Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54651.1

JCVISYN3A_0168

Oligopeptide ABC transporter ATP-binding protein.
M. mycoides homolog: Q6MU58.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 470
Unique PROST Go: 3
Unique BLAST Go: 405
Unique Foldseek Go: 2

Total Homologs: 3537
Unique PROST Homologs: 1
Unique BLAST Homologs: 2508
Unique Foldseek Homologs: 6

Literature

Danchin and Fang [1]: oligopeptide ABC transporter (ATP-binding protein)|may be involved in cell to cell communication (essential for colony formation)
Yang and Tsui [2]: Oligopeptide transport ATP-binding protein OppF
Antczak et al. [3]: oppF; Oligopeptide ABC transporter, ATP-binding protein
Zhang et al. [4]: GO:0035639|purine ribonucleoside triphosphate binding
Bianchi et al. [5]: "Oligopeptide transport system, ATP binding"

Structures and Sequence Alignment

The best structural homolog that predicted by 3. BF was P0CZ33 (Oligopeptide transport ATP-binding protein OppF) with a FATCAT P-Value: 0 and RMSD of 1.12 angstrom. The sequence alignment identity is 26.3%.
Structural alignment shown in left. Query protein AVX54651.1 colored as red in alignment, homolog P0CZ33 colored as blue. Query protein AVX54651.1 is also shown in right top, homolog P0CZ33 showed in right bottom. They are colored based on secondary structures.

  AVX54651.1 MIKKKNEAILKVRDLLIEFGNGRNKLKAVKGVTFDVYKGETFGLVGESGSGKTTIGRAIIGIQPISDGAIYFENKLLRGKSPDVYKINQKIARHLYIMQQ 100
      P0CZ33 ---------------------------------------------------------------------------------------------------- 0

  AVX54651.1 NQLTTSLSLNDYSNEFKRVYYKYVQSKFFDFKTQELKDYEDGKSRIIKEGVNLNTTKLVSVKKNANLSIVIQAITDNLKRLLKIIRLQEKASRITKNISK 200
      P0CZ33 ---------------------------------------------------------------------------------------------------- 0

  AVX54651.1 HTSVKVELQDAINKYQDFVHDSILKVKDLENTIYNTLQEMLAIRNDVNEGKYTSVTKFFDQMGSRLKLVIKSQKLITPQLEDASHDQLMNLALTC----P 296
      P0CZ33 ----------------------------------------------------------------------MSEKLV--EVKD--------LEISFGEGKK 20

  AVX54651.1 KY---KN-NYYLKKLKQRIEYLNL-----NNKTKLAQEYESVIQTVENSDFYDNLKTAEIFKSPNKKELKE-NKKDMQMIFQDPSSSLNERMAVEEIIKE 386
      P0CZ33 KFVAVKNANFFIKK----GETFSLVGESGSGKTTIGRAIIGLNDTSSGQILYDG-KVINGRKS--KSEANELIRK-IQMIFQDPAASLNERATVDYIISE 112

  AVX54651.1 GLDNFPELYSNDEVKKAYQQWFNQKNPENKIVEISEIDKKDIKRFLINQLLETVGLLPEHLSRYPHEFSGGQRQRIGIARALIMKPKFVVADEPISALDV 486
      P0CZ33 GLYNF-NLFKTEEERK---------------------EK--IK----NMMAE-VGLLSEHLTRYPHEFSGGQRQRIGIARALVMNPEFVIADEPISALDV 183

  AVX54651.1 SIRAQIMNLLAKFQKQFDLTYIFIAHDLSVVRFATDRIAVIYRGDIVELAESNELFDLPLHPYTRSLLSAIPLPDPVQESKKVHFVYQPEVEHHDYLVDF 586
      P0CZ33 SVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIAVIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHP--DQHDYTLDK 281

  AVX54651.1 PKWVEVSKNHFVYANEREIKAYKKQIKAYKEQLKNK 622
      P0CZ33 PSMVEIKPNHFVWANQAEIEKYQKEL---------- 307

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
1. PBF	GO:0015594	ABC-type putrescine transporter activity
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0043190	ATP-binding cassette (ABC) transporter complex
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0015833	peptide transport
1. PBF	GO:0042626	ATPase-coupled transmembrane transporter activity
1. PBF	GO:0016787	hydrolase activity
3. BF	GO:0042882	L-arabinose transmembrane transport
3. BF	GO:0015419	ABC-type sulfate transporter activity
3. BF	GO:0055085	transmembrane transport
3. BF	GO:0005887	integral component of plasma membrane
3. BF	GO:0015192	L-phenylalanine transmembrane transporter activity
3. BF	GO:0043215	daunorubicin transport
3. BF	GO:0046677	response to antibiotic
3. BF	GO:0001407	glycerophosphodiester transmembrane transport
3. BF	GO:0033212	iron import into cell
3. BF	GO:0015612	ABC-type L-arabinose transporter activity
3. BF	GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane
3. BF	GO:1900753	doxorubicin transport
3. BF	GO:0015562	efflux transmembrane transporter activity
3. BF	GO:0015414	ABC-type nitrate transporter activity
3. BF	GO:0015031	protein transport
3. BF	GO:0042941	D-alanine transport
3. BF	GO:0030256	type I protein secretion system complex
3. BF	GO:0033228	cysteine export across plasma membrane
3. BF	GO:0046872	metal ion binding
3. BF	GO:0015430	ABC-type glycerol-3-phosphate transporter activity
3. BF	GO:0006824	cobalt ion transport
3. BF	GO:0009276	Gram-negative-bacterium-type cell wall
3. BF	GO:0022857	transmembrane transporter activity
3. BF	GO:0044874	lipoprotein localization to outer membrane
3. BF	GO:0015408	ABC-type ferric iron transporter activity
3. BF	GO:0051539	4 iron, 4 sulfur cluster binding
3. BF	GO:0089705	protein localization to outer membrane
3. BF	GO:0030253	protein secretion by the type I secretion system
3. BF	GO:0015417	ABC-type polyamine transporter activity
3. BF	GO:0042160	lipoprotein modification
3. BF	GO:0015416	ABC-type phosphonate transporter activity
3. BF	GO:0034040	ATPase-coupled lipid transmembrane transporter activity
3. BF	GO:0008643	carbohydrate transport
3. BF	GO:0008559	ABC-type xenobiotic transporter activity
3. BF	GO:0006865	amino acid transport
3. BF	GO:0102025	ABC-type thiosulfate transporter activity
3. BF	GO:0015611	ABC-type D-ribose transporter activity
3. BF	GO:0103116	ABC-type D-galactofuranose transporter
3. BF	GO:0000770	peptide pheromone export
3. BF	GO:0030420	establishment of competence for transformation
3. BF	GO:1905887	autoinducer AI-2 transmembrane transport
3. BF	GO:0044873	lipoprotein localization to membrane
3. BF	GO:0033232	ABC-type D-methionine transporter activity
3. BF	GO:0015112	nitrate transmembrane transporter activity
3. BF	GO:1903805	L-valine import across plasma membrane
3. BF	GO:0015439	ABC-type heme transporter activity
3. BF	GO:0043211	ABC-type carbohydrate transporter activity
3. BF	GO:1903806	L-isoleucine import across plasma membrane
3. BF	GO:0140306	lipoprotein releasing activity
3. BF	GO:0042953	lipoprotein transport
4. PB	GO:0000049	tRNA binding
4. PB	GO:0045900	negative regulation of translational elongation
5. P	GO:0043022	ribosome binding
5. P	GO:0019700	organic phosphonate catabolic process
5. P	GO:0140603	obsolete ATP hydrolysis activity
6. F	GO:0015848	spermidine transport
6. F	GO:0008554	P-type sodium transporter activity
7. B	GO:1902995	positive regulation of phospholipid efflux
7. B	GO:0042910	xenobiotic transmembrane transporter activity
7. B	GO:0034188	apolipoprotein A-I receptor activity
7. B	GO:0005829	cytosol
7. B	GO:0010315	auxin efflux
7. B	GO:0006778	porphyrin-containing compound metabolic process
7. B	GO:0015886	heme transport
7. B	GO:0010044	response to aluminum ion
7. B	GO:0015462	ABC-type protein transporter activity
7. B	GO:0015633	ABC-type zinc transporter activity
7. B	GO:0070730	cAMP transport
7. B	GO:0150104	transport across blood-brain barrier
7. B	GO:0034375	high-density lipoprotein particle remodeling
7. B	GO:0010329	auxin efflux transmembrane transporter activity
7. B	GO:0005975	carbohydrate metabolic process
7. B	GO:0042825	TAP complex
7. B	GO:0005634	nucleus
7. B	GO:1901873	regulation of post-translational protein modification
7. B	GO:0035351	heme transmembrane transport
7. B	GO:0034186	apolipoprotein A-I binding
7. B	GO:0070925	organelle assembly
7. B	GO:0015607	ABC-type fatty-acyl-CoA transporter activity
7. B	GO:0015489	putrescine transmembrane transporter activity
7. B	GO:0030145	manganese ion binding
7. B	GO:0140326	ATPase-coupled intramembrane lipid transporter activity
7. B	GO:0043024	ribosomal small subunit binding
7. B	GO:1903064	positive regulation of reverse cholesterol transport
7. B	GO:0097254	renal tubular secretion
7. B	GO:0042270	protection from natural killer cell mediated cytotoxicity
7. B	GO:0010217	cellular aluminum ion homeostasis
7. B	GO:0015438	ABC-type teichoic acid transporter activity
7. B	GO:0008272	sulfate transport
7. B	GO:0006649	phospholipid transfer to membrane
7. B	GO:0031154	culmination involved in sorocarp development
7. B	GO:0016324	apical plasma membrane
7. B	GO:0034755	iron ion transmembrane transport
7. B	GO:0015126	canalicular bile acid transmembrane transporter activity
7. B	GO:0031004	potassium ion-transporting ATPase complex
7. B	GO:0009432	SOS response
7. B	GO:0070894	regulation of transposon integration
7. B	GO:0015675	nickel cation transport
7. B	GO:0090155	negative regulation of sphingolipid biosynthetic process
7. B	GO:0097234	epidermal lamellar body membrane
7. B	GO:0048770	pigment granule
7. B	GO:0042908	xenobiotic transport
7. B	GO:1902602	aluminum ion transmembrane transport
7. B	GO:0014045	establishment of endothelial blood-brain barrier
7. B	GO:0015421	ABC-type oligopeptide transporter activity
7. B	GO:0071403	cellular response to high density lipoprotein particle stimulus
7. B	GO:0015441	ABC-type beta-glucan transporter activity
7. B	GO:0140466	iron-sulfur cluster export from the mitochondrion
7. B	GO:0015867	ATP transport
7. B	GO:0045806	negative regulation of endocytosis
7. B	GO:0032367	intracellular cholesterol transport
7. B	GO:0015225	biotin transmembrane transporter activity
7. B	GO:0055088	lipid homeostasis
7. B	GO:0042632	cholesterol homeostasis
7. B	GO:0071716	leukotriene transport
7. B	GO:0019829	ATPase-coupled cation transmembrane transporter activity
7. B	GO:0046471	phosphatidylglycerol metabolic process
7. B	GO:0043213	bacteriocin transport
7. B	GO:0005615	extracellular space
7. B	GO:0042288	MHC class I protein binding
7. B	GO:0043225	ATPase-coupled inorganic anion transmembrane transporter activity
7. B	GO:0061135	endopeptidase regulator activity
7. B	GO:0042441	eye pigment metabolic process
7. B	GO:1990962	xenobiotic transport across blood-brain barrier
7. B	GO:1902418	(+)-abscisic acid D-glucopyranosyl ester transmembrane transport
7. B	GO:0038183	bile acid signaling pathway
7. B	GO:0005779	integral component of peroxisomal membrane
7. B	GO:0098838	folate transmembrane transport
7. B	GO:1904251	regulation of bile acid metabolic process
7. B	GO:0043217	myelin maintenance
7. B	GO:0047617	acyl-CoA hydrolase activity
7. B	GO:1903427	negative regulation of reactive oxygen species biosynthetic process
7. B	GO:0015423	ABC-type maltose transporter activity
7. B	GO:0003336	corneocyte desquamation
7. B	GO:1900407	regulation of cellular response to oxidative stress
7. B	GO:0008558	ABC-type guanine transporter activity
7. B	GO:0000054	ribosomal subunit export from nucleus
7. B	GO:1900016	negative regulation of cytokine production involved in inflammatory response
7. B	GO:0032383	regulation of intracellular cholesterol transport
7. B	GO:0032940	secretion by cell
7. B	GO:0006727	ommochrome biosynthetic process
7. B	GO:0046581	intercellular canaliculus
7. B	GO:1903898	negative regulation of PERK-mediated unfolded protein response
7. B	GO:1905601	negative regulation of receptor-mediated endocytosis involved in cholesterol transport
7. B	GO:0006879	cellular iron ion homeostasis
7. B	GO:0031998	regulation of fatty acid beta-oxidation
7. B	GO:0043691	reverse cholesterol transport
7. B	GO:0002591	positive regulation of antigen processing and presentation of peptide antigen via MHC class I
7. B	GO:0008514	organic anion transmembrane transporter activity
7. B	GO:0055076	transition metal ion homeostasis
7. B	GO:0042599	lamellar body
7. B	GO:0036246	phytochelatin 2 import into vacuole
7. B	GO:1903413	cellular response to bile acid
7. B	GO:0046691	intracellular canaliculus
7. B	GO:0097327	response to antineoplastic agent
7. B	GO:0015164	glucuronoside transmembrane transporter activity
7. B	GO:0016323	basolateral plasma membrane
7. B	GO:0007049	cell cycle
7. B	GO:0010872	regulation of cholesterol esterification
7. B	GO:0036249	cadmium ion import into vacuole
7. B	GO:0048545	response to steroid hormone
7. B	GO:0003723	RNA binding
7. B	GO:0043481	anthocyanin accumulation in tissues in response to UV light
7. B	GO:0002489	antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
7. B	GO:0015842	aminergic neurotransmitter loading into synaptic vesicle
7. B	GO:0006364	rRNA processing
7. B	GO:0019534	toxin transmembrane transporter activity
7. B	GO:0006829	zinc ion transport
7. B	GO:0046985	positive regulation of hemoglobin biosynthetic process
7. B	GO:0000038	very long-chain fatty acid metabolic process
7. B	GO:0015411	ABC-type taurine transporter transporter activity
7. B	GO:0006413	translational initiation
7. B	GO:0005319	lipid transporter activity
7. B	GO:0071806	protein transmembrane transport
7. B	GO:0070455	positive regulation of heme biosynthetic process
7. B	GO:0051301	cell division
7. B	GO:0099039	sphingolipid translocation
7. B	GO:1990060	maltose transport complex
7. B	GO:0097233	alveolar lamellar body membrane
7. B	GO:0006412	translation
7. B	GO:0005765	lysosomal membrane
7. B	GO:0031459	ABC-type glycine betaine transporter activity
7. B	GO:0015188	L-isoleucine transmembrane transporter activity
7. B	GO:0097386	glial cell projection
7. B	GO:1901529	positive regulation of anion channel activity
7. B	GO:0055091	phospholipid homeostasis
7. B	GO:0046618	xenobiotic export
7. B	GO:0010496	intercellular transport
7. B	GO:1903232	melanosome assembly
7. B	GO:0015865	purine nucleotide transport
7. B	GO:0010328	auxin influx transmembrane transporter activity
7. B	GO:0005730	nucleolus
7. B	GO:0034775	glutathione transmembrane transport
7. B	GO:1901086	benzylpenicillin metabolic process
7. B	GO:0120188	regulation of bile acid secretion
7. B	GO:0010875	positive regulation of cholesterol efflux
7. B	GO:0071995	phytochelatin import into vacuole
7. B	GO:0097744	renal urate salt excretion
