Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54648.1
JCVISYN3A_0165

Oligopeptide ABC transporter permease.
M. mycoides homolog: Q6MU61.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 70
Unique PROST Go: 36
Unique BLAST Go: 0
Unique Foldseek Go: 3

Total Homologs: 324
Unique PROST Homologs: 141
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 47

Literature

Danchin and Fang [1]: oligopeptide transporter, permease|PP conserved, consseved in Streptococci and Lactobacilli
Yang and Tsui [2]: Oligopeptide transport system permease protein OppB
Antczak et al. [3]: oppB; Oligopeptide ABC transporter, permease
Zhang et al. [4]: GO:0042626|ATPase activity, coupled to transmembrane movement of substances
Bianchi et al. [5]: Oligopeptide transport system permease

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P0A4N8 (Oligopeptide transport system permease protein OppB) with a FATCAT P-Value: 0 and RMSD of 2.68 angstrom. The sequence alignment identity is 23.4%.
Structural alignment shown in left. Query protein AVX54648.1 colored as red in alignment, homolog P0A4N8 colored as blue. Query protein AVX54648.1 is also shown in right top, homolog P0A4N8 showed in right bottom. They are colored based on secondary structures.

  AVX54648.1 MKSTLKTKQEVLNLNSELLLDDFSLLNETNQQHKVSKWTTFKYWYYDTSANIYKYFLRHPLYGYSFKRILYGLITL-LLSIIILYVVIRLITPDTKYLPP 99
      P0A4N8 ---------------------------------------------------MWKVIIR---------RILLMIPQLFILSILVFFF--------AKLMPG 32

  AVX54648.1 DIEKTGLSRAQQDKLLEDRMKR-FGVYGPLIPQILTYLKNITPFIPKQIVLGSEVTILQNGNAIIDSSKLITETRWVY-LGVTTATTIAEEGSDALSIFL 197
      P0A4N8 D-PFSGLIGPHTDPHEVEALRRAAGLYDPWWEQ---YLR----------WLGNAI----HGN--LGMS---------YNLKEPVMTVI---GHRAINTFW 100

  AVX54648.1 KAMPYSFAIGSVSVLISYALAILIGVRAAKKKGKLFDNV---FNGISALLLAIPSIV--IIIGTFIFSVAVLGN---SGIYNT------G---SFATRFW 280
      P0A4N8 --M--SL----LSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSIT---FGIPPYVFYLLI-IFIFGYSL--NWFPTG--GTVSPDAMGIIPVFFSKIY 184

  AVX54648.1 ----PIFAIVVINLPGIATFVRRYIVDEMTVDYAKFALAKGTSSNKTYYVHIFRNAGVRIIRSIPSEIILT-VFGSSMIVETQWAIPGMGRL-IKESAGG 374
      P0A4N8 HMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFG--FVITGLLGGAIFAETIFGYPGLGQLFIT-SISG 281

  AVX54648.1 NDFFVFLGFTVLSSFVSIFAKLLADLVHVLLDPRVSLTKD 414
      P0A4N8 RDYSMITALILLNGFLGLLGALLSDIIMAMVDPRIRIQ-- 319

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0034775 glutathione transmembrane transport
1. PBF GO:0055085 transmembrane transport
1. PBF GO:0015031 protein transport
1. PBF GO:0016021 integral component of membrane
1. PBF GO:0005886 plasma membrane
1. PBF GO:0030435 sporulation resulting in formation of a cellular spore
1. PBF GO:0015675 nickel cation transport
1. PBF GO:0015099 nickel cation transmembrane transporter activity
1. PBF GO:0015833 peptide transport
1. PBF GO:0071916 dipeptide transmembrane transporter activity
1. PBF GO:0006829 zinc ion transport
1. PBF GO:0030420 establishment of competence for transformation
1. PBF GO:0006824 cobalt ion transport
1. PBF GO:0034634 glutathione transmembrane transporter activity
2. PF GO:0015419 ABC-type sulfate transporter activity
2. PF GO:0022857 transmembrane transporter activity
2. PF GO:0005315 inorganic phosphate transmembrane transporter activity
2. PF GO:0005887 integral component of plasma membrane
2. PF GO:0042956 maltodextrin transport
2. PF GO:0015098 molybdate ion transmembrane transporter activity
2. PF GO:0035435 phosphate ion transmembrane transport
2. PF GO:0006865 amino acid transport
2. PF GO:0006817 phosphate ion transport
2. PF GO:0008643 carbohydrate transport
2. PF GO:0015423 ABC-type maltose transporter activity
2. PF GO:0043190 ATP-binding cassette (ABC) transporter complex
2. PF GO:1990060 maltose transport complex
2. PF GO:0055072 iron ion homeostasis
3. BF GO:0006825 copper ion transport
4. PB GO:0042884 microcin transport
4. PB GO:0035672 oligopeptide transmembrane transport
5. P GO:0042918 alkanesulfonate transport
5. P GO:0005314 high-affinity glutamate transmembrane transporter activity
5. P GO:0043953 protein transport by the Tat complex
5. P GO:0098796 membrane protein complex
5. P GO:0015879 carnitine transport
5. P GO:0015810 aspartate transmembrane transport
5. P GO:0015847 putrescine transport
5. P GO:0042935 achromobactin transport
5. P GO:0046872 metal ion binding
5. P GO:0015889 cobalamin transport
5. P GO:0051701 biological process involved in interaction with host
