | Q87C89 | Phosphate transport system permease protein PstA | 1.38e-08 | NA | NA | 0.5746 |
6. F | P0AER6 | Glutamate/aspartate import permease protein GltK | 5.11e-13 | NA | NA | 0.6673 |
6. F | P0AE35 | Arginine ABC transporter permease protein ArtQ | 4.00e-14 | NA | NA | 0.637 |
6. F | Q99UA1 | Nickel import system permease protein NikC | 2.55e-09 | NA | NA | 0.6318 |
6. F | P0AF02 | Molybdenum transport system permease protein ModB | 1.73e-11 | NA | NA | 0.6387 |
6. F | P45169 | Spermidine/putrescine transport system permease protein PotC | 3.52e-09 | NA | NA | 0.7161 |
6. F | Q9TJR4 | Probable sulfate transport system permease protein cysT | 1.15e-08 | NA | NA | 0.5785 |
6. F | Q7A5Q7 | Nickel import system permease protein NikC | 2.94e-09 | NA | NA | 0.6212 |
6. F | Q7A0Y0 | Nickel import system permease protein NikC | 3.22e-09 | NA | NA | 0.6293 |
6. F | Q9PBK1 | Phosphate transport system permease protein PstA | 1.34e-08 | NA | NA | 0.6454 |
6. F | P48245 | Glutamate transport system permease protein GluD | 9.26e-13 | NA | NA | 0.6507 |
6. F | P54536 | Arginine transport system permease protein ArtQ | 3.74e-14 | NA | NA | 0.7144 |
6. F | Q8Z8W9 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 1.41e-07 | NA | NA | 0.5699 |
6. F | Q2FH56 | Nickel import system permease protein NikC | 2.93e-09 | NA | NA | 0.631 |
6. F | P0AER4 | Glutamate/aspartate import permease protein GltJ | 1.89e-09 | NA | NA | 0.6092 |
6. F | P54953 | Probable amino-acid permease protein YxeN | 2.00e-13 | NA | NA | 0.7785 |
6. F | Q2YXY8 | Nickel import system permease protein NikC | 2.06e-09 | NA | NA | 0.6504 |
6. F | Q5HG39 | Nickel import system permease protein NikC | 2.89e-09 | NA | NA | 0.6717 |
6. F | P0A2J0 | Histidine transport system permease protein HisQ | 2.21e-13 | NA | NA | 0.6244 |
6. F | P45090 | Arginine ABC transporter permease protein ArtQ | 9.50e-14 | NA | NA | 0.7075 |
6. F | Q8RQL5 | Glutamate transport system permease protein GluC | 7.28e-14 | NA | NA | 0.6535 |
6. F | Q08382 | Molybdenum transport system permease protein ModB | 3.47e-12 | NA | NA | 0.709 |
6. F | Q8RQL4 | Glutamate transport system permease protein GluD | 1.22e-12 | NA | NA | 0.655 |
6. F | O34671 | Probable glutamine ABC transporter permease protein GlnM | 1.39e-13 | NA | NA | 0.6775 |
6. F | P0AFK7 | Spermidine/putrescine transport system permease protein PotC | 1.88e-09 | NA | NA | 0.6609 |
6. F | P0A2I9 | Histidine transport system permease protein HisQ | 2.62e-13 | NA | NA | 0.6249 |
6. F | P48244 | Glutamate transport system permease protein GluC | 7.78e-14 | NA | NA | 0.63 |
6. F | P0AFK8 | Spermidine/putrescine transport system permease protein PotC | 1.19e-09 | NA | NA | 0.6851 |
6. F | Q6GH26 | Nickel import system permease protein NikC | 2.04e-09 | NA | NA | 0.6304 |
6. F | P27367 | Sulfate transport system permease protein CysT | 6.61e-09 | NA | NA | 0.626 |
6. F | Q97UZ0 | Glucose import system permease protein GlcT | 6.13e-10 | NA | NA | 0.6084 |
6. F | P0AER7 | Glutamate/aspartate import permease protein GltK | 4.16e-13 | NA | NA | 0.6404 |
6. F | O34606 | Probable glutamine ABC transporter permease protein GlnP | 9.69e-14 | NA | NA | 0.7419 |
6. F | P9WG12 | Molybdenum transport system permease protein ModB | 2.01e-08 | NA | NA | 0.533 |
6. F | P0AEQ8 | Glutamine transport system permease protein GlnP | 3.83e-14 | NA | NA | 0.6644 |
6. F | P45089 | Arginine ABC transporter permease protein ArtM | 5.70e-13 | NA | NA | 0.6863 |
6. F | Q83RR7 | Spermidine/putrescine transport system permease protein PotC | 1.93e-09 | NA | NA | 0.6634 |