7. B	GO:0016151	nickel cation binding
7. B	GO:0032368	regulation of lipid transport
7. B	GO:0006856	eye pigment precursor transport
7. B	GO:0042758	long-chain fatty acid catabolic process
7. B	GO:0023029	MHC class Ib protein binding
7. B	GO:0015878	biotin transport
7. B	GO:0140481	ABC-type iron-sulfur cluster transporter activity
7. B	GO:0000325	plant-type vacuole
7. B	GO:0032585	multivesicular body membrane
7. B	GO:0015127	bilirubin transmembrane transporter activity
7. B	GO:0019389	glucuronoside metabolic process
7. B	GO:0098713	leucine import across plasma membrane
7. B	GO:0009507	chloroplast
7. B	GO:0120202	rod photoreceptor disc membrane
7. B	GO:0042985	negative regulation of amyloid precursor protein biosynthetic process
7. B	GO:0015434	ABC-type cadmium transporter activity
7. B	GO:0015418	ABC-type quaternary ammonium compound transporting activity
7. B	GO:1990535	neuron projection maintenance
7. B	GO:0000324	fungal-type vacuole
7. B	GO:0046890	regulation of lipid biosynthetic process
7. B	GO:0015716	organic phosphonate transport
7. B	GO:0015625	ABC-type ferric hydroxamate transporter activity
7. B	GO:0015424	ABC-type amino acid transporter activity
7. B	GO:0015432	ABC-type bile acid transporter activity
7. B	GO:1905075	positive regulation of tight junction disassembly
7. B	GO:0015415	ATPase-coupled phosphate ion transmembrane transporter activity
7. B	GO:0098591	external side of apical plasma membrane
7. B	GO:0071714	icosanoid transmembrane transporter activity
7. B	GO:0006686	sphingomyelin biosynthetic process
7. B	GO:1902993	positive regulation of amyloid precursor protein catabolic process
7. B	GO:0042888	molybdenum ion transmembrane transporter activity
7. B	GO:0005275	amine transmembrane transporter activity
7. B	GO:1901076	positive regulation of engulfment of apoptotic cell
7. B	GO:0036020	endolysosome membrane
7. B	GO:0016021	integral component of membrane
7. B	GO:0046968	peptide antigen transport
7. B	GO:0099040	ceramide translocation
7. B	GO:0070731	cGMP transport
7. B	GO:0042986	positive regulation of amyloid precursor protein biosynthetic process
7. B	GO:0140357	heme export from vacuole to cytoplasm
7. B	GO:0001573	ganglioside metabolic process
7. B	GO:0015918	sterol transport
7. B	GO:0000287	magnesium ion binding
7. B	GO:0006687	glycosphingolipid metabolic process
7. B	GO:0097208	alveolar lamellar body
7. B	GO:0046415	urate metabolic process
7. B	GO:0034041	ABC-type sterol transporter activity
7. B	GO:0008281	sulfonylurea receptor activity
7. B	GO:0015143	urate transmembrane transporter activity
7. B	GO:0090370	negative regulation of cholesterol efflux
7. B	GO:0080168	abscisic acid transport
7. B	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
7. B	GO:0015436	ABC-type capsular-polysaccharide transporter activity
7. B	GO:0019843	rRNA binding
7. B	GO:0033162	melanosome membrane
7. B	GO:0003677	DNA binding
7. B	GO:1900721	positive regulation of uterine smooth muscle relaxation
7. B	GO:0090556	phosphatidylserine floppase activity
7. B	GO:0042824	MHC class I peptide loading complex
7. B	GO:0008282	inward rectifying potassium channel
7. B	GO:0030504	inorganic diphosphate transmembrane transporter activity
7. B	GO:0055092	sterol homeostasis
7. B	GO:0010540	basipetal auxin transport
7. B	GO:0097708	intracellular vesicle
7. B	GO:0120020	cholesterol transfer activity
7. B	GO:0033700	phospholipid efflux
7. B	GO:0032218	riboflavin transport
7. B	GO:2000008	regulation of protein localization to cell surface
7. B	GO:0120189	positive regulation of bile acid secretion
7. B	GO:0015847	putrescine transport
7. B	GO:1904411	positive regulation of secretory granule organization
7. B	GO:0010043	response to zinc ion
7. B	GO:0015911	long-chain fatty acid import across plasma membrane
7. B	GO:0003924	GTPase activity
7. B	GO:0034205	amyloid-beta formation
7. B	GO:0015614	ABC-type D-xylose transporter activity
7. B	GO:1905039	carboxylic acid transmembrane transport
7. B	GO:0005774	vacuolar membrane
7. B	GO:0043231	intracellular membrane-bounded organelle
7. B	GO:0010949	negative regulation of intestinal phytosterol absorption
7. B	GO:0015893
7. B	GO:0005315	inorganic phosphate transmembrane transporter activity
7. B	GO:0046967	cytosol to endoplasmic reticulum transport
7. B	GO:0061843	Sertoli cell barrier remodeling
7. B	GO:0046865	terpenoid transport
7. B	GO:0015413	ABC-type nickel transporter activity
7. B	GO:0016887	ATP hydrolysis activity
7. B	GO:0005503	all-trans retinal binding
7. B	GO:0032376	positive regulation of cholesterol transport
7. B	GO:0015420	ABC-type vitamin B12 transporter activity
7. B	GO:0006869	lipid transport
7. B	GO:0042887	amide transmembrane transporter activity
7. B	GO:1904479	negative regulation of intestinal absorption
7. B	GO:0005576	extracellular region
7. B	GO:0005506	iron ion binding
7. B	GO:0034634	glutathione transmembrane transporter activity
7. B	GO:0048581	negative regulation of post-embryonic development
7. B	GO:0015711	organic anion transport
7. B	GO:0075139	response to host iron concentration
7. B	GO:0032464	positive regulation of protein homooligomerization
7. B	GO:0071072	negative regulation of phospholipid biosynthetic process
7. B	GO:0033762	response to glucagon
7. B	GO:0033013	tetrapyrrole metabolic process
7. B	GO:0140328	floppase activity
7. B	GO:0098849	cellular detoxification of cadmium ion
7. B	GO:0017004	cytochrome complex assembly
7. B	GO:0070633	transepithelial transport
7. B	GO:0070327	thyroid hormone transport
7. B	GO:0061092	positive regulation of phospholipid translocation
7. B	GO:0061855	negative regulation of neuroblast migration
7. B	GO:0032782	bile acid secretion
7. B	GO:0098662	inorganic cation transmembrane transport
7. B	GO:2001140	positive regulation of phospholipid transport
7. B	GO:0006684	sphingomyelin metabolic process
7. B	GO:0015440	ABC-type peptide transporter activity
7. B	GO:0030301	cholesterol transport
7. B	GO:0005778	peroxisomal membrane
7. B	GO:0015721	bile acid and bile salt transport
7. B	GO:0090539	peptide pheromone export by transmembrane transport
7. B	GO:0032000	positive regulation of fatty acid beta-oxidation
7. B	GO:0006448	regulation of translational elongation
7. B	GO:0099038	ceramide floppase activity
7. B	GO:0010874	regulation of cholesterol efflux
7. B	GO:0010312	detoxification of zinc ion
7. B	GO:0046943	carboxylic acid transmembrane transporter activity
7. B	GO:0015433	ABC-type peptide antigen transporter activity
7. B	GO:0038027	apolipoprotein A-I-mediated signaling pathway
7. B	GO:2001225	regulation of chloride transport
7. B	GO:0042883	cysteine transport
7. B	GO:0008509	anion transmembrane transporter activity
7. B	GO:0045332	phospholipid translocation
7. B	GO:0030505	inorganic diphosphate transport
7. B	GO:0035672	oligopeptide transmembrane transport
7. B	GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I
7. B	GO:0015232	heme transmembrane transporter activity
7. B	GO:0006932	substrate-dependent cell migration, cell contraction
7. B	GO:2001280	positive regulation of unsaturated fatty acid biosynthetic process
7. B	GO:0036113	very long-chain fatty-acyl-CoA catabolic process
7. B	GO:0006638	neutral lipid metabolic process
7. B	GO:0150110	negative regulation of cholesterol esterification
7. B	GO:0015774	polysaccharide transport
7. B	GO:0031460	glycine betaine transport
7. B	GO:0006635	fatty acid beta-oxidation
7. B	GO:0090374	oligopeptide export from mitochondrion
7. B	GO:0015599	ATPase-coupled L-glutamine transmembrane transporter activity
7. B	GO:0035444	nickel cation transmembrane transport
7. B	GO:0006817	phosphate ion transport
7. B	GO:0061337	cardiac conduction
7. B	GO:0032289	central nervous system myelin formation
7. B	GO:0006855	xenobiotic transmembrane transport
7. B	GO:0015722	canalicular bile acid transport
7. B	GO:0046978	TAP1 binding
7. B	GO:1903331	positive regulation of iron-sulfur cluster assembly
7. B	GO:0032217	riboflavin transmembrane transporter activity
7. B	GO:0008206	bile acid metabolic process
7. B	GO:0005525	GTP binding
7. B	GO:0042178	xenobiotic catabolic process
7. B	GO:0015437	lipopolysaccharide floppase activity
7. B	GO:0006281	DNA repair
7. B	GO:0015412	ABC-type molybdate transporter activity
7. B	GO:0090554	phosphatidylcholine floppase activity
7. B	GO:0150094	amyloid-beta clearance by cellular catabolic process
7. B	GO:0140359	ABC-type transporter activity
7. B	GO:1902417	(+)-abscisic acid D-glucopyranosyl ester transmembrane transporter activity
7. B	GO:0015910	long-chain fatty acid import into peroxisome
7. B	GO:0097209	epidermal lamellar body
7. B	GO:0005654	nucleoplasm
7. B	GO:0062157	mitochondrial ATP-gated potassium channel complex
7. B	GO:0031526	brush border membrane
7. B	GO:1902497	iron-sulfur cluster transmembrane transport
7. B	GO:0009245	lipid A biosynthetic process
7. B	GO:0090555	phosphatidylethanolamine flippase activity
7. B	GO:0044604	ABC-type phytochelatin transporter activity
7. B	GO:0015723	bilirubin transport
7. B	GO:0055072	iron ion homeostasis
7. B	GO:0043214	ABC-type bacteriocin transporter activity
7. B	GO:0043129	surfactant homeostasis
7. B	GO:0015808	L-alanine transport
7. B	GO:0060049	regulation of protein glycosylation
7. B	GO:0032805	positive regulation of low-density lipoprotein particle receptor catabolic process
7. B	GO:0046980	tapasin binding
7. B	GO:0071996	glutathione transmembrane import into vacuole
7. B	GO:0006357	regulation of transcription by RNA polymerase II
7. B	GO:0002082	regulation of oxidative phosphorylation
7. B	GO:0090156	cellular sphingolipid homeostasis
7. B	GO:0071805	potassium ion transmembrane transport
7. B	GO:0090740	integral component of pigment granule membrane
7. B	GO:1904375	regulation of protein localization to cell periphery
7. B	GO:0031288	sorocarp morphogenesis
7. B	GO:0015431	ABC-type glutathione S-conjugate transporter activity
7. B	GO:1902004	positive regulation of amyloid-beta formation
7. B	GO:0015777	teichoic acid transport
7. B	GO:0045796	negative regulation of intestinal cholesterol absorption
7. B	GO:0042168	heme metabolic process
7. B	GO:0015752	D-ribose transmembrane transport
7. B	GO:2000010	positive regulation of protein localization to cell surface
7. B	GO:0008270	zinc ion binding
7. B	GO:0000329	fungal-type vacuole membrane
7. B	GO:1901238	ABC-type tungstate transporter activity
7. B	GO:0015125	bile acid transmembrane transporter activity
7. B	GO:0140115	export across plasma membrane
7. B	GO:0034380	high-density lipoprotein particle assembly
7. B	GO:0044857	plasma membrane raft organization
7. B	GO:0097232	lamellar body membrane
7. B	GO:0034436	glycoprotein transport
7. B	GO:0003746	translation elongation factor activity
7. B	GO:1990748	cellular detoxification
7. B	GO:0042959	alkanesulfonate transmembrane transporter activity
7. B	GO:0007031	peroxisome organization
7. B	GO:0015732	prostaglandin transport
7. B	GO:0051900	regulation of mitochondrial depolarization
7. B	GO:0060919	auxin influx
7. B	GO:0035435	phosphate ion transmembrane transport
7. B	GO:0090108	positive regulation of high-density lipoprotein particle assembly
7. B	GO:0033344	cholesterol efflux
7. B	GO:0023061	signal release
7. B	GO:0005501	retinoid binding
7. B	GO:0032379	positive regulation of intracellular lipid transport
7. B	GO:0002481	antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
7. B	GO:0015087	cobalt ion transmembrane transporter activity
7. B	GO:0048502	ABC-type thiamine transporter activity
7. B	GO:0015694	mercury ion transport
7. B	GO:0032384	negative regulation of intracellular cholesterol transport
7. B	GO:0008494	translation activator activity
7. B	GO:0120019	phosphatidylcholine transfer activity
7. B	GO:0005324	long-chain fatty acid transporter activity
7. B	GO:0005304	L-valine transmembrane transporter activity
7. B	GO:0015190	L-leucine transmembrane transporter activity
7. B	GO:0035627	ceramide transport
7. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
7. B	GO:0015216	purine nucleotide transmembrane transporter activity
7. B	GO:0005840	ribosome
7. B	GO:0042605	peptide antigen binding
7. B	GO:0042401	cellular biogenic amine biosynthetic process
7. B	GO:0002485	antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
7. B	GO:1905948	ABC-type 3',5'-cyclic GMP transmembrane transporter activity
7. B	GO:1904486	response to 17alpha-ethynylestradiol
7. B	GO:1905604	negative regulation of blood-brain barrier permeability
7. B	GO:0046623	sphingolipid floppase activity
7. B	GO:0140345	phosphatidylcholine flippase activity
7. B	GO:0015426	ATPase-coupled polar amino acid-transporter activity
7. B	GO:0140347	N-retinylidene-phosphatidylethanolamine flippase activity
7. B	GO:0042760	very long-chain fatty acid catabolic process
7. B	GO:0140327	flippase activity
7. B	GO:1901557	response to fenofibrate
7. B	GO:0005737	cytoplasm
7. B	GO:0044847	iron acquisition from host
7. B	GO:1902991	regulation of amyloid precursor protein catabolic process
7. B	GO:0046979	TAP2 binding
7. B	GO:0030644	cellular chloride ion homeostasis
7. B	GO:1905598	negative regulation of low-density lipoprotein receptor activity
7. B	GO:0031409	pigment binding
7. B	GO:0150172	regulation of phosphatidylcholine metabolic process
7. B	GO:0042493
7. B	GO:0005548	phospholipid transporter activity
7. B	GO:0002790	peptide secretion
7. B	GO:0017144
7. B	GO:0016020	membrane
7. B	GO:0009235	cobalamin metabolic process
7. B	GO:0015794	glycerol-3-phosphate transmembrane transport
7. B	GO:0046906	tetrapyrrole binding
7. B	GO:0020037	heme binding
7. B	GO:0015689	molybdate ion transport
7. B	GO:0031427	response to methotrexate