5. P GO:0015226 carnitine transmembrane transporter activity
5. P GO:0015183 L-aspartate transmembrane transporter activity
5. P GO:0015489 putrescine transmembrane transporter activity
5. P GO:0015199 amino-acid betaine transmembrane transporter activity
5. P GO:0033281 TAT protein transport complex
5. P GO:0031460 glycine betaine transport
5. P GO:0010436 carotenoid dioxygenase activity
5. P GO:0001504 neurotransmitter uptake
5. P GO:0098712 L-glutamate import across plasma membrane
5. P GO:0016121 carotene catabolic process
5. P GO:0015416 ABC-type phosphonate transporter activity
5. P GO:0070297 regulation of phosphorelay signal transduction system
5. P GO:0035444 nickel cation transmembrane transport
5. P GO:0045881 positive regulation of sporulation resulting in formation of a cellular spore
5. P GO:0033214 siderophore-dependent iron import into cell
5. P GO:0009977 proton motive force dependent protein transmembrane transporter activity
5. P GO:0042959 alkanesulfonate transmembrane transporter activity
5. P GO:0015768 maltose transport
5. P GO:0015112 nitrate transmembrane transporter activity
5. P GO:0010438 cellular response to sulfur starvation
5. P GO:0090482 vitamin transmembrane transporter activity
5. P GO:0015620 ferric-enterobactin transmembrane transporter activity
5. P GO:0015685 ferric-enterobactin import into cell
5. P GO:0003834 beta-carotene 15,15'-dioxygenase activity
5. P GO:0010921 regulation of phosphatase activity
6. F GO:0048473 D-methionine transport
6. F GO:0033223 2-aminoethylphosphonate transport
6. F GO:0003333 amino acid transmembrane transport

Uniprot GO Annotations

GO Description
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0055085 transmembrane transport
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P0A4M7 Oligopeptide transport system permease protein AmiC 5.33e-09 3.10e-09 3.35e-28 0.6925
1. PBF P47324 Oligopeptide transport system permease protein OppC 3.06e-07 2.27e-32 0.012 0.4886
1. PBF P0AFH3 Oligopeptide transport system permease protein OppB 0.00e+00 3.44e-18 1.14e-10 0.8061
1. PBF Q83S25 Glutathione transport system permease protein GsiD 9.73e-08 3.10e-06 0.016 0.6629
1. PBF P75553 Oligopeptide transport system permease protein OppC 2.82e-08 8.68e-31 0.044 0.4988
1. PBF Q2FH55 Nickel import system permease protein NikB 0.00e+00 5.43e-11 4.11e-06 0.7495
1. PBF Q8FWN8 Putative peptide permease protein BRA0408/BS1330_II0405 0.00e+00 2.55e-13 1.27e-11 0.8213
1. PBF Q8Z862 Glutathione transport system permease protein GsiC 0.00e+00 4.49e-13 1.37e-06 0.8329
1. PBF P26903 Dipeptide transport system permease protein DppB 0.00e+00 1.84e-16 5.46e-19 0.7941
1. PBF Q7A5Q6 Nickel import system permease protein NikB 0.00e+00 2.35e-11 4.38e-06 0.7584
1. PBF Q2YXY7 Nickel import system permease protein NikB 0.00e+00 9.22e-12 1.65e-06 0.7592
1. PBF Q8FJK9 Glutathione transport system permease protein GsiC 0.00e+00 1.14e-12 2.32e-06 0.8342
1. PBF P0A4N7 Oligopeptide transport system permease protein OppB 0.00e+00 4.55e-16 1.04e-14 0.7784
1. PBF P0AFU1 Inner membrane ABC transporter permease protein YejB 0.00e+00 4.14e-18 1.35e-14 0.6567
1. PBF Q0T6D1 Glutathione transport system permease protein GsiC 0.00e+00 8.98e-13 2.73e-06 0.8337
1. PBF Q32IB8 Glutathione transport system permease protein GsiD 8.92e-08 3.18e-06 0.005 0.6855
1. PBF Q1RE93 Glutathione transport system permease protein GsiD 5.48e-09 3.52e-06 0.031 0.6657
1. PBF Q3Z3V2 Glutathione transport system permease protein GsiC 0.00e+00 7.20e-13 2.65e-06 0.8082
1. PBF Q6D3B1 Glutathione transport system permease protein GsiC 0.00e+00 3.44e-13 4.28e-07 0.8628
1. PBF Q5PGP5 Glutathione transport system permease protein GsiC 0.00e+00 5.05e-13 1.20e-06 0.8134
1. PBF Q8X6V6 Glutathione transport system permease protein GsiD 1.01e-07 4.75e-06 0.018 0.5479
1. PBF Q5HG38 Nickel import system permease protein NikB 0.00e+00 5.43e-11 4.11e-06 0.7594
1. PBF A1A971 Glutathione transport system permease protein GsiD 5.71e-09 3.52e-06 0.031 0.6883
1. PBF P45096 Dipeptide transport system permease protein DppB 0.00e+00 1.98e-10 1.94e-06 0.782
1. PBF Q8YBN9 Putative peptide permease protein BMEII0860 0.00e+00 6.69e-13 4.20e-11 0.8149
1. PBF Q2YJK1 Putative peptide transport system permease protein BAB2_1050 0.00e+00 2.52e-14 5.24e-12 0.828
1. PBF P08005 Oligopeptide transport system permease protein OppB 0.00e+00 4.00e-18 8.66e-12 0.8129
1. PBF Q57RB0 Glutathione transport system permease protein GsiC 0.00e+00 4.49e-13 1.37e-06 0.8342