Uniprot GO Annotations

GO	Description
GO:0005524	ATP binding
GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:0015833	peptide transport
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q32IB5	Glutathione import ATP-binding protein GsiA	1.30e-05	2.67e-05	5.22e-49	0.3288
1. PBF	Q323W5	Glutathione import ATP-binding protein GsiA	1.24e-05	1.59e-05	1.98e-48	0.3275
1. PBF	Q8Z864	Glutathione import ATP-binding protein GsiA	1.88e-05	1.05e-05	1.27e-46	0.3222
1. PBF	Q7MFH3	Putative ABC transporter ATP-binding protein VVA0347	3.27e-05	7.77e-03	4.26e-08	0.2551
1. PBF	Q4A9E1	Spermidine/putrescine import ATP-binding protein PotA	2.91e-04	9.69e-03	1.46e-19	0.4137
1. PBF	Q9PR37	Spermidine/putrescine import ATP-binding protein PotA	1.18e-07	1.07e-06	1.43e-17	0.3776
1. PBF	P47288	Spermidine/putrescine import ATP-binding protein PotA	9.10e-07	4.02e-06	2.45e-17	0.3482
1. PBF	P47326	Oligopeptide transport ATP-binding protein OppF	1.19e-05	2.55e-10	1.94e-41	0.4034
1. PBF	Q5ZZZ7	Spermidine/putrescine import ATP-binding protein PotA	3.85e-04	8.49e-03	3.30e-19	0.4078
1. PBF	Q0T6D3	Glutathione import ATP-binding protein GsiA	1.09e-05	7.13e-06	1.79e-48	0.3231
1. PBF	P75551	Oligopeptide transport ATP-binding protein OppF	7.41e-05	3.32e-10	1.08e-40	0.4117
1. PBF	Q8ZQM4	Glutathione import ATP-binding protein GsiA	1.43e-05	1.05e-05	1.27e-46	0.3159
1. PBF	Q4A5Q4	Spermidine/putrescine import ATP-binding protein PotA	7.44e-04	1.42e-02	1.23e-16	0.4039
1. PBF	Q8X6W1	Glutathione import ATP-binding protein GsiA	1.09e-05	3.41e-05	2.74e-48	0.3291
1. PBF	Q83LT3	Glutathione import ATP-binding protein GsiA	1.16e-05	4.29e-06	1.88e-48	0.331
1. PBF	A1A967	Glutathione import ATP-binding protein GsiA	1.07e-05	4.87e-06	3.80e-47	0.3327
1. PBF	Q5PGP3	Glutathione import ATP-binding protein GsiA	8.80e-06	1.14e-05	1.32e-46	0.3145
1. PBF	Q6D3A9	Glutathione import ATP-binding protein GsiA	1.60e-05	4.75e-07	1.42e-48	0.3228
1. PBF	Q57RB2	Glutathione import ATP-binding protein GsiA	7.71e-06	1.38e-05	1.22e-46	0.3151
1. PBF	Q87G35	Putative ABC transporter ATP-binding protein VPA1482	1.03e-04	1.31e-02	6.00e-09	0.252
1. PBF	Q8D3Z9	Putative ABC transporter ATP-binding protein VV2_1533	2.88e-05	1.09e-03	5.07e-08	0.2476
3. BF	Q3IM24	Phosphonates import ATP-binding protein PhnC 2	5.42e-05	NA	1.01e-13	0.7694
3. BF	Q8G195	Lipoprotein-releasing system ATP-binding protein LolD	4.53e-05	NA	1.43e-06	0.793
3. BF	Q2YJJ8	Putative peptide import ATP-binding protein BAB2_1053	7.81e-09	NA	8.27e-44	0.7439
3. BF	Q8DRS0	Energy-coupling factor transporter ATP-binding protein EcfA2	2.07e-05	NA	1.39e-09	0.7254
3. BF	Q65TH4	Macrolide export ATP-binding/permease protein MacB	2.23e-02	NA	2.32e-07	0.3729
3. BF	Q48P40	ATP-dependent lipid A-core flippase	1.79e-04	NA	8.01e-06	0.2441
3. BF	Q4KK46	Methionine import ATP-binding protein MetN 2	1.30e-04	NA	1.83e-23	0.6155
3. BF	Q3ATY5	Lipoprotein-releasing system ATP-binding protein LolD 1	1.71e-05	NA	1.08e-08	0.7971
3. BF	Q6FAN3	Methionine import ATP-binding protein MetN 1	1.69e-04	NA	2.67e-21	0.6411
3. BF	P0A9T9	Uncharacterized ABC transporter ATP-binding protein YbbA	2.63e-03	NA	9.59e-09	0.82
3. BF	Q2G7G7	Lipoprotein-releasing system ATP-binding protein LolD	3.21e-05	NA	2.72e-05	0.8126
3. BF	Q6ME20	Methionine import ATP-binding protein MetN	2.12e-05	NA	2.21e-18	0.6815
3. BF	A1URR2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.12e-04	NA	1.72e-14	0.6117
3. BF	Q3MAR5	Spermidine/putrescine import ATP-binding protein PotA	1.70e-04	NA	3.17e-17	0.5458
3. BF	Q02Z10	Spermidine/putrescine import ATP-binding protein PotA	9.78e-04	NA	9.82e-14	0.4992
3. BF	Q8UB29	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	8.23e-05	NA	8.22e-13	0.5891
3. BF	Q7N8M2	Methionine import ATP-binding protein MetN	2.12e-05	NA	4.73e-20	0.6545
3. BF	Q8YBN6	Putative peptide import ATP-binding protein BMEII0863	8.60e-08	NA	4.94e-29	0.7007
3. BF	A0LM36	Macrolide export ATP-binding/permease protein MacB	9.72e-02	NA	4.39e-12	0.347
3. BF	Q5LT05	Spermidine/putrescine import ATP-binding protein PotA	2.07e-04	NA	1.97e-14	0.5696
3. BF	Q1MQ44	Spermidine/putrescine import ATP-binding protein PotA	4.78e-04	NA	8.95e-14	0.5856
3. BF	Q729H7	Lipoprotein-releasing system ATP-binding protein LolD	1.93e-05	NA	1.23e-06	0.8249
3. BF	Q47YG8	Lipoprotein-releasing system ATP-binding protein LolD	3.35e-04	NA	5.46e-13	0.7297
3. BF	Q0C1C3	Lipoprotein-releasing system ATP-binding protein LolD	1.58e-05	NA	8.58e-10	0.8301
3. BF	Q4JTG9	Methionine import ATP-binding protein MetN	1.57e-05	NA	1.89e-18	0.5985
3. BF	Q5P6D5	Macrolide export ATP-binding/permease protein MacB	1.89e-02	NA	2.03e-08	0.3677
3. BF	Q325U1	Methionine import ATP-binding protein MetN	8.89e-06	NA	6.61e-20	0.6618
3. BF	Q1IGZ0	Methionine import ATP-binding protein MetN 2	2.30e-05	NA	1.16e-24	0.6838
3. BF	Q1M8E0	Methionine import ATP-binding protein MetN	1.04e-04	NA	1.52e-14	0.6212
3. BF	Q81VQ1	Energy-coupling factor transporter ATP-binding protein EcfA2	6.29e-05	NA	1.61e-16	0.7382
3. BF	O51587	Spermidine/putrescine import ATP-binding protein PotA	1.13e-04	NA	2.70e-20	0.6065
3. BF	Q72FW5	Spermidine/putrescine import ATP-binding protein PotA	4.23e-04	NA	6.48e-16	0.5758
3. BF	Q2RWA3	Methionine import ATP-binding protein MetN	1.53e-05	NA	4.92e-19	0.6596
3. BF	Q6GEL3	Energy-coupling factor transporter ATP-binding protein EcfA1	1.20e-04	NA	2.89e-12	0.7856
3. BF	Q31VH5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.00e-03	NA	9.12e-11	0.5725
3. BF	P0CZ27	Energy-coupling factor transporter ATP-binding protein EcfA2	2.31e-05	NA	8.88e-10	0.7333
3. BF	Q0TQU8	Galactose/methyl galactoside import ATP-binding protein MglA	1.13e-02	NA	1.18e-05	0.3003
3. BF	P18766	Oligopeptide transport ATP-binding protein AmiF	0.00e+00	NA	7.52e-88	0.9297
3. BF	Q7NWX3	Sulfate/thiosulfate import ATP-binding protein CysA 2	7.80e-04	NA	1.72e-14	0.587
3. BF	Q89KN0	Lipoprotein-releasing system ATP-binding protein LolD	1.24e-05	NA	3.09e-06	0.7813
3. BF	Q9K619	Bacitracin export ATP-binding protein BceA	7.49e-05	NA	1.33e-09	0.775
3. BF	Q2K204	Ribose import ATP-binding protein RbsA 2	1.07e-04	NA	1.50e-04	0.274
3. BF	Q92QN0	Lipoprotein-releasing system ATP-binding protein LolD	2.76e-03	NA	3.57e-07	0.8176
3. BF	O34756	Putative ABC transporter ATP-binding protein YjkB	1.92e-06	NA	1.49e-11	0.7991
3. BF	Q9K789	Methionine import ATP-binding protein MetN	9.01e-06	NA	1.16e-17	0.687
3. BF	Q8CTB2	Methionine import ATP-binding protein MetN 1	6.22e-05	NA	1.26e-20	0.6787
3. BF	Q38UU0	Energy-coupling factor transporter ATP-binding protein EcfA2	2.46e-04	NA	1.30e-13	0.7073
3. BF	A1AA20	Spermidine/putrescine import ATP-binding protein PotA	5.13e-05	NA	4.74e-17	0.5482
3. BF	P69876	Spermidine/putrescine import ATP-binding protein PotA	4.82e-05	NA	4.96e-17	0.5526
3. BF	P0DJA1	Lipoprotein-releasing system ATP-binding protein LolD	1.42e-05	NA	3.18e-10	0.775
3. BF	Q65P77	Energy-coupling factor transporter ATP-binding protein EcfA1	2.92e-04	NA	1.28e-09	0.7527
3. BF	Q1GIE5	Spermidine/putrescine import ATP-binding protein PotA	5.21e-04	NA	3.07e-14	0.5887
3. BF	Q8DAV2	ATP-dependent lipid A-core flippase	6.00e-06	NA	5.68e-08	0.2297
3. BF	Q99RR8	Putative hemin import ATP-binding protein HrtA	1.55e-05	NA	3.79e-12	0.7909
3. BF	Q1IGM2	Taurine import ATP-binding protein TauB	2.23e-04	NA	4.06e-07	0.7492
3. BF	C0SP98	Putative oligopeptide transport ATP-binding protein YkfD	1.89e-09	NA	5.49e-61	0.823
3. BF	Q1BY14	Methionine import ATP-binding protein MetN 1	1.17e-05	NA	4.42e-21	0.6569
3. BF	Q02DK6	Methionine import ATP-binding protein MetN 2	1.84e-05	NA	4.42e-24	0.6583
3. BF	Q8NY21	Methionine import ATP-binding protein MetN 1	2.65e-05	NA	9.13e-22	0.6372
3. BF	Q4L884	Energy-coupling factor transporter ATP-binding protein EcfA2	9.75e-05	NA	8.34e-12	0.7362
3. BF	Q63H61	Energy-coupling factor transporter ATP-binding protein EcfA2	3.13e-05	NA	3.71e-14	0.7389
3. BF	Q601T6	Energy-coupling factor transporter ATP-binding protein EcfA2	6.61e-06	NA	9.83e-09	0.6741
3. BF	Q1CA99	Macrolide export ATP-binding/permease protein MacB 1	1.84e-02	NA	5.22e-09	0.3625
3. BF	Q578E9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.25e-04	NA	1.13e-13	0.5915
3. BF	Q3B276	Lipoprotein-releasing system ATP-binding protein LolD 2	2.46e-05	NA	4.16e-08	0.8005
3. BF	P24137	Oligopeptide transport ATP-binding protein OppF	1.94e-12	NA	1.97e-75	0.9326
3. BF	Q2NSZ1	Macrolide export ATP-binding/permease protein MacB	1.50e-02	NA	4.33e-09	0.3721
3. BF	Q1GB17	Spermidine/putrescine import ATP-binding protein PotA	2.22e-04	NA	1.15e-12	0.5765
3. BF	Q5F6V6	Macrolide export ATP-binding/permease protein MacB	6.10e-02	NA	7.36e-08	0.3831
3. BF	Q50293	Energy-coupling factor transporter ATP-binding protein EcfA2	6.70e-06	NA	1.70e-09	0.6617
3. BF	Q67SV5	Methionine import ATP-binding protein MetN	3.88e-05	NA	1.71e-16	0.638
3. BF	Q2SRI1	Energy-coupling factor transporter ATP-binding protein EcfA1	7.95e-07	NA	1.49e-06	0.5101
3. BF	Q5WJP0	Methionine import ATP-binding protein MetN 2	1.10e-05	NA	1.50e-18	0.6735
3. BF	Q8XED0	Macrolide export ATP-binding/permease protein MacB	9.98e-03	NA	2.58e-08	0.3649
3. BF	Q1J6Q6	Spermidine/putrescine import ATP-binding protein PotA	3.15e-04	NA	1.64e-16	0.5461
3. BF	Q4L885	Energy-coupling factor transporter ATP-binding protein EcfA1	2.16e-05	NA	2.56e-10	0.7845
3. BF	Q8DFC3	Methionine import ATP-binding protein MetN	1.25e-05	NA	9.27e-19	0.6466
3. BF	Q92EZ6	Methionine import ATP-binding protein MetN 1	1.10e-05	NA	1.19e-16	0.6734
3. BF	Q00752	Multiple sugar-binding transport ATP-binding protein MsmK	2.63e-04	NA	9.13e-12	0.5451
3. BF	Q04EY5	Energy-coupling factor transporter ATP-binding protein EcfA1	1.86e-04	NA	6.74e-12	0.7314
3. BF	Q8DRF9	Methionine import ATP-binding protein MetN	3.11e-05	NA	4.27e-19	0.663
3. BF	Q3J1N0	Methionine import ATP-binding protein MetN	2.60e-05	NA	7.72e-23	0.6463
3. BF	Q2JB14	Phosphonates import ATP-binding protein PhnC	8.96e-06	NA	1.69e-11	0.819
3. BF	Q4KES7	Macrolide export ATP-binding/permease protein MacB 1	2.25e-02	NA	2.45e-09	0.3729
3. BF	Q1JII9	Methionine import ATP-binding protein MetN	3.99e-05	NA	6.07e-18	0.6638
3. BF	Q722B1	Spermidine/putrescine import ATP-binding protein PotA	2.72e-04	NA	1.36e-15	0.5602
3. BF	Q5X9B6	Energy-coupling factor transporter ATP-binding protein EcfA2	3.45e-05	NA	6.15e-10	0.7643
3. BF	Q83F44	Methionine import ATP-binding protein MetN	1.65e-05	NA	2.85e-16	0.6371
3. BF	Q89LP2	Methionine import ATP-binding protein MetN	1.57e-05	NA	1.62e-23	0.6651
3. BF	P0A2V4	Oligopeptide transport ATP-binding protein OppF	1.25e-06	NA	1.54e-47	0.8121
3. BF	Q68W38	Lipoprotein-releasing system ATP-binding protein LolD	9.31e-05	NA	8.73e-10	0.8292
3. BF	Q1J8E4	Methionine import ATP-binding protein MetN	3.90e-05	NA	3.36e-18	0.662
3. BF	P55122	Leukotoxin translocation ATP-binding protein LktB	4.60e-04	NA	3.42e-11	0.257
3. BF	Q1QTX6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.33e-04	NA	6.55e-12	0.5641
3. BF	Q035B2	Energy-coupling factor transporter ATP-binding protein EcfA1	9.48e-05	NA	1.64e-09	0.7727
3. BF	Q8ZR89	Methionine import ATP-binding protein MetN 2	2.12e-05	NA	2.22e-22	0.6692
3. BF	Q1JNE0	Methionine import ATP-binding protein MetN	3.90e-05	NA	2.22e-18	0.6623
3. BF	Q2FJI0	Methionine import ATP-binding protein MetN 1	2.51e-05	NA	1.42e-21	0.6388
3. BF	Q73EL7	Methionine import ATP-binding protein MetN 2	8.65e-05	NA	3.44e-22	0.6835
3. BF	Q7W6G5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.16e-05	NA	2.78e-12	0.5712
3. BF	Q2NU23	Lipoprotein-releasing system ATP-binding protein LolD	9.21e-06	NA	7.85e-09	0.8494
3. BF	Q2SXD1	Lipoprotein-releasing system ATP-binding protein LolD	2.33e-05	NA	1.43e-12	0.7621
3. BF	P9WQK0	Uncharacterized ABC transporter ATP-binding protein MT1014	5.85e-05	NA	4.34e-09	0.7819
3. BF	P9WQK4	Uncharacterized ABC transporter ATP-binding protein MT0079	3.98e-03	NA	5.23e-05	0.5844
3. BF	A0AGP9	Spermidine/putrescine import ATP-binding protein PotA	2.12e-04	NA	1.43e-15	0.5606
3. BF	Q8FW07	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.83e-05	NA	1.13e-13	0.5907
3. BF	Q5PMK1	Spermidine/putrescine import ATP-binding protein PotA	6.27e-04	NA	2.12e-17	0.556
3. BF	P57032	Lipoprotein-releasing system ATP-binding protein LolD	2.67e-05	NA	9.00e-10	0.761
3. BF	O05253	Guanosine import ATP-binding protein NupO	2.65e-04	NA	0.029	0.2789
3. BF	Q9WXX0	Ribose import ATP-binding protein RbsA 1	9.27e-05	NA	2.44e-04	0.2791
3. BF	Q5ZUG5	Methionine import ATP-binding protein MetN	7.32e-05	NA	6.70e-16	0.6556
3. BF	P0A9U2	Probable multidrug ABC transporter ATP-binding protein YbhF	2.39e-04	NA	0.022	0.2613
3. BF	Q66CQ3	Methionine import ATP-binding protein MetN 1	3.55e-05	NA	1.35e-21	0.669
3. BF	A1JIE0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.76e-04	NA	1.10e-10	0.5644
3. BF	Q5PGH0	ATP-dependent lipid A-core flippase	3.54e-04	NA	1.36e-07	0.2525
3. BF	Q7VR29	Lipoprotein-releasing system ATP-binding protein LolD	8.83e-06	NA	4.87e-12	0.8116
3. BF	Q48PU6	Methionine import ATP-binding protein MetN 1	2.33e-05	NA	1.91e-24	0.6524
3. BF	Q1C6Q8	Lipoprotein-releasing system ATP-binding protein LolD	1.59e-05	NA	5.59e-10	0.8131
3. BF	Q8Z7H7	Spermidine/putrescine import ATP-binding protein PotA	5.04e-05	NA	1.90e-17	0.5589
3. BF	Q0RAT5	Spermidine/putrescine import ATP-binding protein PotA	4.55e-04	NA	1.36e-14	0.4386
3. BF	P96063	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	3.78e-04	NA	3.45e-18	0.5536
3. BF	P21629	High-affinity branched-chain amino acid transport ATP-binding protein BraF	5.90e-05	NA	3.66e-07	0.8011
3. BF	Q0SML1	Spermidine/putrescine import ATP-binding protein PotA	3.30e-04	NA	9.75e-20	0.6179
3. BF	Q50801	Putative ABC transporter ATP-binding protein MTBMA_c05830	3.80e-05	NA	1.88e-12	0.7431
3. BF	Q65S66	Fe(3+) ions import ATP-binding protein FbpC	1.41e-04	NA	2.08e-14	0.604
3. BF	Q2FER7	Energy-coupling factor transporter ATP-binding protein EcfA1	1.20e-04	NA	7.19e-12	0.784
3. BF	Q2NUA5	ATP-dependent lipid A-core flippase	2.78e-04	NA	1.44e-07	0.2551
3. BF	Q2T4S8	Arabinose import ATP-binding protein AraG 2	8.26e-04	NA	0.005	0.2784
3. BF	Q24QI5	Methionine import ATP-binding protein MetN	5.24e-05	NA	4.54e-17	0.6656
3. BF	Q31YV7	Galactose/methyl galactoside import ATP-binding protein MglA	1.24e-04	NA	1.52e-04	0.2875
3. BF	Q1LPJ9	Lipoprotein-releasing system ATP-binding protein LolD	2.75e-05	NA	6.13e-11	0.7712
3. BF	A1SWH9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.92e-04	NA	3.56e-15	0.553
3. BF	Q737I0	Putative ABC transporter ATP-binding protein BCE_2668	1.21e-04	NA	1.76e-07	0.2585
3. BF	Q0VQQ0	Lipoprotein-releasing system ATP-binding protein LolD	1.60e-04	NA	3.40e-12	0.8035
3. BF	E0SCY1	Glycine betaine/choline transport system ATP-binding protein OusV	2.67e-04	NA	8.97e-18	0.5339
3. BF	Q81CT8	Putative ABC transporter ATP-binding protein BC_2655	2.03e-04	NA	1.56e-07	0.2525
3. BF	Q5L3Q9	Energy-coupling factor transporter ATP-binding protein EcfA2	3.00e-06	NA	8.88e-12	0.7104
3. BF	Q0TIV6	Lipoprotein-releasing system ATP-binding protein LolD	9.01e-06	NA	2.61e-11	0.8264
3. BF	Q8U7G2	Methionine import ATP-binding protein MetN	1.76e-05	NA	8.13e-25	0.6305
3. BF	Q03A07	Methionine import ATP-binding protein MetN	1.16e-05	NA	1.33e-17	0.6548
3. BF	Q81VM2	Methionine import ATP-binding protein MetN 1	1.05e-05	NA	2.49e-18	0.64
3. BF	Q9PF03	Methionine import ATP-binding protein MetN	3.93e-05	NA	2.84e-23	0.6574
3. BF	Q74IV9	Methionine import ATP-binding protein MetN	1.10e-04	NA	8.06e-19	0.63
3. BF	Q8P4S7	Methionine import ATP-binding protein MetN	3.22e-05	NA	4.51e-26	0.6833
3. BF	Q13TV1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.89e-04	NA	2.17e-11	0.5695
3. BF	Q8U949	Ribose import ATP-binding protein RbsA 2	1.14e-04	NA	6.89e-04	0.3
3. BF	Q7MN25	Methionine import ATP-binding protein MetN	1.31e-05	NA	8.77e-19	0.6468
3. BF	Q62M41	Methionine import ATP-binding protein MetN 1	1.03e-05	NA	3.67e-21	0.6657
3. BF	Q6XYZ4	Energy-coupling factor transporter ATP-binding protein EcfA1	5.61e-05	NA	1.34e-08	0.7308
3. BF	P75612	Putative ABC transporter ATP-binding protein MG065 homolog	3.05e-05	NA	1.71e-10	0.2908
3. BF	Q3BNZ3	Methionine import ATP-binding protein MetN	3.15e-05	NA	7.07e-25	0.6823
3. BF	Q8FIM7	Lipoprotein-releasing system ATP-binding protein LolD	9.20e-06	NA	2.61e-11	0.8233
3. BF	Q4UMZ7	Lipoprotein-releasing system ATP-binding protein LolD	4.21e-03	NA	1.25e-09	0.8265
3. BF	Q4KBU0	Methionine import ATP-binding protein MetN 3	2.92e-04	NA	1.23e-18	0.6605
3. BF	P75552	Oligopeptide transport ATP-binding protein OppD	5.87e-04	NA	1.24e-24	0.5273
3. BF	Q1CGD7	Macrolide export ATP-binding/permease protein MacB 2	4.57e-02	NA	5.22e-09	0.359
3. BF	Q57R58	Macrolide export ATP-binding/permease protein MacB	2.27e-02	NA	8.55e-07	0.3608
3. BF	Q6HBS0	Methionine import ATP-binding protein MetN 2	1.93e-05	NA	8.51e-20	0.6816
3. BF	Q1I966	Macrolide export ATP-binding/permease protein MacB 1	2.27e-02	NA	1.52e-09	0.3713
3. BF	Q47T99	Spermidine/putrescine import ATP-binding protein PotA	2.02e-04	NA	1.58e-16	0.5665
3. BF	Q8RDH4	Dipeptide transport ATP-binding protein DppD	9.96e-06	NA	1.87e-22	0.7692
3. BF	Q13ER6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.62e-04	NA	1.48e-11	0.581
3. BF	Q48KI4	Lipoprotein-releasing system ATP-binding protein LolD	3.11e-03	NA	2.96e-12	0.8393
3. BF	Q0BMC9	Methionine import ATP-binding protein MetN	1.41e-05	NA	1.07e-23	0.6243
3. BF	Q1WSB9	Energy-coupling factor transporter ATP-binding protein EcfA2	2.69e-06	NA	5.29e-14	0.7008
3. BF	Q2K9A3	Ribose import ATP-binding protein RbsA 1	1.10e-03	NA	0.002	0.2692
3. BF	Q1JEC9	Energy-coupling factor transporter ATP-binding protein EcfA2	3.50e-05	NA	6.15e-10	0.7087
3. BF	Q5PGK9	Macrolide export ATP-binding/permease protein MacB	2.86e-02	NA	8.69e-07	0.3608
3. BF	Q2K1C8	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	1.59e-04	NA	3.51e-13	0.5949
3. BF	Q0A8P9	Lipoprotein-releasing system ATP-binding protein LolD	9.37e-06	NA	2.35e-11	0.8081
3. BF	Q7NTU0	Lipoprotein-releasing system ATP-binding protein LolD	2.21e-05	NA	1.24e-13	0.8219
3. BF	Q5YRD1	Methionine import ATP-binding protein MetN	4.35e-05	NA	8.44e-21	0.6794
3. BF	Q12BC9	Phosphonates import ATP-binding protein PhnC	2.32e-05	NA	1.00e-06	0.6941
3. BF	Q8DRR9	Energy-coupling factor transporter ATP-binding protein EcfA1	2.25e-04	NA	3.28e-14	0.7398
3. BF	Q5HDY6	Energy-coupling factor transporter ATP-binding protein EcfA1	4.60e-05	NA	7.19e-12	0.7817
3. BF	Q0BZD8	Phosphonates import ATP-binding protein PhnC	5.52e-06	NA	1.58e-13	0.7701
3. BF	Q56993	Hemin import ATP-binding protein HmuV	4.52e-04	NA	3.65e-08	0.7209
3. BF	Q5FFC0	Lipoprotein-releasing system ATP-binding protein LolD	2.44e-03	NA	1.05e-07	0.8501
3. BF	P0A194	High-affinity branched-chain amino acid transport ATP-binding protein LivG	1.04e-04	NA	2.61e-08	0.7949
3. BF	Q9RDI1	Ribose import ATP-binding protein RbsA 2	8.61e-03	NA	0.014	0.2835
3. BF	Q1WVG9	Methionine import ATP-binding protein MetN	8.79e-05	NA	9.43e-15	0.6303
3. BF	Q6F813	Macrolide export ATP-binding/permease protein MacB	3.19e-02	NA	2.95e-08	0.341
3. BF	Q881Q1	Macrolide export ATP-binding/permease protein MacB 2	3.02e-02	NA	4.96e-08	0.3518
3. BF	A3CRB8	Energy-coupling factor transporter ATP-binding protein EcfA2	2.97e-05	NA	4.29e-10	0.7225
3. BF	F8DT93	Lipoprotein-releasing system ATP-binding protein LolD	1.19e-05	NA	2.77e-10	0.7962
3. BF	A0PXX8	Energy-coupling factor transporter ATP-binding protein EcfA2	1.53e-04	NA	1.08e-09	0.6974
3. BF	P42423	ABC transporter ATP-binding protein YxdL	1.02e-04	NA	2.24e-08	0.741
3. BF	Q2T4B3	Macrolide export ATP-binding/permease protein MacB	3.33e-02	NA	3.69e-05	0.3745
3. BF	Q8ELA5	Methionine import ATP-binding protein MetN 4	5.68e-06	NA	6.36e-19	0.6579
3. BF	Q2SZW0	ATP-dependent lipid A-core flippase	4.48e-05	NA	1.89e-06	0.2587
3. BF	Q81XL3	Methionine import ATP-binding protein MetN 3	2.05e-05	NA	8.12e-20	0.6799
3. BF	Q0BG60	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.35e-04	NA	6.81e-05	0.2748
3. BF	Q0KDG3	Methionine import ATP-binding protein MetN	2.43e-05	NA	5.36e-20	0.6717
3. BF	Q3J7S3	Lipoprotein-releasing system ATP-binding protein LolD	2.93e-05	NA	1.27e-10	0.8082
3. BF	Q49W48	Methionine import ATP-binding protein MetN	1.39e-05	NA	1.65e-20	0.6562
3. BF	Q1CNC6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.09e-04	NA	1.16e-10	0.569
3. BF	Q73L25	Lipoprotein-releasing system ATP-binding protein LolD	5.34e-05	NA	9.51e-11	0.8322
3. BF	Q38UT9	Energy-coupling factor transporter ATP-binding protein EcfA1	7.13e-05	NA	1.17e-10	0.7136
3. BF	P47260	Putative ABC transporter ATP-binding protein MG014	1.52e-05	NA	0.001	0.2423
3. BF	Q66FU4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.15e-04	NA	1.14e-10	0.5713
3. BF	A0A1U9YI12	ABC-type transmembrane transporter verA	6.30e-03	NA	3.94e-09	0.2322
3. BF	Q57S53	Methionine import ATP-binding protein MetN 2	2.05e-05	NA	1.74e-22	0.6695
3. BF	Q080S4	Lipoprotein-releasing system ATP-binding protein LolD	3.00e-05	NA	3.76e-13	0.7999
3. BF	Q81J15	Energy-coupling factor transporter ATP-binding protein EcfA2	5.84e-05	NA	1.12e-15	0.7056
3. BF	Q7N3A6	Lipoprotein-releasing system ATP-binding protein LolD	1.88e-05	NA	4.24e-11	0.8005
3. BF	Q7VM95	Methionine import ATP-binding protein MetN	9.27e-06	NA	2.96e-20	0.6676
3. BF	Q1C138	Autoinducer 2 import ATP-binding protein LsrA	8.52e-05	NA	6.26e-07	0.2716
3. BF	P60753	ATP-dependent lipid A-core flippase	9.45e-04	NA	7.62e-08	0.2502
3. BF	Q0SFW6	Methionine import ATP-binding protein MetN 2	4.78e-05	NA	1.06e-22	0.6646
3. BF	Q1AVD3	Ribose import ATP-binding protein RbsA 2	6.06e-05	NA	5.97e-04	0.2889
3. BF	Q7VZ31	Lipoprotein-releasing system ATP-binding protein LolD	2.11e-04	NA	4.71e-11	0.8112
3. BF	Q7N6F9	Macrolide export ATP-binding/permease protein MacB	3.68e-03	NA	3.92e-06	0.3692
3. BF	Q7WH20	ATP-dependent lipid A-core flippase	8.24e-05	NA	3.47e-07	0.2627
3. BF	Q9CM47	Macrolide export ATP-binding/permease protein MacB	3.29e-02	NA	1.97e-08	0.3732
3. BF	Q6G2E2	Methionine import ATP-binding protein MetN	2.07e-05	NA	5.52e-20	0.6542
3. BF	Q9I1C8	Methionine import ATP-binding protein MetN 1	3.57e-05	NA	9.41e-22	0.6148
3. BF	Q5WUF8	Lipoprotein-releasing system ATP-binding protein LolD	1.85e-03	NA	8.71e-15	0.8349
3. BF	Q8FWP2	Putative peptide import ATP-binding protein BRA0404/BS1330_II0401	5.88e-10	NA	1.59e-51	0.8502
3. BF	Q48GY7	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.33e-04	NA	5.17e-06	0.2765
3. BF	Q9HZL7	Lipoprotein-releasing system ATP-binding protein LolD	3.12e-05	NA	2.96e-12	0.8231
3. BF	A1B677	Macrolide export ATP-binding/permease protein MacB 1/2	9.70e-02	NA	1.13e-06	0.3552
3. BF	P0AAH9	Peptide transport system ATP-binding protein SapF	1.50e-06	NA	2.98e-33	0.8277
3. BF	Q4ZZR8	Methionine import ATP-binding protein MetN 1	2.57e-05	NA	8.98e-24	0.6513
3. BF	Q6YRJ4	Putative ABC transporter ATP-binding protein PAM_020	5.95e-05	NA	2.71e-07	0.2513
3. BF	P63400	Uncharacterized ABC transporter ATP-binding protein Mb2353c	4.36e-03	NA	0.002	0.2234
3. BF	Q2PBM0	Autoinducer 2 import ATP-binding protein LsrA	1.02e-04	NA	8.67e-07	0.2765
3. BF	D4GPW3	Glucose import ATP-binding protein TsgD13	1.57e-04	NA	0.004	0.2347
3. BF	Q6HP89	Methionine import ATP-binding protein MetN 1	9.01e-05	NA	3.67e-22	0.6742
3. BF	P47426	Energy-coupling factor transporter ATP-binding protein EcfA2	6.74e-06	NA	8.50e-11	0.6781
3. BF	Q2EHL8	Macrolide export ATP-binding/permease protein MacB	3.48e-02	NA	1.86e-08	0.3789
3. BF	Q6NDQ0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.32e-04	NA	8.79e-11	0.5884
3. BF	Q815Y7	Methionine import ATP-binding protein MetN 3	2.32e-05	NA	8.83e-20	0.6802
3. BF	Q07UI9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.64e-04	NA	6.39e-12	0.5759
3. BF	Q81J16	Energy-coupling factor transporter ATP-binding protein EcfA1	3.77e-04	NA	5.76e-10	0.7105
3. BF	Q8NXH5	Methionine import ATP-binding protein MetN 2	5.90e-05	NA	7.68e-20	0.6474
3. BF	Q7A471	Energy-coupling factor transporter ATP-binding protein EcfA2	9.67e-05	NA	5.13e-13	0.6737
3. BF	A5VU87	Putative peptide import ATP-binding protein BOV_A0348	7.11e-08	NA	3.63e-29	0.7187
3. BF	Q9CM08	Galactose/methyl galactoside import ATP-binding protein MglA	4.05e-04	NA	1.38e-05	0.288
3. BF	Q5X2Z8	Lipoprotein-releasing system ATP-binding protein LolD	2.09e-03	NA	2.29e-14	0.8309
3. BF	Q87JM4	Macrolide export ATP-binding/permease protein MacB	2.44e-02	NA	7.06e-11	0.3456
3. BF	Q5H503	Methionine import ATP-binding protein MetN	3.17e-05	NA	5.48e-23	0.6824
3. BF	P47311	Putative ABC transporter ATP-binding protein MG065	4.78e-05	NA	3.64e-10	0.4275
3. BF	Q473H8	Lipoprotein-releasing system ATP-binding protein LolD	4.14e-05	NA	1.21e-10	0.7852
3. BF	Q5HRU5	Methionine import ATP-binding protein MetN 1	1.29e-05	NA	1.40e-23	0.6623
3. BF	Q8Y8T6	Spermidine/putrescine import ATP-binding protein PotA	2.50e-04	NA	1.43e-15	0.5703
3. BF	Q1RK34	Lipoprotein-releasing system ATP-binding protein LolD	9.44e-05	NA	1.50e-10	0.8249
3. BF	Q5NFU5	Methionine import ATP-binding protein MetN	1.30e-05	NA	5.17e-23	0.6248
3. BF	Q6FZX3	Lipoprotein-releasing system ATP-binding protein LolD	1.43e-05	NA	3.96e-06	0.8405
3. BF	Q8XHV2	Energy-coupling factor transporter ATP-binding protein EcfA1	2.54e-05	NA	2.46e-16	0.7261
3. BF	Q6LN52	Methionine import ATP-binding protein MetN	1.38e-05	NA	1.09e-16	0.6468
3. BF	Q6AMR9	Lipoprotein-releasing system ATP-binding protein LolD	1.30e-05	NA	1.57e-06	0.8741
3. BF	Q9KQW9	ATP-dependent lipid A-core flippase	1.02e-05	NA	6.67e-07	0.2574
3. BF	Q8DMY0	Energy-coupling factor transporter ATP-binding protein EcfA2	3.19e-05	NA	3.52e-09	0.7178
3. BF	Q7A3X3	Putative hemin import ATP-binding protein HrtA	1.47e-05	NA	3.79e-12	0.8265
3. BF	Q8EIL8	Macrolide export ATP-binding/permease protein MacB	3.03e-02	NA	3.44e-09	0.3497
3. BF	Q8Y0C6	Lipoprotein-releasing system ATP-binding protein LolD	2.75e-05	NA	2.94e-11	0.7833
3. BF	Q4UQD2	Methionine import ATP-binding protein MetN	3.18e-05	NA	4.51e-26	0.6604
3. BF	Q98HF7	Spermidine/putrescine import ATP-binding protein PotA	1.64e-04	NA	1.40e-14	0.5945
3. BF	Q8XXB6	ATP-dependent lipid A-core flippase	2.31e-05	NA	7.31e-08	0.2528
3. BF	Q7NZU6	ATP-dependent lipid A-core flippase	1.70e-05	NA	1.10e-06	0.2712
3. BF	P57066	Lipoprotein-releasing system ATP-binding protein LolD	1.33e-05	NA	4.58e-11	0.8387
3. BF	Q9A6Z7	Lipoprotein-releasing system ATP-binding protein LolD 2	2.62e-03	NA	5.92e-08	0.82
3. BF	Q2YYM4	Energy-coupling factor transporter ATP-binding protein EcfA1	1.20e-04	NA	2.66e-11	0.7849
3. BF	Q1QVQ7	Methionine import ATP-binding protein MetN	1.47e-05	NA	6.18e-19	0.6661
3. BF	Q1QX72	Lipoprotein-releasing system ATP-binding protein LolD	3.61e-05	NA	8.96e-10	0.8262
3. BF	Q3SQZ1	Macrolide export ATP-binding/permease protein MacB	2.20e-02	NA	1.56e-07	0.3649
3. BF	Q73XU8	Sulfate/thiosulfate import ATP-binding protein CysA	2.09e-04	NA	1.04e-18	0.5737
3. BF	Q53193	Probable peptide ABC transporter ATP-binding protein y4tR	1.52e-08	NA	2.17e-32	0.7619
3. BF	Q92DL6	Spermidine/putrescine import ATP-binding protein PotA	2.29e-04	NA	1.54e-15	0.5709
3. BF	Q57DS9	Lipoprotein-releasing system ATP-binding protein LolD	4.40e-05	NA	1.43e-06	0.7937
3. BF	Q7VV72	Methionine import ATP-binding protein MetN	6.34e-05	NA	1.91e-24	0.6333
3. BF	Q5E0F2	ATP-dependent lipid A-core flippase	1.64e-04	NA	1.06e-08	0.2238
3. BF	Q9ZB70	Putative ABC transporter ATP-binding protein MG468.1	6.08e-03	NA	8.63e-11	0.6607
3. BF	Q2A4V5	Lipoprotein-releasing system ATP-binding protein LolD	9.37e-06	NA	8.03e-12	0.8118
3. BF	Q72Y96	Methionine import ATP-binding protein MetN 3	2.15e-05	NA	7.47e-20	0.6827
3. BF	Q87AL9	Methionine import ATP-binding protein MetN	3.11e-05	NA	8.81e-24	0.6558
3. BF	Q3B2U2	Lipoprotein-releasing system ATP-binding protein LolD 1	6.97e-05	NA	3.44e-09	0.8053
3. BF	Q32JQ8	Methionine import ATP-binding protein MetN	8.91e-06	NA	4.56e-20	0.6699
3. BF	Q73F11	Methionine import ATP-binding protein MetN 1	1.02e-05	NA	1.03e-18	0.6417
3. BF	Q57QD7	Lipoprotein-releasing system ATP-binding protein LolD	6.63e-06	NA	3.60e-11	0.833
3. BF	Q64SQ6	Spermidine/putrescine import ATP-binding protein PotA	8.71e-04	NA	2.33e-11	0.4565
3. BF	Q87R16	ATP-dependent lipid A-core flippase	1.78e-04	NA	5.91e-07	0.225
3. BF	Q2YK63	Putative peptide import ATP-binding protein BAB2_0817	8.52e-08	NA	8.82e-30	0.6957
3. BF	Q2NRN5	Methionine import ATP-binding protein MetN	8.26e-06	NA	6.44e-19	0.6406
3. BF	Q1CJW8	Macrolide export ATP-binding/permease protein MacB 1	3.32e-02	NA	2.04e-10	0.3536
3. BF	Q9KS33	Spermidine/putrescine import ATP-binding protein PotA	7.65e-05	NA	4.94e-18	0.5505
3. BF	A0L0V9	Macrolide export ATP-binding/permease protein MacB	4.00e-02	NA	1.74e-09	0.3679
3. BF	Q0TLD2	Methionine import ATP-binding protein MetN	8.74e-06	NA	6.08e-20	0.6699
3. BF	Q5FUV5	Lipoprotein-releasing system ATP-binding protein LolD	4.59e-05	NA	5.98e-05	0.8127
3. BF	Q87VF3	ATP-dependent lipid A-core flippase	1.08e-04	NA	8.22e-06	0.2436
3. BF	Q81IZ6	Methionine import ATP-binding protein MetN 1	8.75e-06	NA	1.24e-18	0.657
3. BF	P72335	Nod factor export ATP-binding protein I	1.02e-03	NA	1.36e-04	0.6603