1. PBF P0A4N8 Oligopeptide transport system permease protein OppB 0.00e+00 4.55e-16 1.04e-14 0.7678
1. PBF Q8NWT4 Nickel import system permease protein NikB 0.00e+00 6.23e-11 5.19e-06 0.752
1. PBF P0AEG0 Dipeptide transport system permease protein DppB 0.00e+00 1.43e-09 5.23e-10 0.7529
1. PBF Q323W3 Glutathione transport system permease protein GsiC 0.00e+00 1.20e-12 2.80e-06 0.833
1. PBF Q6GH25 Nickel import system permease protein NikB 0.00e+00 1.80e-10 1.52e-06 0.7436
1. PBF P45286 Peptide transport system permease protein SapB 0.00e+00 2.03e-05 0.018 0.6583
1. PBF Q323W2 Glutathione transport system permease protein GsiD 5.02e-09 4.75e-06 0.018 0.6713
1. PBF Q0TJL7 Glutathione transport system permease protein GsiC 0.00e+00 1.68e-12 2.58e-06 0.8333
1. PBF Q3Z3V1 Glutathione transport system permease protein GsiD 4.46e-09 4.75e-06 0.018 0.672
1. PBF Q8VQK4 Putative peptide transport system permease protein BruAb2_1031 0.00e+00 2.52e-14 5.24e-12 0.8295
1. PBF Q0TJL6 Glutathione transport system permease protein GsiD 9.22e-08 3.36e-06 0.020 0.6633
1. PBF P45054 Oligopeptide transport system permease protein OppB 0.00e+00 4.89e-18 1.80e-12 0.846
1. PBF Q32IB7 Glutathione transport system permease protein GsiC 0.00e+00 1.68e-12 2.58e-06 0.8328
1. PBF A2RI75 Dipeptide transport system permease protein DppB 0.00e+00 2.01e-10 3.68e-17 0.8086
1. PBF Q8FUX0 Putative peptide transport system permease protein BRA1092/BS1330_II1084 0.00e+00 4.51e-14 9.99e-12 0.8284
1. PBF P42062 Oligopeptide transport system permease protein AppB 0.00e+00 3.27e-18 3.15e-18 0.7994
1. PBF A0A0H3K104 Metal-staphylopine import system permease protein CntB 0.00e+00 6.72e-17 9.39e-13 0.78
1. PBF A0A0H2ZGW7 Di/tripeptide transport system permease protein DppB 0.00e+00 1.85e-11 4.44e-09 0.7407
1. PBF P0A4M8 Oligopeptide transport system permease protein AmiC 1.37e-08 3.10e-09 3.35e-28 0.6977
1. PBF Q8ZQM2 Glutathione transport system permease protein GsiC 0.00e+00 5.21e-13 1.21e-06 0.8721
1. PBF P0AFH4 Oligopeptide transport system permease protein OppB 0.00e+00 3.44e-18 1.14e-10 0.8044
1. PBF A0A0H2ZFV0 Di/tripeptide transport system permease protein DppC 4.06e-07 9.07e-05 0.024 0.7186
1. PBF Q8X6V7 Glutathione transport system permease protein GsiC 0.00e+00 1.76e-12 2.63e-06 0.8357
1. PBF P9WFZ6 Putative peptide transport permease protein MT1320 0.00e+00 2.29e-12 6.67e-05 0.7089
1. PBF Q8FJK8 Glutathione transport system permease protein GsiD 9.54e-08 3.36e-06 0.020 0.548
1. PBF A5VU90 Putative peptide permease protein BOV_A0351 0.00e+00 6.69e-13 4.20e-11 0.7738
1. PBF P0C2L2 Glutathione transport system permease protein GsiD 1.00e-07 3.10e-06 0.016 0.676
1. PBF P0AEF9 Dipeptide transport system permease protein DppB 0.00e+00 1.43e-09 5.23e-10 0.7478
1. PBF P66967 Putative peptide transport permease protein Mb1314c 0.00e+00 2.29e-12 6.67e-05 0.7828
1. PBF Q99UA0 Nickel import system permease protein NikB 0.00e+00 2.35e-11 4.38e-06 0.7507
1. PBF Q1RE94 Glutathione transport system permease protein GsiC 0.00e+00 1.68e-12 2.58e-06 0.8306
1. PBF Q83S26 Glutathione transport system permease protein GsiC 0.00e+00 1.71e-12 2.77e-06 0.8231
1. PBF A1A970 Glutathione transport system permease protein GsiC 0.00e+00 1.68e-12 2.58e-06 0.8291
1. PBF P24138 Oligopeptide transport system permease protein OppB 0.00e+00 2.67e-13 4.17e-12 0.7915
1. PBF Q6G9H8 Nickel import system permease protein NikB 0.00e+00 6.23e-11 5.19e-06 0.7497
1. PBF Q8YDG7 Putative peptide transport system permease protein BMEII0209 0.00e+00 1.74e-14 5.96e-12 0.8245
1. PBF P94311 Dipeptide transport system permease protein DppB 0.00e+00 2.21e-09 1.96e-06 0.7053
1. PBF Q53191 Probable peptide ABC transporter permease protein y4tP 0.00e+00 1.26e-12 1.12e-11 0.8262
1. PBF P0AFH5 Oligopeptide transport system permease protein OppB 0.00e+00 3.44e-18 1.14e-10 0.8037
2. PF Q53192 Probable peptide ABC transporter permease protein y4tQ 5.93e-11 6.42e-05 NA 0.5705
2. PF P0A627 Phosphate transport system permease protein PstA 2 1.08e-08 2.52e-03 NA 0.643
2. PF Q74RF9 Maltose/maltodextrin transport system permease protein MalF 5.74e-05 4.28e-06 NA 0.5144
2. PF P0AGH4 Peptide transport system permease protein SapB 0.00e+00 2.95e-07 NA 0.6494
2. PF Q50097 Phosphate transport system permease protein PstA 7.78e-09 4.30e-04 NA 0.731
2. PF Q57RA9 Glutathione transport system permease protein GsiD 6.41e-09 1.64e-06 NA 0.6811
2. PF P26904 Dipeptide transport system permease protein DppC 3.97e-08 3.41e-08 NA 0.5177
2. PF Q50098 Phosphate transport system permease protein PstC 1.16e-07 1.51e-02 NA 0.6157
2. PF P9WFZ8 Putative peptide transport permease protein MT1319 1.41e-07 2.45e-04 NA 0.6467
2. PF O69062 Putative phosphite transport system permease protein HtxC 1.11e-09 3.41e-05 NA 0.6985
2. PF Q9PBK2 Phosphate transport system permease protein PstC 2.05e-08 1.66e-06 NA 0.635
2. PF Q5PGP6 Glutathione transport system permease protein GsiD 4.39e-07 1.64e-06 NA 0.5523
2. PF P46339 Probable ABC transporter permease protein YqgH 6.46e-08 1.73e-07 NA 0.5733
2. PF P66965 Putative peptide transport permease protein Mb1313c 1.18e-07 2.45e-04 NA 0.631
2. PF Q8FWN9 Putative peptide permease protein BRA0407/BS1330_II0404 1.54e-08 7.72e-05 NA 0.508
2. PF Q8XF88 Glutathione transport system permease protein GsiD 5.05e-09 1.64e-06 NA 0.6786
2. PF P0AFH7 Oligopeptide transport system permease protein OppC 8.03e-08 3.18e-06 NA 0.6231
2. PF P0A2J5 Peptide transport system permease protein SapC 2.87e-08 9.18e-06 NA 0.643
2. PF Q8FUW9 Putative peptide transport system permease protein BRA1093/BS1330_II1085 2.46e-07 2.90e-05 NA 0.5529
2. PF P94312 Dipeptide transport system permease protein DppC 7.13e-08 1.54e-06 NA 0.673
2. PF P0AEG2 Dipeptide transport system permease protein DppC 2.58e-08 2.05e-04 NA 0.5404
2. PF Q8VQK5 Putative peptide transport system permease protein BruAb2_1032 1.43e-08 5.17e-05 NA 0.5541
2. PF P0AGH7 Peptide transport system permease protein SapC 2.98e-09 1.11e-05 NA 0.6417
2. PF Q7CQV4 Glutathione transport system permease protein GsiD 7.56e-09 1.64e-06 NA 0.5506
2. PF P0AFB0 Nickel transport system permease protein NikC 6.58e-09 1.80e-03 NA 0.5597
2. PF Q577J7 Putative peptide permease protein BruAb2_0794 2.01e-08 1.25e-04 NA 0.5059
2. PF A2RI76 Dipeptide transport system permease protein DppC 1.57e-07 6.50e-19 NA 0.5311
2. PF P0AEG3 Dipeptide transport system permease protein DppC 1.86e-08 2.05e-04 NA 0.6602
2. PF Q9Z3R7 Alpha-glucoside transport system permease protein AglG 8.80e-06 4.97e-06 NA 0.5422
2. PF P0AGH6 Peptide transport system permease protein SapC 3.21e-09 1.11e-05 NA 0.6646
2. PF Q6D3B2 Glutathione transport system permease protein GsiD 5.40e-09 1.03e-05 NA 0.5507
2. PF P9WG08 Phosphate transport system permease protein PstA 2 9.27e-09 2.52e-03 NA 0.6934
2. PF A5VU89 Putative peptide permease protein BOV_A0350 1.50e-08 3.89e-05 NA 0.5095
2. PF Q2YK65 Putative peptide permease protein BAB2_0815 1.56e-07 1.25e-04 NA 0.5056
2. PF P9WG04 Phosphate transport system permease protein PstC 2 4.54e-08 5.29e-04 NA 0.5925
2. PF P0A2J3 Peptide transport system permease protein SapB 0.00e+00 6.68e-07 NA 0.6569
2. PF Q8YBN8 Putative peptide permease protein BMEII0861 1.94e-08 1.25e-04 NA 0.5165
2. PF P08006 Oligopeptide transport system permease protein OppC 1.09e-07 1.19e-06 NA 0.6449
2. PF Q8YDG8 Putative peptide transport system permease protein BMEII0207/BMEII0208 1.78e-08 5.17e-05 NA 0.6582
2. PF Q2YJK0 Putative peptide transport system permease protein BAB2_1051 1.01e-07 5.17e-05 NA 0.5547
2. PF P9WG10 Phosphate transport system permease protein PstA 1 4.05e-09 7.15e-05 NA 0.7104
2. PF Q57SD8 Putative 2-aminoethylphosphonate transport system permease protein PhnV 2.56e-10 6.21e-03 NA 0.5934
2. PF Q5PFQ5 Putative 2-aminoethylphosphonate transport system permease protein PhnV 1.71e-10 1.04e-02 NA 0.586
2. PF P24139 Oligopeptide transport system permease protein OppC 5.26e-09 2.30e-09 NA 0.5438
2. PF P18812 Maltose/maltodextrin transport system permease protein MalF 1.13e-05 7.22e-08 NA 0.4268
2. PF P0A4P0 Oligopeptide transport system permease protein OppC 5.61e-12 2.52e-03 NA 0.6451
2. PF P51000 Dipeptide transport system permease protein DppC 1.80e-08 6.92e-06 NA 0.5557
2. PF Q8Z1U2 Maltose/maltodextrin transport system permease protein MalF 1.80e-05 3.45e-07 NA 0.4232
2. PF Q7N984 Maltose/maltodextrin transport system permease protein MalF 3.85e-05 2.35e-06 NA 0.4919
2. PF P0A2J4 Peptide transport system permease protein SapB 0.00e+00 6.68e-07 NA 0.644
2. PF P45053 Oligopeptide transport system permease protein OppC 2.37e-08 1.86e-07 NA 0.6539
2. PF P45190 Phosphate transport system permease protein PstA 3.12e-08 2.21e-03 NA 0.6258
2. PF P0A4N9 Oligopeptide transport system permease protein OppC 7.11e-12 2.72e-03 NA 0.6628