3. BF	Q12B04	Methionine import ATP-binding protein MetN	2.29e-05	NA	2.57e-23	0.6352
3. BF	Q2P7S3	Methionine import ATP-binding protein MetN	3.15e-05	NA	5.48e-23	0.6598
3. BF	Q8EEV5	Lipoprotein-releasing system ATP-binding protein LolD	6.45e-05	NA	1.46e-12	0.8111
3. BF	Q3K9F9	Lipoprotein-releasing system ATP-binding protein LolD	2.45e-05	NA	7.15e-11	0.8246
3. BF	P47705	Putative ABC transporter ATP-binding protein MG467	4.12e-04	NA	3.59e-16	0.6236
3. BF	Q8DAV6	Lipoprotein-releasing system ATP-binding protein LolD	2.67e-05	NA	1.54e-11	0.8241
3. BF	Q8FDZ8	Alpha-hemolysin translocation ATP-binding protein HlyB	6.58e-04	NA	1.01e-10	0.258
3. BF	Q882I8	Arabinose import ATP-binding protein AraG	6.37e-04	NA	0.006	0.2514
3. BF	A1BCE9	Macrolide export ATP-binding/permease protein MacB 3	2.90e-02	NA	1.36e-07	0.364
3. BF	Q2YIV5	Methionine import ATP-binding protein MetN	2.13e-05	NA	4.43e-19	0.6336
3. BF	Q8ENU2	Methionine import ATP-binding protein MetN 2	1.51e-05	NA	6.18e-21	0.6602
3. BF	Q6G3A6	Lipoprotein-releasing system ATP-binding protein LolD	1.37e-05	NA	1.92e-06	0.7912
3. BF	Q92UI2	Ribose import ATP-binding protein RbsA 3	2.02e-04	NA	1.34e-05	0.2859
3. BF	Q92LX3	Methionine import ATP-binding protein MetN	1.25e-05	NA	1.96e-26	0.6505
3. BF	Q2KVK2	Methionine import ATP-binding protein MetN	4.34e-05	NA	8.16e-24	0.6366
3. BF	Q0TIU8	Spermidine/putrescine import ATP-binding protein PotA	4.81e-05	NA	4.96e-17	0.5477
3. BF	Q6D4W8	Arabinose import ATP-binding protein AraG	3.16e-04	NA	0.019	0.2835
3. BF	P38046	Nitrate import ATP-binding protein NrtD	2.54e-04	NA	5.49e-12	0.7294
3. BF	Q6D5H7	Methionine import ATP-binding protein MetN 1	1.09e-05	NA	1.18e-23	0.6479
3. BF	Q2IXX0	Macrolide export ATP-binding/permease protein MacB	3.11e-02	NA	9.68e-07	0.3414
3. BF	Q47JR8	ATP-dependent lipid A-core flippase	1.85e-04	NA	1.24e-04	0.2781
3. BF	Q1QE80	Spermidine/putrescine import ATP-binding protein PotA	3.12e-04	NA	1.37e-18	0.5343
3. BF	Q2LVM2	Lipoprotein-releasing system ATP-binding protein LolD	1.14e-05	NA	4.65e-12	0.8272
3. BF	Q48PN3	Methionine import ATP-binding protein MetN 2	1.62e-04	NA	6.63e-21	0.5907
3. BF	Q2RU16	Lipoprotein-releasing system ATP-binding protein LolD 1	3.22e-05	NA	8.33e-07	0.7982
3. BF	Q02SA6	Taurine import ATP-binding protein TauB	2.35e-04	NA	3.02e-10	0.7494
3. BF	Q6GIH9	Methionine import ATP-binding protein MetN 2	5.03e-05	NA	4.82e-20	0.6467
3. BF	Q7NRX5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.36e-04	NA	6.27e-14	0.5726
3. BF	Q6GC27	Methionine import ATP-binding protein MetN 1	1.11e-05	NA	9.13e-22	0.6422
3. BF	Q70GD4	Hemin import ATP-binding protein HmuV	1.18e-03	NA	0.003	0.7797
3. BF	Q6D3Q6	Methionine import ATP-binding protein MetN 2	1.46e-05	NA	8.42e-24	0.6409
3. BF	Q0HJG0	Lipoprotein-releasing system ATP-binding protein LolD	6.90e-05	NA	1.47e-12	0.8091
3. BF	Q92W60	Ribose import ATP-binding protein RbsA 2	9.74e-05	NA	6.32e-05	0.285
3. BF	Q2J2E9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.36e-04	NA	6.88e-12	0.57
3. BF	O86751	Fe(3+) ions import ATP-binding protein FbpC	8.81e-05	NA	6.21e-09	0.6048
3. BF	A0B3Z7	Arabinose import ATP-binding protein AraG 2	4.15e-04	NA	4.59e-04	0.2756
3. BF	Q0VT01	Macrolide export ATP-binding/permease protein MacB	7.80e-02	NA	8.75e-10	0.3654
3. BF	P9WQJ4	Uncharacterized ABC transporter ATP-binding protein MT1318	5.99e-06	NA	4.12e-44	0.2955
3. BF	Q31YT6	ATP-dependent lipid A-core flippase	9.55e-04	NA	7.62e-08	0.25
3. BF	P0AAH6	Peptide transport system ATP-binding protein SapD	1.75e-07	NA	2.05e-22	0.7206
3. BF	Q1CA68	ATP-dependent lipid A-core flippase	4.66e-04	NA	1.82e-07	0.257
3. BF	Q9WYI7	Uncharacterized ABC transporter ATP-binding protein TM_0352	5.35e-05	NA	7.38e-11	0.8114
3. BF	Q5PID0	Methionine import ATP-binding protein MetN 1	9.38e-06	NA	4.19e-20	0.6706
3. BF	Q7CHF8	Methionine import ATP-binding protein MetN 2	1.92e-05	NA	1.35e-21	0.6421
3. BF	P69875	Spermidine/putrescine import ATP-binding protein PotA	6.04e-04	NA	4.96e-17	0.5526
3. BF	Q890R3	Energy-coupling factor transporter ATP-binding protein EcfA2	1.66e-04	NA	2.81e-12	0.6858
3. BF	Q1R9S4	Galactose/methyl galactoside import ATP-binding protein MglA	8.80e-05	NA	1.39e-04	0.2851
3. BF	A0LUE6	Spermidine/putrescine import ATP-binding protein PotA	2.12e-04	NA	8.13e-17	0.5371
3. BF	Q5HQQ9	Methionine import ATP-binding protein MetN 2	5.65e-05	NA	1.99e-20	0.6382
3. BF	Q9JVR5	Macrolide export ATP-binding/permease protein MacB	5.83e-02	NA	4.06e-08	0.3847
3. BF	Q3JMW7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.97e-04	NA	3.93e-10	0.5691
3. BF	Q8X5D9	Galactose/methyl galactoside import ATP-binding protein MglA	1.37e-04	NA	1.37e-04	0.2852
3. BF	Q6D664	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	2.39e-08	0.8196
3. BF	Q7A1Z1	Phosphonates import ATP-binding protein PhnC	3.58e-06	NA	4.20e-09	0.8106
3. BF	P0AAH5	Peptide transport system ATP-binding protein SapD	2.04e-07	NA	2.05e-22	0.7071
3. BF	Q7W4E1	Methionine import ATP-binding protein MetN	6.49e-05	NA	1.91e-24	0.6414
3. BF	Q669P3	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	7.19e-10	0.8144
3. BF	Q82JY6	Fe(3+) ions import ATP-binding protein FbpC	7.28e-05	NA	4.38e-09	0.6006
3. BF	Q46ZM0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	4.27e-04	NA	1.85e-11	0.5589
3. BF	Q83MC5	Methionine import ATP-binding protein MetN	1.03e-05	NA	4.96e-20	0.6616
3. BF	Q8Z824	Macrolide export ATP-binding/permease protein MacB	4.48e-02	NA	8.62e-07	0.3608
3. BF	Q3ARY3	Lipoprotein-releasing system ATP-binding protein LolD 2	7.47e-05	NA	1.07e-09	0.7955
3. BF	Q3KBH4	Spermidine/putrescine import ATP-binding protein PotA	7.45e-04	NA	1.15e-18	0.563
3. BF	Q5LYN4	Spermidine/putrescine import ATP-binding protein PotA	7.44e-04	NA	1.48e-16	0.5443
3. BF	Q8ETV7	Energy-coupling factor transporter ATP-binding protein EcfA1	3.54e-04	NA	4.24e-11	0.7309
3. BF	Q5ZT78	Lipoprotein-releasing system ATP-binding protein LolD	1.39e-05	NA	2.04e-14	0.8446
3. BF	Q1J450	Energy-coupling factor transporter ATP-binding protein EcfA2	2.35e-07	NA	6.15e-10	0.7575
3. BF	Q659V4	Hemin import ATP-binding protein HmuV	4.38e-04	NA	0.001	0.7845
3. BF	Q2SJ99	Ribose import ATP-binding protein RbsA	3.22e-05	NA	1.35e-05	0.2912
3. BF	Q7A7E3	Methionine import ATP-binding protein MetN 1	2.51e-05	NA	1.42e-21	0.6511
3. BF	Q7M8U0	Macrolide export ATP-binding/permease protein MacB	3.61e-02	NA	2.69e-09	0.3559
3. BF	Q8RBQ1	Putative ribose/galactose/methyl galactoside import ATP-binding protein	4.09e-05	NA	8.52e-06	0.302
3. BF	Q135Z8	Lipoprotein-releasing system ATP-binding protein LolD	1.53e-05	NA	1.42e-06	0.7886
3. BF	Q88XV1	Energy-coupling factor transporter ATP-binding protein EcfA2	3.24e-05	NA	1.42e-15	0.6843
3. BF	Q0TMS7	Energy-coupling factor transporter ATP-binding protein EcfA1	2.56e-05	NA	2.46e-16	0.7195
3. BF	Q8XHV3	Energy-coupling factor transporter ATP-binding protein EcfA2	3.80e-04	NA	7.36e-12	0.6929
3. BF	Q5MZ53	Bicarbonate transport ATP-binding protein CmpD	2.30e-04	NA	2.78e-10	0.719
3. BF	Q6GFJ1	Putative multidrug export ATP-binding/permease protein SAR1956	9.17e-06	NA	2.24e-07	0.2218
3. BF	Q312H8	Lipoprotein-releasing system ATP-binding protein LolD	2.35e-05	NA	1.98e-07	0.8053
3. BF	Q4KJB2	ATP-dependent lipid A-core flippase	9.89e-05	NA	3.35e-06	0.2309
3. BF	Q31GF5	Lipoprotein-releasing system ATP-binding protein LolD	2.78e-05	NA	1.17e-11	0.8095
3. BF	Q6MCV4	Spermidine/putrescine import ATP-binding protein PotA	1.24e-04	NA	2.27e-18	0.5609
3. BF	Q5HLN4	Putative hemin import ATP-binding protein HrtA	1.34e-05	NA	2.66e-16	0.8131
3. BF	Q1IGN4	Methionine import ATP-binding protein MetN 1	2.43e-05	NA	1.35e-23	0.619
3. BF	P94360	Oligosaccharides import ATP-binding protein MsmX	1.29e-04	NA	1.23e-12	0.5739
3. BF	Q81IN8	Methionine import ATP-binding protein MetN 2	5.29e-05	NA	6.75e-22	0.665
3. BF	P57030	Lipoprotein-releasing system ATP-binding protein LolD	1.27e-05	NA	1.94e-08	0.8404
3. BF	Q5XDS8	Methionine import ATP-binding protein MetN	3.93e-05	NA	2.35e-18	0.6625
3. BF	Q8UII7	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	3.54e-04	NA	2.20e-12	0.5699
3. BF	Q4ZRC6	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.80e-04	NA	1.83e-05	0.2738
3. BF	Q66CL2	Macrolide export ATP-binding/permease protein MacB 1	2.56e-02	NA	5.22e-09	0.3598
3. BF	Q7MJ01	Lipoprotein-releasing system ATP-binding protein LolD	2.75e-05	NA	1.54e-11	0.8276
3. BF	Q99WE1	Methionine import ATP-binding protein MetN 1	2.54e-05	NA	1.42e-21	0.6501
3. BF	Q1RFY9	Methionine import ATP-binding protein MetN	9.22e-06	NA	5.97e-20	0.6697
3. BF	Q63NI4	Methionine import ATP-binding protein MetN 2	3.88e-05	NA	7.22e-21	0.5795
3. BF	Q73F66	Energy-coupling factor transporter ATP-binding protein EcfA2	6.57e-05	NA	1.49e-16	0.7373
3. BF	Q2L219	Lipoprotein-releasing system ATP-binding protein LolD	3.07e-05	NA	1.47e-10	0.8209
3. BF	Q4KDI2	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.49e-04	NA	8.80e-07	0.2861
3. BF	Q631Y4	Methionine import ATP-binding protein MetN 3	1.93e-05	NA	7.97e-20	0.6818
3. BF	Q8ZRM9	Methionine import ATP-binding protein MetN 1	9.11e-06	NA	3.55e-20	0.6708
3. BF	Q0SRL2	Spermidine/putrescine import ATP-binding protein PotA	1.49e-04	NA	1.56e-15	0.5988
3. BF	Q8UFV7	Lipoprotein-releasing system ATP-binding protein LolD	3.90e-05	NA	6.55e-05	0.8203
3. BF	Q65F80	Methionine import ATP-binding protein MetN 2	6.67e-05	NA	9.17e-19	0.6736
3. BF	P53706	Alpha-factor-transporting ATPase	1.07e-02	NA	7.18e-06	0.2263
3. BF	P75110	Putative ABC transporter ATP-binding protein MG467 homolog	4.30e-04	NA	1.42e-14	0.5799
3. BF	P45081	ATP-binding/permease protein CydC	5.13e-05	NA	9.74e-05	0.2214
3. BF	Q9CMG7	ATP-dependent lipid A-core flippase	2.13e-04	NA	2.10e-08	0.2558
3. BF	Q6YPR6	Spermidine/putrescine import ATP-binding protein PotA	4.06e-06	NA	9.02e-14	0.4581
3. BF	P57383	Lipoprotein-releasing system ATP-binding protein LolD	1.33e-05	NA	7.30e-13	0.8741
3. BF	Q15UY7	ATP-dependent lipid A-core flippase	4.67e-06	NA	6.48e-08	0.2351
3. BF	P36638	Peptide transport system ATP-binding protein SapF	1.50e-06	NA	4.71e-34	0.8079
3. BF	Q667L9	Methionine import ATP-binding protein MetN 2	9.50e-06	NA	5.59e-20	0.6678
3. BF	Q0I3C2	Lipoprotein-releasing system ATP-binding protein LolD	1.67e-05	NA	3.88e-10	0.8583
3. BF	Q8CRB0	Putative hemin import ATP-binding protein HrtA	1.25e-05	NA	3.13e-16	0.8151
3. BF	Q65VG9	Methionine import ATP-binding protein MetN	9.29e-06	NA	7.22e-17	0.6602
3. BF	Q8Y455	Energy-coupling factor transporter ATP-binding protein EcfA2	9.07e-05	NA	6.86e-15	0.7414
3. BF	P24136	Oligopeptide transport ATP-binding protein OppD	3.96e-05	NA	1.80e-37	0.707
3. BF	P26905	Dipeptide transport ATP-binding protein DppD	7.35e-08	NA	1.68e-34	0.7261
3. BF	Q99XI2	Energy-coupling factor transporter ATP-binding protein EcfA2	2.19e-07	NA	6.15e-10	0.7347
3. BF	Q5NHP2	Lipoprotein-releasing system ATP-binding protein LolD	1.02e-05	NA	8.03e-12	0.813
3. BF	Q7NQN5	Spermidine/putrescine import ATP-binding protein PotA	1.17e-04	NA	1.92e-19	0.5888
3. BF	Q2RQQ0	Lipoprotein-releasing system ATP-binding protein LolD 2	1.38e-03	NA	5.79e-11	0.8431
3. BF	Q8PKT0	Lipoprotein-releasing system ATP-binding protein LolD	2.76e-05	NA	1.12e-12	0.8035
3. BF	Q39AT4	Methionine import ATP-binding protein MetN 2	4.82e-05	NA	1.79e-22	0.5874
3. BF	Q88WA5	Methionine import ATP-binding protein MetN 1	1.53e-05	NA	1.14e-17	0.6444
3. BF	Q3Z300	Lipoprotein-releasing system ATP-binding protein LolD	7.88e-06	NA	2.61e-11	0.8135
3. BF	Q5PGR6	Lipoprotein-releasing system ATP-binding protein LolD	7.18e-06	NA	3.40e-11	0.832
3. BF	Q2SMT0	Putative ribose/galactose/methyl galactoside import ATP-binding protein	9.76e-05	NA	7.68e-06	0.2795
3. BF	Q62J04	Lipoprotein-releasing system ATP-binding protein LolD	3.31e-05	NA	1.31e-12	0.7531
3. BF	P45095	Dipeptide transport ATP-binding protein DppD	4.41e-07	NA	2.80e-32	0.7306
3. BF	Q13X01	Lipoprotein-releasing system ATP-binding protein LolD	2.74e-05	NA	1.39e-11	0.7714
3. BF	P02915	Histidine transport ATP-binding protein HisP	6.99e-06	NA	4.20e-13	0.8377
3. BF	Q4K681	Spermidine/putrescine import ATP-binding protein PotA	2.36e-04	NA	7.57e-16	0.5782
3. BF	A0R8K9	Energy-coupling factor transporter ATP-binding protein EcfA2	7.36e-05	NA	1.72e-16	0.7556
3. BF	Q2IF17	Lipoprotein-releasing system ATP-binding protein LolD	2.26e-05	NA	2.12e-11	0.8294
3. BF	Q3SFZ6	ATP-dependent lipid A-core flippase	1.72e-04	NA	1.68e-05	0.2667
3. BF	P42065	Oligopeptide transport ATP-binding protein AppF	2.42e-09	NA	2.16e-57	0.7981
3. BF	Q9KFL0	Phosphonates import ATP-binding protein PhnC 2	9.45e-06	NA	3.79e-11	0.8234
3. BF	Q8CQS7	Methionine import ATP-binding protein MetN 2	1.27e-05	NA	1.40e-23	0.6629
3. BF	Q6A6X6	Methionine import ATP-binding protein MetN	1.95e-05	NA	2.01e-18	0.6307
3. BF	Q02ME3	Methionine import ATP-binding protein MetN 1	5.93e-05	NA	9.50e-22	0.6149
3. BF	Q3KK97	Methionine import ATP-binding protein MetN 1	2.30e-05	NA	5.55e-24	0.6494
3. BF	Q8NV47	Putative hemin import ATP-binding protein HrtA	1.56e-05	NA	3.97e-12	0.7956
3. BF	Q6G799	Energy-coupling factor transporter ATP-binding protein EcfA1	1.10e-04	NA	2.47e-11	0.8023
3. BF	Q7UPK3	Lipoprotein-releasing system ATP-binding protein LolD 2	5.49e-03	NA	6.35e-13	0.788
3. BF	Q1BHS6	Lipoprotein-releasing system ATP-binding protein LolD	2.87e-05	NA	5.61e-13	0.7416
3. BF	Q3JPZ4	Methionine import ATP-binding protein MetN 1	2.08e-05	NA	3.67e-21	0.6665
3. BF	Q839D4	Energy-coupling factor transporter ATP-binding protein EcfA2	1.15e-04	NA	4.65e-16	0.7132
3. BF	Q5F4X8	ATP-dependent lipid A-core flippase	9.12e-05	NA	4.68e-05	0.2342
3. BF	Q045Z7	Energy-coupling factor transporter ATP-binding protein EcfA2	3.56e-06	NA	4.18e-12	0.7092
3. BF	Q12ES3	Lipoprotein-releasing system ATP-binding protein LolD	1.41e-05	NA	1.86e-11	0.8142
3. BF	A1KF14	Multidrug efflux ATP-binding/permease protein BCG_0231	2.13e-03	NA	1.32e-08	0.2547
3. BF	Q2IYS5	Phosphonates import ATP-binding protein PhnC 1	1.12e-04	NA	7.31e-15	0.7076
3. BF	Q5LUD0	Lipoprotein-releasing system ATP-binding protein LolD	1.85e-03	NA	7.79e-06	0.8356
3. BF	Q9CIN4	Methionine import ATP-binding protein MetN	7.26e-05	NA	3.77e-17	0.6113
3. BF	Q0AU85	Methionine import ATP-binding protein MetN	1.45e-05	NA	1.53e-22	0.6725
3. BF	A7A063	ABC transporter NFT1	2.17e-02	NA	0.003	0.2539
3. BF	Q9EYM2	Lipoprotein-releasing system ATP-binding protein LolD	2.80e-05	NA	1.77e-11	0.8657
3. BF	O28881	Probable branched-chain amino acid transport ATP-binding protein LivG	2.75e-05	NA	2.43e-04	0.7489