2. PF P0A4N0 Oligopeptide transport system permease protein AmiD 4.10e-08 7.85e-10 NA 0.7028
2. PF P0A4M9 Oligopeptide transport system permease protein AmiD 2.02e-09 7.85e-10 NA 0.6827
2. PF P0A2J6 Peptide transport system permease protein SapC 3.80e-08 9.18e-06 NA 0.6546
2. PF P42063 Oligopeptide transport system permease protein AppC 8.50e-08 1.42e-05 NA 0.6539
3. BF P75554 Oligopeptide transport system permease protein OppB 0.00e+00 NA 1.34e-12 0.7056
3. BF P47323 Oligopeptide transport system permease protein OppB 0.00e+00 NA 6.35e-10 0.7067
4. PB P77308 Probable D,D-dipeptide transport system permease protein DdpB 0.00e+00 1.77e-10 0.004 NA
4. PB P0AFH2 Oligopeptide transport system permease protein OppB 0.00e+00 3.44e-18 1.14e-10 NA
4. PB P0AEF8 Dipeptide transport system permease protein DppB 0.00e+00 1.43e-09 5.23e-10 NA
4. PB P75798 Glutathione transport system permease protein GsiC 0.00e+00 1.68e-12 2.58e-06 NA
4. PB P9WFZ7 Putative peptide transport permease protein Rv1283c 0.00e+00 2.29e-12 6.67e-05 NA
4. PB P33591 Nickel transport system permease protein NikB 0.00e+00 1.04e-13 4.89e-10 NA
4. PB P0AFU0 Inner membrane ABC transporter permease protein YejB 0.00e+00 4.14e-18 1.35e-14 NA
4. PB Q2FVE8 Metal-staphylopine import system permease protein CntB 0.00e+00 9.78e-17 1.33e-12 NA
4. PB Q2FYQ5 Nickel import system permease protein NikB 0.00e+00 5.43e-11 4.11e-06 NA
4. PB P75799 Glutathione transport system permease protein GsiD 9.60e-08 4.14e-06 0.014 NA
5. P D4GPW2 Glucose ABC transporter permease protein TsgB13 6.19e-03 4.06e-03 NA NA
5. P B4T4N5 Vitamin B12 import system permease protein BtuC 4.40e-03 3.23e-02 NA NA
5. P Q98FL4 Phosphate transport system permease protein PstA 2.45e-08 1.60e-02 NA NA
5. P B4TGH8 Vitamin B12 import system permease protein BtuC 4.67e-03 3.09e-02 NA NA
5. P P68184 Maltose/maltodextrin transport system permease protein MalG 2.58e-07 6.23e-04 NA NA
5. P P0AGH5 Putrescine export system permease protein SapC 2.95e-09 1.11e-05 NA NA
5. P P0A631 Phosphate transport system permease protein PstC 2 3.08e-08 5.29e-04 NA NA
5. P O58967 Probable ABC transporter permease protein PH1216 4.77e-09 2.45e-02 NA NA
5. P A9N235 Vitamin B12 import system permease protein BtuC 4.39e-03 3.09e-02 NA NA
5. P P94529 Arabinooligosaccharides transport system permease protein AraP 6.04e-08 1.02e-02 NA NA
5. P P9WG06 Phosphate transport system permease protein PstC 1 1.22e-06 6.61e-06 NA NA
5. P P45191 Phosphate transport system permease protein PstC 8.64e-08 7.55e-05 NA NA
5. P P18795 Probable transport system permease protein NifC 7.18e-09 1.98e-02 NA NA
5. P P0AFH6 Oligopeptide transport system permease protein OppC 8.09e-08 3.18e-06 NA NA
5. P Q55106 Bicarbonate transport system permease protein CmpB 1.89e-06 4.43e-03 NA NA
5. P P26467 Maltose/maltodextrin transport system permease protein MalF 1.99e-05 2.35e-07 NA NA
5. P Q7N3Q3 Vitamin B12 import system permease protein BtuC 2.38e-03 8.20e-04 NA NA
5. P O32261 Galactooligosaccharides transport system permease protein GanP 1.83e-06 5.58e-07 NA NA
5. P P02916 Maltose/maltodextrin transport system permease protein MalF 3.50e-05 7.26e-07 NA NA
5. P P96065 Putative 2-aminoethylphosphonate transport system permease protein PhnV 1.64e-10 1.34e-02 NA NA
5. P Q8Z8X0 Putative 2-aminoethylphosphonate transport system permease protein PhnV 1.85e-10 2.83e-03 NA NA
5. P P31135 Putrescine transport system permease protein PotH 2.74e-07 3.15e-03 NA NA
5. P Q8D3U8 Maltose/maltodextrin transport system permease protein MalF 1.17e-04 5.58e-05 NA NA
5. P B5RAW6 Vitamin B12 import system permease protein BtuC 4.40e-03 3.23e-02 NA NA
5. P B5BA35 Vitamin B12 import system permease protein BtuC 4.37e-03 3.80e-02 NA NA
5. P A8AHA4 Vitamin B12 import system permease protein BtuC 3.98e-03 1.91e-02 NA NA
5. P P0AGH3 Putrescine export system permease protein SapB 0.00e+00 2.95e-07 NA NA
5. P Q6D656 Vitamin B12 import system permease protein BtuC 1.62e-03 1.57e-02 NA NA
5. P O06990 Maltodextrin transport system permease protein MdxF 2.14e-06 1.75e-08 NA NA
5. P D4GP37 Xylose/arabinose import permease protein XacI 1.12e-07 3.77e-02 NA NA
5. P Q83P81 Maltose/maltodextrin transport system permease protein MalF 5.37e-06 1.19e-06 NA NA
5. P P55603 Probable ABC transporter permease protein y4oR 6.07e-08 8.85e-03 NA NA
5. P P58655 Phosphate transport system permease protein PstA 4.98e-10 4.34e-05 NA NA
5. P Q89AW1 Putative transport protein bbp_117 3.58e-04 2.41e-02 NA NA