3. BF	Q5F8K2	Lipoprotein-releasing system ATP-binding protein LolD	1.26e-05	NA	3.45e-08	0.7937
3. BF	P45247	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	1.22e-10	0.8779
3. BF	O26236	Putative ABC transporter ATP-binding protein MTH_133	3.71e-05	NA	3.10e-14	0.7243
3. BF	Q12NL5	Lipoprotein-releasing system ATP-binding protein LolD	9.29e-06	NA	1.51e-12	0.8132
3. BF	A1A9B7	Macrolide export ATP-binding/permease protein MacB 1	2.11e-02	NA	6.49e-08	0.3651
3. BF	Q2SMN9	Macrolide export ATP-binding/permease protein MacB	2.92e-02	NA	4.46e-08	0.3719
3. BF	P69877	Spermidine/putrescine import ATP-binding protein PotA	4.88e-05	NA	4.96e-17	0.5424
3. BF	Q87UV4	Methionine import ATP-binding protein MetN 1	5.53e-05	NA	1.36e-21	0.5903
3. BF	Q035E0	Phosphonates import ATP-binding protein PhnC	7.16e-05	NA	9.56e-10	0.7935
3. BF	Q1CGH0	ATP-dependent lipid A-core flippase	4.47e-04	NA	1.82e-07	0.2501
3. BF	Q65P76	Energy-coupling factor transporter ATP-binding protein EcfA2	1.71e-05	NA	1.97e-14	0.747
3. BF	Q2YVT7	Methionine import ATP-binding protein MetN 1	2.63e-05	NA	6.90e-22	0.6379
3. BF	Q6MMY0	Lipoprotein-releasing system ATP-binding protein LolD	1.63e-05	NA	4.06e-11	0.8335
3. BF	Q2YYM5	Energy-coupling factor transporter ATP-binding protein EcfA2	1.02e-04	NA	5.63e-13	0.6742
3. BF	Q98DA2	Methionine import ATP-binding protein MetN	3.87e-05	NA	7.45e-15	0.6215
3. BF	Q3MB44	Ribose import ATP-binding protein RbsA	4.39e-05	NA	0.001	0.2655
3. BF	Q48V78	Methionine import ATP-binding protein MetN	3.90e-05	NA	2.22e-18	0.6642
3. BF	P57031	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	1.94e-08	0.841
3. BF	Q8YIT2	Macrolide export ATP-binding/permease protein MacB	3.44e-02	NA	7.31e-07	0.3647
3. BF	Q92NU9	Macrolide export ATP-binding/permease protein MacB	8.09e-02	NA	4.36e-07	0.3747
3. BF	Q8Y4L8	Methionine import ATP-binding protein MetN 2	1.78e-05	NA	2.90e-22	0.659
3. BF	Q8VQK7	Putative peptide import ATP-binding protein BruAb2_1034	8.77e-09	NA	8.27e-44	0.74
3. BF	P14788	Sulfate/thiosulfate import ATP-binding protein CysA	2.45e-04	NA	2.79e-17	0.622
3. BF	Q1QLB0	Lipoprotein-releasing system ATP-binding protein LolD	1.15e-05	NA	3.38e-07	0.7913
3. BF	Q2YRG7	Macrolide export ATP-binding/permease protein MacB	3.83e-02	NA	4.79e-07	0.3706
3. BF	P0C2H3	Macrolide export ATP-binding/permease protein MacB 2	2.68e-02	NA	1.86e-09	0.3673
3. BF	Q3SI20	Lipoprotein-releasing system ATP-binding protein LolD	8.88e-05	NA	5.13e-09	0.8345
3. BF	Q5HEQ8	Putative multidrug export ATP-binding/permease protein SACOL1924	1.08e-05	NA	2.24e-07	0.2177
3. BF	Q5H0G3	Lipoprotein-releasing system ATP-binding protein LolD	2.65e-05	NA	1.04e-12	0.789
3. BF	Q8TQ05	Putative ABC transporter ATP-binding protein MA_1747	1.10e-04	NA	2.72e-09	0.2615
3. BF	Q7W8T0	Lipoprotein-releasing system ATP-binding protein LolD	2.06e-04	NA	4.71e-11	0.8123
3. BF	Q7VNG4	Spermidine/putrescine import ATP-binding protein PotA	4.99e-05	NA	4.42e-16	0.5585
3. BF	Q03I83	Energy-coupling factor transporter ATP-binding protein EcfA2	2.12e-07	NA	3.83e-08	0.7299
3. BF	Q7A848	Phosphonates import ATP-binding protein PhnC	4.12e-06	NA	4.20e-09	0.8053
3. BF	Q3Z5F8	Methionine import ATP-binding protein MetN	8.89e-06	NA	5.97e-20	0.6617
3. BF	Q6XYZ3	Energy-coupling factor transporter ATP-binding protein EcfA2	3.88e-04	NA	2.01e-09	0.6621
3. BF	Q63SP4	Lipoprotein-releasing system ATP-binding protein LolD	2.25e-05	NA	1.31e-12	0.75
3. BF	Q2K284	Methionine import ATP-binding protein MetN	4.88e-05	NA	9.56e-16	0.635
3. BF	Q4ZV73	Lipoprotein-releasing system ATP-binding protein LolD	3.13e-03	NA	2.96e-12	0.8222
3. BF	Q832R5	Putative ABC transporter ATP-binding protein EF_2153	8.57e-05	NA	1.83e-09	0.2583
3. BF	Q1QYT1	Arabinose import ATP-binding protein AraG	1.08e-04	NA	4.32e-04	0.2849
3. BF	Q5WVL8	Methionine import ATP-binding protein MetN	7.34e-05	NA	6.77e-16	0.6557
3. BF	Q7WK40	Lipoprotein-releasing system ATP-binding protein LolD	2.11e-04	NA	4.71e-11	0.8113
3. BF	Q2SJK0	Lipoprotein-releasing system ATP-binding protein LolD	2.37e-03	NA	6.94e-08	0.8014
3. BF	Q4QKQ9	Lipoprotein-releasing system ATP-binding protein LolD	1.63e-05	NA	1.22e-10	0.8657
3. BF	Q99S47	Energy-coupling factor transporter ATP-binding protein EcfA1	1.16e-04	NA	1.14e-11	0.7839
3. BF	Q8NVB5	Energy-coupling factor transporter ATP-binding protein EcfA1	1.46e-04	NA	2.47e-11	0.7996
3. BF	Q11JI6	Lipoprotein-releasing system ATP-binding protein LolD	2.57e-03	NA	1.34e-04	0.8197
3. BF	P9WQI4	Uncharacterized ABC transporter ATP-binding protein MT2640	4.15e-04	NA	3.78e-06	0.5778
3. BF	Q7CMM8	Energy-coupling factor transporter ATP-binding protein EcfA2	2.48e-05	NA	6.15e-10	0.7368
3. BF	Q7W9N7	ATP-dependent lipid A-core flippase	1.91e-04	NA	3.47e-07	0.2317
3. BF	Q04HV8	Energy-coupling factor transporter ATP-binding protein EcfA2	3.67e-05	NA	3.52e-09	0.717
3. BF	Q7CHI2	Macrolide export ATP-binding/permease protein MacB 1	2.11e-02	NA	5.22e-09	0.3599
3. BF	Q0K998	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.23e-04	NA	1.64e-11	0.5643
3. BF	Q97UY8	Glucose import ATP-binding protein GlcV	2.50e-04	NA	5.19e-16	0.5956
3. BF	Q1GBI9	Energy-coupling factor transporter ATP-binding protein EcfA2	9.46e-05	NA	1.48e-07	0.7024
3. BF	Q6MSQ1	Energy-coupling factor transporter ATP-binding protein EcfA1	1.96e-06	NA	7.90e-07	0.3998
3. BF	Q6F1W4	Energy-coupling factor transporter ATP-binding protein EcfA2	2.13e-04	NA	1.80e-11	0.6836
3. BF	Q87FK7	Arabinose import ATP-binding protein AraG	4.38e-04	NA	0.017	0.2773
3. BF	Q5E715	Methionine import ATP-binding protein MetN	1.31e-05	NA	6.27e-17	0.646
3. BF	P0AAH7	Peptide transport system ATP-binding protein SapD	1.99e-07	NA	2.05e-22	0.7211
3. BF	Q62K91	Ribose import ATP-binding protein RbsA	5.30e-05	NA	0.007	0.2922
3. BF	Q5HIL5	Methionine import ATP-binding protein MetN 1	1.11e-05	NA	1.42e-21	0.641
3. BF	A1U0A9	Macrolide export ATP-binding/permease protein MacB	1.53e-02	NA	1.30e-09	0.3695
3. BF	Q79EE4	Osmoprotective compounds uptake ATP-binding protein GgtA	5.59e-05	NA	1.91e-13	0.5803
3. BF	Q724C0	Methionine import ATP-binding protein MetN 1	1.64e-05	NA	9.80e-17	0.67
3. BF	Q8R7Y4	Energy-coupling factor transporter ATP-binding protein EcfA1	4.04e-05	NA	6.68e-12	0.7239
3. BF	A3CVD3	Energy-coupling factor transporter ATP-binding protein EcfA	1.25e-04	NA	7.75e-12	0.7301
3. BF	Q2YNH6	Lipoprotein-releasing system ATP-binding protein LolD	4.22e-05	NA	1.43e-06	0.7946
3. BF	Q88PM5	Phosphonates import ATP-binding protein PhnC	1.51e-05	NA	3.07e-08	0.7413
3. BF	Q2A3Z2	Methionine import ATP-binding protein MetN	1.41e-05	NA	1.07e-23	0.6248
3. BF	Q8UKE4	Macrolide export ATP-binding/permease protein MacB	5.17e-02	NA	3.34e-08	0.3686
3. BF	Q7A470	Energy-coupling factor transporter ATP-binding protein EcfA1	1.16e-04	NA	1.14e-11	0.7847
3. BF	Q1BR30	Methionine import ATP-binding protein MetN 2	3.59e-05	NA	2.45e-22	0.5958
3. BF	Q2W450	Lipoprotein-releasing system ATP-binding protein LolD	3.80e-05	NA	5.60e-05	0.7832
3. BF	Q0TMS8	Energy-coupling factor transporter ATP-binding protein EcfA2	3.77e-04	NA	7.36e-12	0.6938
3. BF	Q2FII2	Methionine import ATP-binding protein MetN 2	6.67e-05	NA	7.68e-20	0.6518
3. BF	P61482	Lipoprotein-releasing system ATP-binding protein LolD	8.48e-06	NA	3.40e-11	0.832
3. BF	Q93DA2	Methionine import ATP-binding protein MetN	4.36e-05	NA	3.37e-19	0.6628
3. BF	P0A4W3	Sulfate/thiosulfate import ATP-binding protein CysA	2.14e-04	NA	1.70e-19	0.6104
3. BF	Q1LLP5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.57e-05	NA	6.52e-11	0.564
3. BF	P61481	Lipoprotein-releasing system ATP-binding protein LolD	8.49e-06	NA	3.40e-11	0.8329
3. BF	Q1CG91	Methionine import ATP-binding protein MetN 1	1.92e-05	NA	1.35e-21	0.6694
3. BF	Q28QL7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.55e-04	NA	2.32e-15	0.5978
3. BF	Q46717	Alpha-hemolysin translocation ATP-binding protein HlyB	7.21e-04	NA	4.04e-08	0.2286
3. BF	Q5WKL3	Methionine import ATP-binding protein MetN 1	4.21e-05	NA	4.68e-23	0.6487
3. BF	Q8PGE8	Methionine import ATP-binding protein MetN	3.18e-05	NA	6.93e-25	0.6447
3. BF	Q6GJL2	Methionine import ATP-binding protein MetN 1	2.72e-05	NA	1.93e-21	0.6335
3. BF	Q160M2	Spermidine/putrescine import ATP-binding protein PotA	7.28e-04	NA	2.92e-16	0.5705
3. BF	Q134N9	Methionine import ATP-binding protein MetN	5.46e-05	NA	4.48e-24	0.6129
3. BF	Q217L2	Macrolide export ATP-binding/permease protein MacB	1.09e-01	NA	4.06e-07	0.3715
3. BF	Q8KF76	Lipoprotein-releasing system ATP-binding protein LolD 1	1.13e-05	NA	1.03e-09	0.8294
3. BF	Q5FKL2	Methionine import ATP-binding protein MetN	8.14e-05	NA	3.97e-19	0.6477
3. BF	Q8ZGA9	ATP-dependent lipid A-core flippase	3.74e-04	NA	1.82e-07	0.2498
3. BF	P0A9S8	High-affinity branched-chain amino acid transport ATP-binding protein LivG	5.04e-05	NA	2.13e-08	0.7963
3. BF	Q8YCB1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.02e-04	NA	3.48e-13	0.5852
3. BF	Q5WDP1	Methionine import ATP-binding protein MetN 3	3.00e-05	NA	3.53e-16	0.6837
3. BF	Q5LXJ4	Energy-coupling factor transporter ATP-binding protein EcfA2	2.22e-07	NA	3.83e-08	0.7285
3. BF	Q8ZH38	Methionine import ATP-binding protein MetN 1	9.34e-06	NA	5.59e-20	0.6685
3. BF	Q0BGD7	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	4.31e-04	NA	0.014	0.2854
3. BF	Q1JJD0	Energy-coupling factor transporter ATP-binding protein EcfA2	3.54e-05	NA	6.15e-10	0.7201
3. BF	Q82CM5	Ribose import ATP-binding protein RbsA 1	3.96e-03	NA	0.012	0.2928
3. BF	Q1GTY0	Lipoprotein-releasing system ATP-binding protein LolD	3.43e-05	NA	6.66e-05	0.8387
3. BF	Q3JYF5	Energy-coupling factor transporter ATP-binding protein EcfA2	4.00e-05	NA	2.18e-09	0.7321
3. BF	Q97Q42	Spermidine/putrescine import ATP-binding protein PotA	1.68e-04	NA	4.62e-16	0.554
3. BF	Q032A0	Methionine import ATP-binding protein MetN	7.06e-05	NA	1.32e-16	0.5979
3. BF	P42064	Oligopeptide transport ATP-binding protein AppD	5.82e-07	NA	1.90e-33	0.7174
3. BF	Q8P2K6	Methionine import ATP-binding protein MetN	3.93e-05	NA	2.22e-18	0.6473
3. BF	Q215F6	Lipoprotein-releasing system ATP-binding protein LolD 1	1.33e-05	NA	5.47e-07	0.7829
3. BF	D8KFN1	Methionine import ATP-binding protein MetN	7.67e-05	NA	1.63e-16	0.5964
3. BF	Q8TIX0	Putative ABC transporter ATP-binding protein MA_4020	9.70e-05	NA	1.61e-12	0.6914
3. BF	O34697	Bacitracin export ATP-binding protein BceA	7.27e-05	NA	1.25e-09	0.7922
3. BF	P0CZ31	Methionine import ATP-binding protein MetN	3.88e-05	NA	1.99e-18	0.657
3. BF	A0B344	Methionine import ATP-binding protein MetN 2	3.55e-05	NA	2.45e-22	0.5971
3. BF	A0ALT6	Energy-coupling factor transporter ATP-binding protein EcfA2	9.66e-05	NA	5.54e-15	0.7182
3. BF	Q97EK9	Energy-coupling factor transporter ATP-binding protein EcfA2	3.43e-04	NA	1.02e-11	0.7094
3. BF	Q3Z3Q4	Macrolide export ATP-binding/permease protein MacB	9.97e-03	NA	6.95e-08	0.3648
3. BF	Q04F14	Methionine import ATP-binding protein MetN 1	2.33e-05	NA	9.53e-18	0.6265
3. BF	P0CZ35	Spermidine/putrescine import ATP-binding protein PotA	2.14e-04	NA	2.38e-16	0.558
3. BF	P45051	Oligopeptide transport ATP-binding protein OppF	3.63e-10	NA	3.10e-58	0.8082
3. BF	Q9L1C3	Methionine import ATP-binding protein MetN	2.79e-04	NA	4.78e-18	0.6113
3. BF	Q21TG3	Lipoprotein-releasing system ATP-binding protein LolD	1.03e-05	NA	3.71e-12	0.8148
3. BF	Q63H29	Methionine import ATP-binding protein MetN 1	1.04e-05	NA	1.27e-18	0.6387
3. BF	Q668L6	Macrolide export ATP-binding/permease protein MacB 2	7.03e-02	NA	1.92e-10	0.3355
3. BF	Q8GNH6	Nod factor export ATP-binding protein I	1.17e-03	NA	4.51e-04	0.6079
3. BF	Q1DDP4	Methionine import ATP-binding protein MetN	1.54e-04	NA	4.80e-18	0.6503
3. BF	Q7WFU9	Methionine import ATP-binding protein MetN	4.42e-05	NA	1.91e-24	0.6405
3. BF	P63356	Methionine import ATP-binding protein MetN	8.86e-06	NA	5.97e-20	0.6698
3. BF	Q1AXG5	Ribose import ATP-binding protein RbsA 1	1.22e-04	NA	0.005	0.2947
3. BF	Q5HHK4	Methionine import ATP-binding protein MetN 2	6.17e-05	NA	7.68e-20	0.6473
3. BF	Q66CI3	ATP-dependent lipid A-core flippase	4.30e-04	NA	1.82e-07	0.2574
3. BF	Q2JLH7	Phosphonates import ATP-binding protein PhnC 2	6.21e-06	NA	3.82e-16	0.7859
3. BF	Q5YTW4	Phosphonates import ATP-binding protein PhnC	4.00e-05	NA	2.34e-09	0.7384
3. BF	A4TQL5	Autoinducer 2 import ATP-binding protein LsrA	9.68e-05	NA	6.26e-07	0.2777
3. BF	Q8E3S0	Methionine import ATP-binding protein MetN	3.21e-05	NA	2.79e-18	0.675
3. BF	P40735	Energy-coupling factor transporter ATP-binding protein EcfA1	1.35e-04	NA	3.31e-08	0.7336
3. BF	Q4L4R9	Methionine import ATP-binding protein MetN	1.31e-05	NA	2.23e-20	0.663
3. BF	Q8E2L3	Energy-coupling factor transporter ATP-binding protein EcfA2	4.04e-05	NA	2.18e-09	0.7348
3. BF	Q9I6T2	Spermidine/putrescine import ATP-binding protein PotA 1	4.76e-04	NA	8.00e-15	0.579
3. BF	P0C2H2	Macrolide export ATP-binding/permease protein MacB	3.74e-02	NA	1.86e-09	0.3675
3. BF	A0RP01	Macrolide export ATP-binding/permease protein MacB	7.10e-02	NA	4.30e-08	0.367
3. BF	Q8ES39	Putative ABC transporter ATP-binding protein OB0804	1.45e-04	NA	1.52e-10	0.2883
3. BF	Q97N51	Energy-coupling factor transporter ATP-binding protein EcfA2	3.60e-05	NA	3.65e-09	0.7176
3. BF	Q3JZP8	Methionine import ATP-binding protein MetN	3.01e-05	NA	2.97e-18	0.6558
3. BF	P63299	Galactofuranose transporter ATP-binding protein YtfR	4.13e-04	NA	7.66e-04	0.2931
3. BF	Q1D382	Lipoprotein-releasing system ATP-binding protein LolD	3.55e-05	NA	1.07e-09	0.8521
3. BF	Q8YBN5	Putative peptide import ATP-binding protein BMEII0864	5.56e-10	NA	1.59e-51	0.8509
3. BF	P45052	Oligopeptide transport ATP-binding protein OppD	7.33e-08	NA	5.44e-35	0.7546
3. BF	Q4L9P7	Phosphonates import ATP-binding protein PhnC	3.61e-06	NA	3.07e-09	0.8001
3. BF	Q7VYN2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.60e-05	NA	3.01e-12	0.5714
3. BF	A6QJK1	Putative hemin import ATP-binding protein HrtA	1.44e-05	NA	3.97e-12	0.8198
3. BF	Q12C33	ATP-dependent lipid A-core flippase	1.07e-04	NA	2.09e-05	0.266
3. BF	Q62GB4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	4.05e-04	NA	1.76e-11	0.5681
3. BF	Q577J4	Putative peptide import ATP-binding protein BruAb2_0797	2.71e-10	NA	1.59e-51	0.8491
3. BF	A0QQ70	Phosphate-import ATP-binding protein PhnC	1.15e-04	NA	1.07e-07	0.7724
3. BF	Q8NSN2	Methionine import ATP-binding protein MetN	1.72e-05	NA	1.62e-20	0.6266
3. BF	Q8YGM0	Lipoprotein-releasing system ATP-binding protein LolD	3.46e-05	NA	1.43e-06	0.8115
3. BF	Q3A558	Lipoprotein-releasing system ATP-binding protein LolD	1.37e-05	NA	1.19e-10	0.8269
3. BF	Q6G1V5	Macrolide export ATP-binding/permease protein MacB	3.56e-02	NA	6.38e-08	0.3672