5. P Q8ZDX4 Vitamin B12 import system permease protein BtuC 1.42e-03 1.73e-02 NA NA
5. P Q321G8 Vitamin B12 import system permease protein BtuC 6.39e-03 4.40e-02 NA NA
5. P P9WG09 Phosphate transport system permease protein PstA 2 8.07e-09 2.52e-03 NA NA
5. P O34382 Uncharacterized membrane protein YvoD 7.39e-03 4.43e-03 NA NA
5. P O07011 Galactooligosaccharides transport system permease protein GanQ 1.89e-06 4.48e-02 NA NA
5. P Q57130 Molybdate import system permease protein MolB 4.66e-03 4.56e-02 NA NA
5. P Q9N1R2 Excitatory amino acid transporter 4 2.11e-03 3.95e-03 NA NA
5. P Q87GB7 Maltose/maltodextrin transport system permease protein MalF 2.99e-05 5.58e-05 NA NA
5. P Q92WD8 sn-glycerol-3-phosphate transport system permease protein UgpA 6.95e-10 1.28e-02 NA NA
5. P Q7N983 Maltose/maltodextrin transport system permease protein MalG 9.42e-05 4.53e-04 NA NA
5. P B1JJ25 Vitamin B12 import system permease protein BtuC 1.25e-03 1.73e-02 NA NA
5. P P94418 Petrobactin import system permease protein YclN 2.24e-03 3.03e-02 NA NA
5. P Q9CNJ6 Phosphate transport system permease protein PstA 5.67e-09 7.82e-03 NA NA
5. P Q97UY9 Glucose import system permease protein GlcU 9.51e-06 1.04e-02 NA NA
5. P Q9CNJ5 Phosphate transport system permease protein PstC 3.50e-07 2.25e-05 NA NA
5. P P0AGH8 Phosphate transport system permease protein PstC 1.30e-07 3.23e-05 NA NA
5. P P18814 Maltose/maltodextrin transport system permease protein MalG 4.01e-05 9.08e-04 NA NA
5. P B5FJA1 Vitamin B12 import system permease protein BtuC 4.70e-03 3.09e-02 NA NA
5. P P0A4N1 Maltodextrin transport system permease protein MalC 1.25e-06 5.16e-08 NA NA
5. P Q5PH87 Vitamin B12 import system permease protein BtuC 3.73e-03 3.80e-02 NA NA
5. P P0AEG1 Dipeptide transport system permease protein DppC 1.45e-08 2.05e-04 NA NA
5. P Q7MFC2 Maltose/maltodextrin transport system permease protein MalF 1.30e-04 5.58e-05 NA NA
5. P P39128 Protein LplB 5.65e-08 1.63e-04 NA NA
5. P A9MFB6 Vitamin B12 import system permease protein BtuC 4.95e-03 1.81e-02 NA NA
5. P P16701 Sulfate transport system permease protein CysT 2.39e-09 4.99e-02 NA NA
5. P P75263 Probable ABC transporter permease protein MG188 homolog 5.07e-08 2.16e-02 NA NA
5. P P27370 Sulfate transport system permease protein CysW 3.91e-07 4.48e-02 NA NA
5. P Q52814 General L-amino acid transport system permease protein AapM 5.01e-06 3.20e-15 NA NA
5. P Q98FL3 Phosphate transport system permease protein PstC 1.17e-07 7.61e-07 NA NA
5. P Q2FZE5 Probable heme-iron transport system permease protein IsdF 2.38e-03 2.62e-02 NA NA
5. P B5QVW1 Vitamin B12 import system permease protein BtuC 3.00e-03 3.23e-02 NA NA
5. P P68185 Maltose/maltodextrin transport system permease protein MalG 2.21e-07 6.23e-04 NA NA
5. P P23877 Ferric enterobactin transport system permease protein FepG 2.86e-03 4.32e-02 NA NA
5. P Q9KL06 Maltose/maltodextrin transport system permease protein MalF 3.75e-05 5.18e-04 NA NA
5. P P9WG05 Phosphate transport system permease protein PstC 2 6.15e-07 5.29e-04 NA NA
5. P P0AGI0 Phosphate transport system permease protein PstC 1.16e-07 3.23e-05 NA NA
5. P P49936 Iron(3+)-hydroxamate import system permease protein FhuB 1.07e-02 2.32e-05 NA NA
5. P Q8D3U7 Maltose/maltodextrin transport system permease protein MalG 7.33e-05 7.41e-04 NA NA
5. P Q58420 Probable phosphate transport system permease protein PstC 2.55e-07 1.82e-05 NA NA
5. P P68183 Maltose/maltodextrin transport system permease protein MalG 1.70e-06 6.23e-04 NA NA
5. P A8GDR2 Vitamin B12 import system permease protein BtuC 1.46e-03 6.91e-03 NA NA
5. P Q7A937 Maltose/maltodextrin transport system permease protein MalF 4.91e-05 2.03e-07 NA NA
5. P A6TAH6 Vitamin B12 import system permease protein BtuC 3.41e-03 7.04e-03 NA NA
5. P Q8ZPS8 Vitamin B12 import system permease protein BtuC 3.06e-03 3.09e-02 NA NA
5. P Q57PU6 Vitamin B12 import system permease protein BtuC 3.03e-03 3.67e-02 NA NA
5. P P0AFA9 Nickel transport system permease protein NikC 7.17e-09 1.80e-03 NA NA
5. P A7FHG9 Vitamin B12 import system permease protein BtuC 1.49e-03 1.73e-02 NA NA
5. P Q04454 Putative transport protein BpOF4_00890 8.83e-04 1.10e-02 NA NA
5. P O34876 Cell division protein FtsX 3.17e-04 2.82e-02 NA NA
5. P P75262 Probable ABC transporter permease protein MG189 homolog 5.80e-06 1.33e-02 NA NA
5. P Q5MZ55 Bicarbonate transport system permease protein CmpB 2.12e-07 4.43e-03 NA NA