3. BF	Q32DZ9	Macrolide export ATP-binding/permease protein MacB	2.95e-02	NA	7.46e-08	0.3619
3. BF	Q4KKK8	Methionine import ATP-binding protein MetN 1	2.29e-05	NA	6.54e-26	0.6659
3. BF	Q0BN75	Lipoprotein-releasing system ATP-binding protein LolD	1.01e-05	NA	3.68e-12	0.8216
3. BF	Q2FRT7	Energy-coupling factor transporter ATP-binding protein EcfA2	1.18e-04	NA	1.37e-08	0.5227
3. BF	Q47RE8	Methionine import ATP-binding protein MetN	2.63e-04	NA	2.59e-21	0.6647
3. BF	Q9A9P4	Lipoprotein-releasing system ATP-binding protein LolD 1	2.40e-03	NA	1.04e-07	0.7982
3. BF	Q31FG2	ATP-dependent lipid A-core flippase	1.03e-04	NA	3.35e-06	0.2399
3. BF	Q5M244	Energy-coupling factor transporter ATP-binding protein EcfA2	2.91e-05	NA	3.83e-08	0.7293
3. BF	Q6N5P8	Lipoprotein-releasing system ATP-binding protein LolD 2	1.02e-05	NA	1.51e-06	0.7775
3. BF	Q0TJH0	Macrolide export ATP-binding/permease protein MacB	1.07e-02	NA	6.32e-08	0.365
3. BF	A5VU86	Putative peptide import ATP-binding protein BOV_A0347	2.55e-10	NA	1.59e-51	0.851
3. BF	Q3A9G5	Methionine import ATP-binding protein MetN	1.01e-05	NA	4.12e-24	0.6417
3. BF	P0AAG2	Dipeptide transport ATP-binding protein DppD	2.14e-07	NA	2.63e-30	0.6854
3. BF	Q81VQ2	Energy-coupling factor transporter ATP-binding protein EcfA1	3.59e-04	NA	6.56e-10	0.7049
3. BF	Q8UBN2	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.44e-04	NA	3.05e-04	0.2888
3. BF	Q6MPX9	Macrolide export ATP-binding/permease protein MacB	2.54e-02	NA	1.04e-07	0.3378
3. BF	Q9KTJ5	Methionine import ATP-binding protein MetN	1.36e-05	NA	4.00e-18	0.6338
3. BF	Q55108	Bicarbonate transport ATP-binding protein CmpD	2.34e-04	NA	2.78e-10	0.7192
3. BF	Q1C970	Methionine import ATP-binding protein MetN 2	2.89e-05	NA	1.35e-21	0.6714
3. BF	Q3JKX3	Taurine import ATP-binding protein TauB	8.80e-05	NA	8.06e-07	0.7255
3. BF	P44531	Fe(3+) ions import ATP-binding protein FbpC 1	2.90e-05	NA	2.00e-13	0.6431
3. BF	Q07733	Oligopeptide transport ATP-binding protein OppD	1.22e-06	NA	9.14e-33	0.7493
3. BF	Q1CI46	Lipoprotein-releasing system ATP-binding protein LolD	1.57e-05	NA	5.59e-10	0.8122
3. BF	A9R074	Autoinducer 2 import ATP-binding protein LsrA	6.59e-05	NA	6.26e-07	0.2701
3. BF	Q5KYQ7	Putative ribose/galactose/methyl galactoside import ATP-binding protein	8.37e-05	NA	0.002	0.2907
3. BF	Q8X8E3	Lipoprotein-releasing system ATP-binding protein LolD	1.28e-05	NA	1.20e-10	0.83
3. BF	Q6LPK2	Lipoprotein-releasing system ATP-binding protein LolD	1.17e-05	NA	1.30e-10	0.84
3. BF	Q6G6W1	Putative hemin import ATP-binding protein HrtA	1.60e-05	NA	3.97e-12	0.8157
3. BF	O31711	Uncharacterized ABC transporter ATP-binding protein YknY	1.85e-05	NA	1.82e-12	0.7973
3. BF	Q2FED7	Putative hemin import ATP-binding protein HrtA	1.55e-05	NA	3.97e-12	0.7905
3. BF	Q7VR44	ATP-dependent lipid A-core flippase	2.56e-04	NA	1.01e-05	0.2528
3. BF	Q04BY6	Energy-coupling factor transporter ATP-binding protein EcfA2	2.39e-04	NA	1.48e-07	0.7026
3. BF	Q5HM27	Energy-coupling factor transporter ATP-binding protein EcfA1	1.45e-04	NA	7.25e-10	0.7762
3. BF	Q2K9R2	Lipoprotein-releasing system ATP-binding protein LolD	4.48e-05	NA	1.69e-06	0.8234
3. BF	Q0T5R2	Spermidine/putrescine import ATP-binding protein PotA	2.94e-04	NA	2.96e-16	0.5523
3. BF	Q83KP2	Arabinose import ATP-binding protein AraG	2.39e-04	NA	0.004	0.2692
3. BF	Q5KVK2	Methionine import ATP-binding protein MetN	5.91e-05	NA	2.21e-21	0.672
3. BF	Q0BSM2	Lipoprotein-releasing system ATP-binding protein LolD	3.13e-05	NA	2.03e-04	0.7921
3. BF	Q0I5E9	Methionine import ATP-binding protein MetN	9.91e-06	NA	1.37e-17	0.6671
3. BF	Q492R2	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	1.80e-12	0.8395
3. BF	Q4UV71	Lipoprotein-releasing system ATP-binding protein LolD	2.41e-05	NA	2.86e-13	0.7801
3. BF	P9WQI2	Trehalose import ATP-binding protein SugC	7.34e-04	NA	4.84e-15	0.5321
3. BF	Q884I3	Lipoprotein-releasing system ATP-binding protein LolD	2.99e-03	NA	1.53e-12	0.8219
3. BF	P0A2U9	Oligopeptide transport ATP-binding protein AmiE	2.72e-06	NA	1.40e-29	0.7291
3. BF	Q1GAN9	Methionine import ATP-binding protein MetN	5.73e-07	NA	7.07e-16	0.6452
3. BF	Q8CUY0	Phosphonates import ATP-binding protein PhnC 2	6.39e-06	NA	2.57e-14	0.8249
3. BF	Q8ELQ6	Methionine import ATP-binding protein MetN 3	1.51e-05	NA	5.56e-19	0.6531
3. BF	Q32EX7	Lipoprotein-releasing system ATP-binding protein LolD	7.88e-06	NA	7.69e-11	0.8133
3. BF	Q3B5J7	Macrolide export ATP-binding/permease protein MacB	3.57e-02	NA	1.83e-07	0.3416
3. BF	Q1C5W7	Macrolide export ATP-binding/permease protein MacB 2	1.08e-01	NA	2.04e-10	0.346
3. BF	Q63S19	Methionine import ATP-binding protein MetN 1	1.25e-05	NA	3.67e-21	0.6678
3. BF	Q8ETV6	Energy-coupling factor transporter ATP-binding protein EcfA2	4.52e-05	NA	5.14e-12	0.7314
3. BF	Q827Y0	Methionine import ATP-binding protein MetN	2.73e-04	NA	3.49e-18	0.6088
3. BF	P08007	Oligopeptide transport ATP-binding protein OppF	6.44e-10	NA	4.48e-58	0.778
3. BF	Q98GF5	Phosphonates import ATP-binding protein PhnC	1.04e-04	NA	3.94e-10	0.6903
3. BF	B2K3G1	Autoinducer 2 import ATP-binding protein LsrA	8.56e-05	NA	5.04e-07	0.2524
3. BF	Q2IWV8	Lipoprotein-releasing system ATP-binding protein LolD	1.11e-05	NA	1.59e-05	0.7868
3. BF	Q71WH8	Energy-coupling factor transporter ATP-binding protein EcfA2	1.14e-04	NA	8.50e-15	0.7169
3. BF	P44407	ATP-dependent lipid A-core flippase	6.52e-05	NA	6.26e-07	0.2238
3. BF	Q2YZ26	Putative hemin import ATP-binding protein HrtA	1.58e-05	NA	3.61e-12	0.7911
3. BF	Q4FTM3	Lipoprotein-releasing system ATP-binding protein LolD	1.39e-05	NA	7.25e-13	0.848
3. BF	Q13VD7	Methionine import ATP-binding protein MetN 1	1.13e-05	NA	6.27e-22	0.6544
3. BF	A0B1M7	Ribose import ATP-binding protein RbsA 2	5.04e-05	NA	0.004	0.2768
3. BF	Q7VL52	ATP-dependent lipid A-core flippase	4.71e-06	NA	2.74e-08	0.2272
3. BF	O54187	Putative ABC transporter ATP-binding protein SCO5958	3.33e-04	NA	0.005	0.7093
3. BF	P63402	Uncharacterized ABC transporter ATP-binding protein Mb2593	4.18e-04	NA	3.78e-06	0.5751
3. BF	Q48QM3	Energy-coupling factor transporter ATP-binding protein EcfA2	3.45e-05	NA	5.11e-10	0.75
3. BF	Q47C66	Lipoprotein-releasing system ATP-binding protein LolD	4.11e-05	NA	1.05e-08	0.8368
3. BF	Q03PY6	Energy-coupling factor transporter ATP-binding protein EcfA2	1.29e-06	NA	3.78e-15	0.7063
3. BF	Q83RS0	Lipoprotein-releasing system ATP-binding protein LolD	7.72e-06	NA	2.79e-11	0.811
3. BF	Q8P2L5	Oligopeptide transport ATP-binding protein OppF	0.00e+00	NA	4.99e-90	0.9327
3. BF	Q21XK2	Methionine import ATP-binding protein MetN	2.74e-05	NA	8.72e-23	0.6482
3. BF	Q2SVU4	Ribose import ATP-binding protein RbsA 1	1.00e-04	NA	0.026	0.3833
3. BF	Q04B25	Methionine import ATP-binding protein MetN	2.73e-06	NA	6.87e-16	0.6461
3. BF	Q31ZH4	Lipoprotein-releasing system ATP-binding protein LolD	8.06e-06	NA	2.64e-11	0.8093
3. BF	Q579H8	Methionine import ATP-binding protein MetN	2.12e-05	NA	4.43e-19	0.6334
3. BF	Q9CL63	Ribose import ATP-binding protein RbsA 2	5.24e-05	NA	0.005	0.3859
3. BF	Q88RL5	Methionine import ATP-binding protein MetN 1	2.29e-05	NA	9.29e-26	0.6465
3. BF	Q8K985	Multidrug resistance-like ATP-binding protein MdlA	7.62e-05	NA	2.75e-06	0.2265
3. BF	Q5QU36	ATP-dependent lipid A-core flippase	8.28e-05	NA	1.63e-08	0.2737
3. BF	Q9A1E3	Methionine import ATP-binding protein MetN	3.90e-05	NA	2.22e-18	0.6623
3. BF	Q5M1F6	Methionine import ATP-binding protein MetN	3.60e-05	NA	9.44e-17	0.6605
3. BF	Q9CN78	Lipoprotein-releasing system ATP-binding protein LolD	1.60e-05	NA	8.08e-11	0.8745
3. BF	A0R8K8	Energy-coupling factor transporter ATP-binding protein EcfA1	3.57e-04	NA	6.56e-10	0.7043
3. BF	Q2RPB4	Macrolide export ATP-binding/permease protein MacB	1.37e-02	NA	1.26e-08	0.3621
3. BF	Q9HT70	Methionine import ATP-binding protein MetN 2	2.51e-05	NA	4.42e-24	0.6757
3. BF	Q8FWP1	Putative peptide import ATP-binding protein BRA0405/BS1330_II0402	7.11e-08	NA	4.89e-29	0.6931
3. BF	Q04FM1	Energy-coupling factor transporter ATP-binding protein EcfA2	5.30e-07	NA	2.52e-12	0.7441
3. BF	P9WQL8	Doxorubicin resistance ATP-binding protein DrrA	7.43e-04	NA	3.27e-04	0.5781
3. BF	Q8KFE9	Macrolide export ATP-binding/permease protein MacB	7.52e-02	NA	1.92e-09	0.339
3. BF	Q83LR7	Macrolide export ATP-binding/permease protein MacB	1.48e-02	NA	7.45e-08	0.3476
3. BF	Q14H97	Methionine import ATP-binding protein MetN	8.21e-05	NA	6.47e-23	0.6213
3. BF	Q8PYH5	Putative ABC transporter ATP-binding protein MM_0887	1.46e-04	NA	6.72e-14	0.6713
3. BF	O32169	Methionine import ATP-binding protein MetN	2.32e-05	NA	1.77e-21	0.657
3. BF	O31707	Uncharacterized ABC transporter ATP-binding protein YknU	9.93e-05	NA	1.27e-05	0.2657
3. BF	Q04CG8	Phosphonates import ATP-binding protein PhnC	6.53e-06	NA	1.30e-11	0.7972
3. BF	Q2YK62	Putative peptide import ATP-binding protein BAB2_0818	2.63e-10	NA	1.59e-51	0.8504
3. BF	Q99VG8	Methionine import ATP-binding protein MetN 2	6.25e-05	NA	7.19e-20	0.6518
3. BF	Q18CI9	Energy-coupling factor transporter ATP-binding protein EcfA2	4.33e-03	NA	1.59e-09	0.6989
3. BF	Q8Z990	Methionine import ATP-binding protein MetN 1	9.39e-06	NA	4.31e-20	0.6736
3. BF	P0A2V6	Oligopeptide transport ATP-binding protein OppF	0.00e+00	NA	3.57e-89	0.9331
3. BF	Q0TFU2	Galactose/methyl galactoside import ATP-binding protein MglA	3.23e-04	NA	1.45e-04	0.2853
3. BF	Q98KS7	Lipoprotein-releasing system ATP-binding protein LolD	3.31e-05	NA	1.06e-05	0.8122
3. BF	Q99T13	Putative multidrug export ATP-binding/permease protein SAV1866	7.99e-06	NA	2.24e-07	0.2177
3. BF	Q9K0N7	Macrolide export ATP-binding/permease protein MacB	5.82e-02	NA	1.16e-07	0.3845
3. BF	Q2SY12	Methionine import ATP-binding protein MetN	2.09e-05	NA	1.89e-21	0.6656
3. BF	Q82VL9	Lipoprotein-releasing system ATP-binding protein LolD	1.66e-05	NA	1.88e-09	0.8497
3. BF	Q97KS6	Spermidine/putrescine import ATP-binding protein PotA	1.23e-04	NA	1.38e-14	0.5959
3. BF	Q4KFA2	Lipoprotein-releasing system ATP-binding protein LolD	3.15e-05	NA	8.51e-12	0.832
3. BF	A0KGB3	Macrolide export ATP-binding/permease protein MacB 1	3.65e-02	NA	3.75e-09	0.3758
3. BF	Q3SRG8	Lipoprotein-releasing system ATP-binding protein LolD	1.36e-05	NA	1.90e-07	0.7816
3. BF	Q8YA75	Methionine import ATP-binding protein MetN 1	1.19e-05	NA	8.85e-17	0.6708
3. BF	Q577J5	Putative peptide import ATP-binding protein BruAb2_0796	8.24e-08	NA	8.82e-30	0.6965
3. BF	Q5XDU4	Oligopeptide transport ATP-binding protein OppF	1.11e-16	NA	3.57e-89	0.9337
3. BF	O83590	Lipoprotein-releasing system ATP-binding protein LolD	4.57e-05	NA	3.29e-07	0.85
3. BF	Q4QPI4	ATP-dependent lipid A-core flippase	1.82e-04	NA	4.87e-07	0.2565
3. BF	Q1JBV6	Spermidine/putrescine import ATP-binding protein PotA	6.02e-04	NA	1.64e-16	0.5486
3. BF	P0CZ26	Energy-coupling factor transporter ATP-binding protein EcfA2	2.37e-07	NA	8.88e-10	0.7556
3. BF	P39459	Nitrate transport protein NasD	5.81e-05	NA	6.95e-15	0.7721
3. BF	Q39T41	Lipoprotein-releasing system ATP-binding protein LolD	2.86e-05	NA	1.74e-10	0.8687
3. BF	O34314	Uncharacterized ABC transporter ATP-binding protein YtlC	4.03e-05	NA	3.54e-10	0.7671
3. BF	Q8P8V9	Lipoprotein-releasing system ATP-binding protein LolD	2.42e-05	NA	2.86e-13	0.7807
3. BF	Q399M3	Macrolide export ATP-binding/permease protein MacB	9.05e-03	NA	7.52e-07	0.3334
3. BF	Q49ZE0	Energy-coupling factor transporter ATP-binding protein EcfA1	5.27e-05	NA	4.89e-09	0.7674
3. BF	Q3BTD3	Lipoprotein-releasing system ATP-binding protein LolD	1.90e-05	NA	4.43e-12	0.8043
3. BF	Q89NX6	Macrolide export ATP-binding/permease protein MacB	4.05e-02	NA	9.93e-07	0.368
3. BF	Q8DY54	Methionine import ATP-binding protein MetN	3.14e-05	NA	2.97e-18	0.6553
3. BF	Q7A6M2	Methionine import ATP-binding protein MetN 2	5.00e-05	NA	7.19e-20	0.647
3. BF	Q24XJ2	Spermidine/putrescine import ATP-binding protein PotA	7.85e-05	NA	4.57e-13	0.608
3. BF	Q5HC57	Lipoprotein-releasing system ATP-binding protein LolD	1.78e-03	NA	1.05e-07	0.8205
3. BF	Q8YUV1	Phosphonates import ATP-binding protein PhnC 1	1.23e-06	NA	2.95e-12	0.7666
3. BF	P0A9U0	Uncharacterized ABC transporter ATP-binding protein YbbA	2.57e-03	NA	9.59e-09	0.8459
3. BF	Q81ZF5	Methionine import ATP-binding protein MetN 2	8.99e-05	NA	8.22e-22	0.6836
3. BF	Q660M8	Spermidine/putrescine import ATP-binding protein PotA	1.13e-04	NA	4.15e-20	0.6063
3. BF	P0AAI0	Peptide transport system ATP-binding protein SapF	1.50e-06	NA	2.98e-33	0.8278
3. BF	Q046T0	Phosphonates import ATP-binding protein PhnC	5.31e-06	NA	1.04e-09	0.7897
3. BF	Q9Z3I3	Nod factor export ATP-binding protein I	6.03e-04	NA	0.011	0.6571
3. BF	Q110U3	Spermidine/putrescine import ATP-binding protein PotA	1.92e-04	NA	5.75e-19	0.5495
3. BF	Q831K6	Methionine import ATP-binding protein MetN 2	1.68e-05	NA	6.87e-18	0.6703
3. BF	Q8E554	Spermidine/putrescine import ATP-binding protein PotA	1.85e-04	NA	1.75e-16	0.5554
3. BF	Q3JSI8	Ribose import ATP-binding protein RbsA 1	7.52e-04	NA	0.006	0.3593
3. BF	Q60AI1	Spermidine/putrescine import ATP-binding protein PotA	5.10e-04	NA	1.13e-13	0.5518
3. BF	Q73F67	Energy-coupling factor transporter ATP-binding protein EcfA1	3.63e-04	NA	1.05e-09	0.7039
3. BF	Q4ZZK0	Methionine import ATP-binding protein MetN 2	6.84e-05	NA	7.08e-21	0.5905
3. BF	P50980	Oligopeptide transport ATP-binding protein OppD	1.19e-06	NA	6.37e-33	0.7711
3. BF	Q8D2U8	ATP-dependent lipid A-core flippase	2.23e-04	NA	3.71e-08	0.2214
3. BF	P0CZ33	Oligopeptide transport ATP-binding protein OppF	0.00e+00	NA	3.57e-89	0.9338
3. BF	Q9JW59	ATP-dependent lipid A-core flippase	9.45e-05	NA	1.38e-04	0.2315
3. BF	P0AAG1	Dipeptide transport ATP-binding protein DppD	2.00e-07	NA	2.63e-30	0.6657
3. BF	Q832Y6	Methionine import ATP-binding protein MetN 1	1.21e-05	NA	1.15e-20	0.6149
3. BF	Q6GB18	Methionine import ATP-binding protein MetN 2	1.72e-05	NA	7.68e-20	0.653
3. BF	Q8FRX8	Methionine import ATP-binding protein MetN	2.15e-05	NA	1.01e-19	0.6141
3. BF	Q1J983	Energy-coupling factor transporter ATP-binding protein EcfA2	2.36e-07	NA	6.15e-10	0.7247
3. BF	Q74L61	Energy-coupling factor transporter ATP-binding protein EcfA2	1.59e-06	NA	2.38e-09	0.7466
3. BF	Q7VMF9	Macrolide export ATP-binding/permease protein MacB	4.28e-02	NA	1.01e-09	0.345
3. BF	Q72AQ6	Phosphonates import ATP-binding protein PhnC	7.80e-06	NA	9.48e-15	0.768
3. BF	Q2YWP2	Methionine import ATP-binding protein MetN 2	6.08e-05	NA	8.20e-20	0.6471
3. BF	Q9CGD4	Spermidine/putrescine import ATP-binding protein PotA	1.05e-03	NA	8.76e-14	0.4969
3. BF	Q2GHT4	Lipoprotein-releasing system ATP-binding protein LolD	9.65e-05	NA	2.55e-08	0.7993