5. P Q8Z1U3 Maltose/maltodextrin transport system permease protein MalG 3.87e-05 1.39e-03 NA NA
5. P P9WFZ9 Putative peptide transport permease protein Rv1282c 1.54e-07 2.45e-04 NA NA
5. P A0A140NFA3 Phosphonate transport system permease protein PhnE 2.35e-09 2.89e-03 NA NA
5. P Q9KL07 Maltose/maltodextrin transport system permease protein MalG 8.38e-05 4.63e-04 NA NA
5. P P37738 Ferric-anguibactin transport system permease protein FatD 3.07e-03 3.23e-02 NA NA
5. P Q74RF8 Maltose/maltodextrin transport system permease protein MalG 4.39e-06 5.59e-03 NA NA
5. P O30143 Molybdate/tungstate transport system permease protein WtpB 2.35e-09 4.94e-02 NA NA
5. P Q00750 Multiple sugar-binding transport system permease protein MsmF 7.42e-10 3.51e-03 NA NA
5. P Q52665 Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC 6.63e-06 3.23e-10 NA NA
5. P O32154 Probable ABC transporter permease protein YurM 7.34e-07 6.04e-03 NA NA
5. P P0AGH9 Phosphate transport system permease protein PstC 1.24e-07 3.23e-05 NA NA
5. P O31520 Probable ABC transporter permease protein YesQ 9.16e-05 3.48e-03 NA NA
5. P Q8FB38 Maltose/maltodextrin transport system permease protein MalF 5.12e-06 2.70e-06 NA NA
5. P A1JPQ9 Vitamin B12 import system permease protein BtuC 1.05e-03 1.15e-02 NA NA
5. P P44872 Cell division protein FtsX 4.45e-04 1.07e-02 NA NA
5. P P33361 Glycine betaine uptake system permease protein YehY 9.78e-08 1.02e-09 NA NA
5. P A9R099 Vitamin B12 import system permease protein BtuC 9.61e-04 1.73e-02 NA NA
5. P P33915 Inner membrane ABC transporter permease protein YejE 1.19e-07 2.03e-16 NA NA
5. P Q47086 Achromobactin transport system permease protein CbrC 9.15e-03 2.68e-05 NA NA
5. P P68186 Maltose/maltodextrin transport system permease protein MalG 3.37e-07 6.23e-04 NA NA
5. P O69053 Phosphite transport system permease protein PtxC 7.54e-09 3.77e-05 NA NA
5. P P9WG11 Phosphate transport system permease protein PstA 1 3.29e-09 6.56e-05 NA NA
5. P B2K660 Vitamin B12 import system permease protein BtuC 1.27e-03 1.73e-02 NA NA
5. P P66896 Sec-independent protein translocase protein TatC 1.59e-03 9.64e-03 NA NA
5. P P45767 Putative amino-acid ABC transporter permease protein YhdX 3.56e-05 1.75e-08 NA NA
5. P P0A4N2 Maltodextrin transport system permease protein MalC 2.98e-06 5.16e-08 NA NA
5. P Q52813 General L-amino acid transport system permease protein AapQ 2.69e-05 5.63e-08 NA NA
5. P Q81XB1 Petrobactin import system permease protein FatD 3.81e-03 1.83e-03 NA NA
5. P Q9HNE6 Probable beta-carotene 15,15'-dioxygenase Blh 2.08e-04 1.06e-02 NA NA
5. P P26468 Maltose/maltodextrin transport system permease protein MalG 3.44e-05 1.13e-03 NA NA
5. P P9WG07 Phosphate transport system permease protein PstC 1 1.88e-06 6.61e-06 NA NA
5. P P9WG96 Sec-independent protein translocase protein TatC 3.56e-03 9.64e-03 NA NA
5. P Q9Z3R6 Alpha-glucoside transport system permease protein AglF 5.17e-06 1.32e-04 NA NA
5. P P45768 Inner membrane amino-acid ABC transporter permease protein YhdY 6.10e-06 1.76e-12 NA NA
5. P Q9RR45 Glycine betaine/carnitine transport permease protein GbuB 5.02e-08 1.08e-03 NA NA
5. P P77463 Probable D,D-dipeptide transport system permease protein DdpC 7.49e-08 1.13e-03 NA NA
5. P B4TUF7 Vitamin B12 import system permease protein BtuC 4.40e-03 3.09e-02 NA NA
5. P P07654 Phosphate transport system permease protein PstA 2.61e-09 7.12e-04 NA NA
5. P Q52664 Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB 4.26e-05 7.00e-06 NA NA
5. P C0SPB3 Polygalacturonan/rhamnogalacturonan transport system permease protein YteP 9.74e-09 1.24e-04 NA NA
5. P P9WG97 Sec-independent protein translocase protein TatC 1.53e-03 9.64e-03 NA NA
5. P O27279 Putative transport protein MTH_1211 3.13e-03 1.42e-02 NA NA
5. P P0A629 Phosphate transport system permease protein PstC 1 1.16e-06 6.61e-06 NA NA
5. P P23876 Ferric enterobactin transport system permease protein FepD 2.92e-03 3.06e-02 NA NA
5. P P48664 Excitatory amino acid transporter 4 4.64e-03 3.67e-02 NA NA
5. P Q47539 Taurine transport system permease protein TauC 2.00e-08 1.11e-04 NA NA
5. P B5F7F5 Vitamin B12 import system permease protein BtuC 3.07e-03 3.09e-02 NA NA
5. P Q9KEF0 Arabinooligosaccharides transport system permease protein AraP 5.88e-06 1.81e-02 NA NA
5. P P77716 Inner membrane ABC transporter permease protein YcjP 2.69e-07 1.07e-03 NA NA
5. P Q8Z6I5 Vitamin B12 import system permease protein BtuC 7.28e-03 3.77e-02 NA NA
5. P P45287 Peptide transport system permease protein SapC 9.41e-11 1.89e-04 NA NA
5. P Q669Z9 Vitamin B12 import system permease protein BtuC 9.68e-04 1.73e-02 NA NA
5. P A9WGD1 Riboflavin transport system permease protein RibX 6.59e-08 2.70e-04 NA NA
5. P Q87GB8 Maltose/maltodextrin transport system permease protein MalG 9.34e-05 7.88e-04 NA NA
5. P Q7MFC1 Maltose/maltodextrin transport system permease protein MalG 8.65e-05 7.41e-04 NA NA
5. P Q87C90 Phosphate transport system permease protein PstC 1.42e-08 2.07e-06 NA NA
6. F O57893 Molybdate/tungstate transport system permease protein WtpB 2.70e-09 NA NA 0.6633
6. F Q93KD5 Tungstate uptake system permease protein TupB 4.15e-12 NA NA 0.6621
6. F A0A0H3JU73 Metal-staphylopine import system permease protein CntC 1.59e-10 NA NA 0.6812
6. F Q01895 Sulfate transport system permease protein CysT 3.56e-07 NA NA 0.6423
6. F Q6G9H9 Nickel import system permease protein NikC 2.84e-09 NA NA 0.6712
6. F P0AEQ9 Glutamine transport system permease protein GlnP 4.81e-14 NA NA 0.6879
6. F Q9TKU8 Probable sulfate transport system permease protein cysT 6.58e-08 NA NA 0.6332
6. F Q8ZRN0 D-methionine transport system permease protein MetI 2.00e-15 NA NA 0.7066
6. F P0AE36 Arginine ABC transporter permease protein ArtQ 5.62e-14 NA NA 0.6469
6. F P45322 Molybdenum transport system permease protein ModB 8.35e-11 NA NA 0.6194
6. F Q87C89 Phosphate transport system permease protein PstA 1.38e-08 NA NA 0.5746
6. F P0AER6 Glutamate/aspartate import permease protein GltK 5.11e-13 NA NA 0.6673
6. F P0AE35 Arginine ABC transporter permease protein ArtQ 4.00e-14 NA NA 0.637
6. F Q99UA1 Nickel import system permease protein NikC 2.55e-09 NA NA 0.6318
6. F P0AF02 Molybdenum transport system permease protein ModB 1.73e-11 NA NA 0.6387
6. F P45169 Spermidine/putrescine transport system permease protein PotC 3.52e-09 NA NA 0.7161
6. F Q9TJR4 Probable sulfate transport system permease protein cysT 1.15e-08 NA NA 0.5785
6. F Q7A5Q7 Nickel import system permease protein NikC 2.94e-09 NA NA 0.6212
6. F Q7A0Y0 Nickel import system permease protein NikC 3.22e-09 NA NA 0.6293
6. F Q9PBK1 Phosphate transport system permease protein PstA 1.34e-08 NA NA 0.6454
6. F P48245 Glutamate transport system permease protein GluD 9.26e-13 NA NA 0.6507
6. F P54536 Arginine transport system permease protein ArtQ 3.74e-14 NA NA 0.7144
6. F Q8Z8W9 Putative 2-aminoethylphosphonate transport system permease protein PhnU 1.41e-07 NA NA 0.5699
6. F Q2FH56 Nickel import system permease protein NikC 2.93e-09 NA NA 0.631
6. F P0AER4 Glutamate/aspartate import permease protein GltJ 1.89e-09 NA NA 0.6092
6. F P54953 Probable amino-acid permease protein YxeN 2.00e-13 NA NA 0.7785
6. F Q2YXY8 Nickel import system permease protein NikC 2.06e-09 NA NA 0.6504
6. F Q5HG39 Nickel import system permease protein NikC 2.89e-09 NA NA 0.6717
6. F P0A2J0 Histidine transport system permease protein HisQ 2.21e-13 NA NA 0.6244
6. F P45090 Arginine ABC transporter permease protein ArtQ 9.50e-14 NA NA 0.7075
6. F Q8RQL5 Glutamate transport system permease protein GluC 7.28e-14 NA NA 0.6535
6. F Q08382 Molybdenum transport system permease protein ModB 3.47e-12 NA NA 0.709
6. F Q8RQL4 Glutamate transport system permease protein GluD 1.22e-12 NA NA 0.655
6. F O34671 Probable glutamine ABC transporter permease protein GlnM 1.39e-13 NA NA 0.6775
6. F P0AFK7 Spermidine/putrescine transport system permease protein PotC 1.88e-09 NA NA 0.6609
6. F P0A2I9 Histidine transport system permease protein HisQ 2.62e-13 NA NA 0.6249
6. F P48244 Glutamate transport system permease protein GluC 7.78e-14 NA NA 0.63
6. F P0AFK8 Spermidine/putrescine transport system permease protein PotC 1.19e-09 NA NA 0.6851
6. F Q6GH26 Nickel import system permease protein NikC 2.04e-09 NA NA 0.6304
6. F P27367 Sulfate transport system permease protein CysT 6.61e-09 NA NA 0.626
6. F Q97UZ0 Glucose import system permease protein GlcT 6.13e-10 NA NA 0.6084
6. F P0AER7 Glutamate/aspartate import permease protein GltK 4.16e-13 NA NA 0.6404
6. F O34606 Probable glutamine ABC transporter permease protein GlnP 9.69e-14 NA NA 0.7419
6. F P9WG12 Molybdenum transport system permease protein ModB 2.01e-08 NA NA 0.533
6. F P0AEQ8 Glutamine transport system permease protein GlnP 3.83e-14 NA NA 0.6644
6. F P45089 Arginine ABC transporter permease protein ArtM 5.70e-13 NA NA 0.6863
6. F Q83RR7 Spermidine/putrescine transport system permease protein PotC 1.93e-09 NA NA 0.6634