3. BF	Q50316	Putative ABC transporter ATP-binding protein MG468.1 homolog	9.05e-03	NA	1.73e-09	0.6722
3. BF	Q21BU8	Methionine import ATP-binding protein MetN	2.40e-05	NA	4.96e-25	0.6507
3. BF	Q5E0B3	Lipoprotein-releasing system ATP-binding protein LolD	4.80e-05	NA	4.65e-12	0.8277
3. BF	Q1RD28	Spermidine/putrescine import ATP-binding protein PotA	6.12e-04	NA	4.74e-17	0.5542
3. BF	Q1QCN2	Lipoprotein-releasing system ATP-binding protein LolD	1.39e-05	NA	2.50e-12	0.8776
3. BF	Q97T09	Methionine import ATP-binding protein MetN	3.16e-05	NA	4.01e-19	0.6681
3. BF	Q62B84	Methionine import ATP-binding protein MetN 2	5.58e-05	NA	7.63e-21	0.5557
3. BF	Q4ZT65	Macrolide export ATP-binding/permease protein MacB 2	7.02e-02	NA	1.44e-09	0.3667
3. BF	Q6MIP7	Phosphonates import ATP-binding protein PhnC	8.65e-06	NA	2.84e-12	0.7674
3. BF	Q6FYL0	Macrolide export ATP-binding/permease protein MacB	8.13e-02	NA	5.01e-07	0.3693
3. BF	A0K5N5	Methionine import ATP-binding protein MetN 1	1.21e-05	NA	4.42e-21	0.6565
3. BF	Q8ZFR4	Lipoprotein-releasing system ATP-binding protein LolD	1.50e-05	NA	5.59e-10	0.8129
3. BF	P46903	ABC transporter ATP-binding protein NatA	1.97e-04	NA	1.20e-06	0.7651
3. BF	A2RI77	Dipeptide transport ATP-binding protein DppD	8.39e-08	NA	2.86e-34	0.7499
3. BF	Q63H62	Energy-coupling factor transporter ATP-binding protein EcfA1	3.33e-04	NA	1.60e-09	0.7125
3. BF	Q5HDJ6	Putative hemin import ATP-binding protein HrtA	1.49e-05	NA	3.97e-12	0.8148
3. BF	P71082	Putative multidrug export ATP-binding/permease protein YgaD	6.01e-06	NA	1.02e-08	0.2217
3. BF	Q31ZK0	Spermidine/putrescine import ATP-binding protein PotA	4.63e-05	NA	3.03e-17	0.5517
3. BF	Q04EY4	Energy-coupling factor transporter ATP-binding protein EcfA3	4.06e-06	NA	4.22e-12	0.7329
3. BF	Q1CFH7	Methionine import ATP-binding protein MetN 2	9.94e-06	NA	5.59e-20	0.6692
3. BF	Q87EF4	Lipoprotein-releasing system ATP-binding protein LolD	2.78e-05	NA	4.07e-10	0.7952
3. BF	Q04DA7	Methionine import ATP-binding protein MetN 2	1.53e-05	NA	5.63e-21	0.6412
3. BF	Q736E0	Aliphatic sulfonates import ATP-binding protein SsuB	3.42e-04	NA	7.86e-12	0.7587
3. BF	Q2Y624	Lipoprotein-releasing system ATP-binding protein LolD	3.22e-03	NA	3.87e-10	0.8297
3. BF	Q89A96	Multidrug resistance-like ATP-binding protein MdlB	6.45e-06	NA	2.12e-04	0.2397
3. BF	Q8PZN0	Putative ABC transporter ATP-binding protein MM_0462	1.14e-04	NA	1.05e-09	0.4993
3. BF	Q5L3R0	Energy-coupling factor transporter ATP-binding protein EcfA1	1.00e-04	NA	1.01e-09	0.7675
3. BF	Q3IL62	Lipoprotein-releasing system ATP-binding protein LolD	1.97e-05	NA	4.60e-12	0.8229
3. BF	Q9CK97	Methionine import ATP-binding protein MetN	7.34e-06	NA	3.42e-18	0.6539
3. BF	Q15TB1	Lipoprotein-releasing system ATP-binding protein LolD	2.63e-05	NA	4.95e-11	0.8513
3. BF	P0A2U8	Oligopeptide transport ATP-binding protein AmiE	2.55e-06	NA	1.40e-29	0.7283
3. BF	Q67JX4	Energy-coupling factor transporter ATP-binding protein EcfA2	2.01e-04	NA	7.75e-15	0.7074
3. BF	Q65TB7	Lipoprotein-releasing system ATP-binding protein LolD	1.15e-05	NA	4.66e-10	0.8744
3. BF	Q2KVS6	Macrolide export ATP-binding/permease protein MacB	3.29e-02	NA	5.02e-09	0.3517
3. BF	Q0T810	Methionine import ATP-binding protein MetN	1.03e-05	NA	4.96e-20	0.6613
3. BF	P72479	Oligopeptide transport ATP-binding protein OppF	7.40e-12	NA	6.45e-73	0.9177
3. BF	Q88XV2	Energy-coupling factor transporter ATP-binding protein EcfA1	1.20e-04	NA	1.12e-07	0.7586
3. BF	Q39HA1	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	5.13e-05	NA	1.37e-04	0.274
3. BF	Q6F1W5	Energy-coupling factor transporter ATP-binding protein EcfA1	1.42e-06	NA	3.93e-09	0.3981
3. BF	Q8TSC8	Putative ABC transporter ATP-binding protein MA_0870	4.63e-04	NA	8.77e-12	0.2297
3. BF	P40790	Spermidine/putrescine import ATP-binding protein PotA	5.42e-04	NA	2.14e-17	0.5545
3. BF	Q8XKQ2	Galactose/methyl galactoside import ATP-binding protein MglA	4.66e-05	NA	1.09e-05	0.2797
3. BF	Q4L8L7	Putative hemin import ATP-binding protein HrtA	7.76e-06	NA	1.75e-10	0.8223
3. BF	Q2KYS6	ATP-dependent lipid A-core flippase	6.87e-04	NA	2.58e-07	0.2395
3. BF	Q6D1C4	Methionine import ATP-binding protein MetN 3	8.69e-06	NA	1.62e-20	0.6704
3. BF	Q928L8	Methionine import ATP-binding protein MetN 2	1.76e-05	NA	1.11e-21	0.6591
3. BF	Q60AA3	ATP-dependent lipid A-core flippase	1.89e-04	NA	1.18e-05	0.2751
3. BF	Q5M5Z2	Methionine import ATP-binding protein MetN	3.74e-05	NA	9.27e-17	0.6627
3. BF	Q49ZT6	Putative hemin import ATP-binding protein HrtA	8.15e-06	NA	4.34e-10	0.8256
3. BF	A1K323	Macrolide export ATP-binding/permease protein MacB	8.60e-02	NA	8.75e-08	0.354
3. BF	P0CZ32	Oligopeptide transport ATP-binding protein OppF	1.11e-16	NA	3.57e-89	0.9332
3. BF	Q3JNJ9	Arabinose import ATP-binding protein AraG	4.27e-04	NA	0.014	0.2753
3. BF	P73265	Nitrate import ATP-binding protein NrtD	9.53e-05	NA	4.14e-10	0.7294
3. BF	Q6NJ07	Methionine import ATP-binding protein MetN	1.37e-05	NA	3.06e-21	0.6676
3. BF	O34979	Uncharacterized ABC transporter ATP-binding protein YvrO	5.24e-05	NA	4.40e-14	0.8225
3. BF	Q323M3	Macrolide export ATP-binding/permease protein MacB	2.42e-02	NA	1.37e-07	0.3647
3. BF	Q6AE21	Methionine import ATP-binding protein MetN	3.86e-05	NA	2.86e-18	0.6225
3. BF	Q38WL5	Methionine import ATP-binding protein MetN	4.71e-05	NA	2.68e-19	0.685
3. BF	Q63JZ3	Taurine import ATP-binding protein TauB	9.42e-05	NA	8.83e-07	0.7247
3. BF	Q1BPZ6	Macrolide export ATP-binding/permease protein MacB	8.84e-02	NA	6.25e-07	0.3664
3. BF	Q7MJ07	ATP-dependent lipid A-core flippase	9.37e-06	NA	8.10e-08	0.2297
3. BF	Q55463	Bicarbonate transport ATP-binding protein CmpD	3.24e-04	NA	8.76e-11	0.7142
3. BF	Q2P3E1	Lipoprotein-releasing system ATP-binding protein LolD	3.75e-03	NA	1.04e-12	0.7557
3. BF	Q0HVQ0	Lipoprotein-releasing system ATP-binding protein LolD	7.71e-05	NA	1.53e-12	0.8039
3. BF	Q1QDA8	Macrolide export ATP-binding/permease protein MacB	7.12e-02	NA	5.42e-06	0.3762
3. BF	Q73P71	Phosphonates import ATP-binding protein PhnC	9.08e-05	NA	8.60e-15	0.8074
3. BF	Q8D3A0	Lipoprotein-releasing system ATP-binding protein LolD	1.36e-05	NA	1.21e-08	0.8225
3. BF	Q4FU75	Macrolide export ATP-binding/permease protein MacB	6.51e-02	NA	2.17e-06	0.3796
3. BF	Q5NZT6	Lipoprotein-releasing system ATP-binding protein LolD	2.62e-05	NA	9.16e-10	0.8163
3. BF	A1RG29	Macrolide export ATP-binding/permease protein MacB	4.29e-02	NA	5.45e-08	0.3679
3. BF	Q1BZA2	Arabinose import ATP-binding protein AraG 1	4.10e-05	NA	0.009	0.2803
3. BF	Q07LR5	Methionine import ATP-binding protein MetN	4.51e-05	NA	1.64e-24	0.6246
3. BF	P0A2V5	Oligopeptide transport ATP-binding protein OppF	1.24e-06	NA	1.54e-47	0.812
3. BF	Q03Z27	Methionine import ATP-binding protein MetN	4.17e-05	NA	9.38e-20	0.6672
3. BF	Q74AT2	Lipoprotein-releasing system ATP-binding protein LolD	6.90e-05	NA	1.99e-10	0.8019
3. BF	Q8KFD6	Putative ABC transporter ATP-binding protein CT0391	1.65e-05	NA	4.20e-09	0.7452
3. BF	P9WQM0	Sulfate/thiosulfate import ATP-binding protein CysA	6.05e-04	NA	1.70e-19	0.5923
3. BF	Q57QC8	Spermidine/putrescine import ATP-binding protein PotA	1.87e-04	NA	2.14e-17	0.5504
3. BF	Q9HX79	Taurine import ATP-binding protein TauB	2.35e-04	NA	9.80e-10	0.7473
3. BF	P63396	Uncharacterized ABC transporter ATP-binding protein Mb1312c	7.02e-06	NA	4.12e-44	0.2982
3. BF	Q3JHC9	Methionine import ATP-binding protein MetN 2	6.12e-05	NA	7.92e-21	0.5806
3. BF	Q8NQH4	Phosphonates import ATP-binding protein PhnC	8.69e-06	NA	5.87e-09	0.7451
3. BF	Q5YVL8	Hemin import ATP-binding protein HmuV	2.59e-04	NA	0.025	0.7226
3. BF	Q8G5P8	Methionine import ATP-binding protein MetN	2.97e-05	NA	1.22e-24	0.564
3. BF	Q0APW8	Lipoprotein-releasing system ATP-binding protein LolD	1.62e-05	NA	3.81e-04	0.7969
3. BF	Q7CJG3	Macrolide export ATP-binding/permease protein MacB 2	5.09e-02	NA	2.04e-10	0.3499
3. BF	Q63GR8	Methionine import ATP-binding protein MetN 2	5.68e-05	NA	4.23e-22	0.6522
3. BF	Q0C1N8	Macrolide export ATP-binding/permease protein MacB	1.18e-02	NA	1.79e-04	0.384
3. BF	A1BE50	Macrolide export ATP-binding/permease protein MacB	6.03e-02	NA	1.72e-07	0.3654
3. BF	Q5QU46	Lipoprotein-releasing system ATP-binding protein LolD	1.88e-03	NA	4.35e-12	0.8258
3. BF	Q2SIN5	ATP-dependent lipid A-core flippase	2.81e-05	NA	7.30e-07	0.2668
3. BF	A2RH10	Energy-coupling factor transporter ATP-binding protein EcfA2	2.32e-05	NA	6.15e-10	0.7538
3. BF	P0CZ30	Methionine import ATP-binding protein MetN	3.75e-05	NA	1.99e-18	0.6643
3. BF	Q6HPM9	Energy-coupling factor transporter ATP-binding protein EcfA2	5.96e-05	NA	1.61e-16	0.7062
3. BF	Q63MM6	Macrolide export ATP-binding/permease protein MacB	2.00e-02	NA	1.75e-05	0.374
3. BF	Q6HLQ9	Spermidine/putrescine import ATP-binding protein PotA	6.20e-05	NA	1.87e-15	0.6329
3. BF	O83658	Spermidine/putrescine import ATP-binding protein PotA	1.59e-04	NA	3.63e-20	0.5548
3. BF	Q8FV85	Methionine import ATP-binding protein MetN	2.15e-05	NA	4.43e-19	0.6343
3. BF	Q46Y89	ATP-dependent lipid A-core flippase	2.91e-04	NA	8.44e-06	0.2552
3. BF	Q21JQ9	Lipoprotein-releasing system ATP-binding protein LolD	4.37e-05	NA	5.99e-12	0.8106
3. BF	Q6D8T5	Macrolide export ATP-binding/permease protein MacB	2.38e-02	NA	1.89e-07	0.3668
3. BF	Q8DPC2	Spermidine/putrescine import ATP-binding protein PotA	1.44e-04	NA	4.62e-16	0.5511
3. BF	Q65M34	Methionine import ATP-binding protein MetN 1	8.24e-06	NA	3.71e-20	0.6796
3. BF	Q8X5Q4	Ribose import ATP-binding protein RbsA 2	3.40e-05	NA	5.65e-04	0.4019
3. BF	Q8DZJ0	Spermidine/putrescine import ATP-binding protein PotA	2.62e-04	NA	1.75e-16	0.5561
3. BF	Q7WID6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.39e-04	NA	3.24e-12	0.5719
3. BF	Q39IE7	Methionine import ATP-binding protein MetN 1	1.21e-05	NA	2.48e-20	0.6536
3. BF	Q88UV2	Methionine import ATP-binding protein MetN 2	1.52e-05	NA	4.85e-18	0.648
3. BF	O06980	Uncharacterized ABC transporter ATP-binding protein YvcR	3.54e-05	NA	3.80e-10	0.7607
3. BF	Q8ZQE4	Macrolide export ATP-binding/permease protein MacB	3.40e-02	NA	8.47e-07	0.361
3. BF	Q1M360	Ribose import ATP-binding protein RbsA 3	3.38e-04	NA	2.49e-05	0.2681
3. BF	Q8RFV0	Lipoprotein-releasing system ATP-binding protein LolD	1.41e-05	NA	1.25e-12	0.8062
3. BF	Q6F9P2	Methionine import ATP-binding protein MetN 2	1.24e-05	NA	3.08e-20	0.6349
3. BF	Q32EY4	Spermidine/putrescine import ATP-binding protein PotA	5.73e-05	NA	4.65e-17	0.5403
3. BF	Q035B3	Energy-coupling factor transporter ATP-binding protein EcfA2	2.16e-07	NA	3.95e-13	0.7101
3. BF	Q6GE75	Putative hemin import ATP-binding protein HrtA	1.21e-05	NA	3.02e-12	0.8219
3. BF	Q92GP5	Lipoprotein-releasing system ATP-binding protein LolD	7.19e-05	NA	9.23e-10	0.8356
3. BF	Q8Y003	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.20e-04	NA	1.01e-04	0.2772
3. BF	Q3JGG7	Macrolide export ATP-binding/permease protein MacB	3.22e-02	NA	1.75e-05	0.3685
3. BF	Q032H3	Energy-coupling factor transporter ATP-binding protein EcfA2	3.17e-04	NA	1.30e-10	0.7373
3. BF	Q492S9	ATP-dependent lipid A-core flippase	1.17e-04	NA	2.69e-04	0.2812
3. BF	Q87ZE0	Putative ribose/galactose/methyl galactoside import ATP-binding protein	8.56e-05	NA	8.55e-06	0.2739
3. BF	A0B212	Macrolide export ATP-binding/permease protein MacB	8.70e-02	NA	8.83e-07	0.3503
3. BF	Q8Z8R5	Methionine import ATP-binding protein MetN 2	2.09e-05	NA	1.99e-21	0.6693
3. BF	Q1LQF6	Methionine import ATP-binding protein MetN	1.40e-05	NA	2.55e-21	0.6535
3. BF	Q6N798	Methionine import ATP-binding protein MetN 2	3.95e-05	NA	1.19e-19	0.6071
3. BF	Q18CJ0	Energy-coupling factor transporter ATP-binding protein EcfA1	3.33e-05	NA	2.66e-13	0.7245
3. BF	P26050	Nod factor export ATP-binding protein I	1.04e-03	NA	0.003	0.6364
3. BF	Q4QMH4	Methionine import ATP-binding protein MetN	8.40e-06	NA	3.04e-18	0.6288
3. BF	Q8A883	Spermidine/putrescine import ATP-binding protein PotA	8.14e-04	NA	1.99e-11	0.4598
3. BF	Q83CV2	Lipoprotein-releasing system ATP-binding protein LolD	1.76e-05	NA	1.76e-09	0.7992
3. BF	Q9L0Q1	Diacetylchitobiose uptake system ATP-binding protein MsiK	2.52e-04	NA	8.22e-14	0.5538
3. BF	Q1CAK4	Methionine import ATP-binding protein MetN 1	9.11e-06	NA	5.59e-20	0.6687
3. BF	Q03P57	Methionine import ATP-binding protein MetN	9.60e-06	NA	2.05e-17	0.6556
3. BF	Q8DWR4	Energy-coupling factor transporter ATP-binding protein EcfA2	4.00e-05	NA	2.18e-09	0.7265
3. BF	Q3Z2Z3	Spermidine/putrescine import ATP-binding protein PotA	6.26e-05	NA	3.03e-17	0.5545
3. BF	Q604C1	Lipoprotein-releasing system ATP-binding protein LolD	1.81e-05	NA	9.96e-12	0.8499
3. BF	A0KMJ3	Macrolide export ATP-binding/permease protein MacB 2	8.33e-02	NA	1.13e-07	0.3402
3. BF	Q0BH79	Methionine import ATP-binding protein MetN 1	1.36e-05	NA	1.94e-21	0.6559
3. BF	A0PXX7	Energy-coupling factor transporter ATP-binding protein EcfA1	3.53e-05	NA	3.13e-13	0.7156
3. BF	Q2FNX9	Energy-coupling factor transporter ATP-binding protein EcfA1	2.60e-05	NA	1.32e-13	0.7592
3. BF	Q44613	Lipoprotein-releasing system ATP-binding protein LolD	1.41e-05	NA	1.40e-12	0.8201
3. BF	Q0WJP9	Autoinducer 2 import ATP-binding protein LsrA	7.60e-05	NA	6.26e-07	0.2739
3. BF	Q9Z9J3	Energy-coupling factor transporter ATP-binding protein EcfA1	8.89e-05	NA	2.56e-06	0.7106
3. BF	Q67JX3	Energy-coupling factor transporter ATP-binding protein EcfA1	9.69e-05	NA	7.68e-19	0.7025
3. BF	Q8TTN2	Putative ABC transporter ATP-binding protein MA_0394	2.28e-04	NA	3.82e-10	0.4694
3. BF	D4GP38	Xylose/arabinose import ATP-binding protein XacJ	1.94e-04	NA	1.31e-15	0.5416
3. BF	Q1GHE5	Ribose import ATP-binding protein RbsA	1.45e-04	NA	0.002	0.294
3. BF	Q5PCG9	Methionine import ATP-binding protein MetN 2	1.92e-05	NA	1.93e-22	0.6692
3. BF	Q1GC08	Phosphonates import ATP-binding protein PhnC	7.72e-06	NA	1.36e-11	0.7978
3. BF	Q14J44	Lipoprotein-releasing system ATP-binding protein LolD	9.98e-06	NA	8.03e-12	0.8208
3. BF	Q1QX69	ATP-dependent lipid A-core flippase	8.73e-06	NA	1.98e-06	0.2436
3. BF	Q88RA1	Taurine import ATP-binding protein TauB	2.13e-04	NA	2.26e-07	0.7439
3. BF	Q7VWD8	ATP-dependent lipid A-core flippase	1.24e-04	NA	3.33e-07	0.2627
3. BF	Q88F88	Macrolide export ATP-binding/permease protein MacB	4.21e-02	NA	2.75e-08	0.3497
3. BF	Q13LD8	Methionine import ATP-binding protein MetN 2	4.34e-05	NA	2.75e-22	0.6063
3. BF	Q7A0J1	Putative multidrug export ATP-binding/permease protein MW1806	1.04e-05	NA	2.24e-07	0.2177
3. BF	Q8CRI6	Energy-coupling factor transporter ATP-binding protein EcfA1	2.13e-04	NA	7.25e-10	0.7826
3. BF	Q83LP0	ATP-dependent lipid A-core flippase	5.27e-04	NA	7.36e-08	0.2542
3. BF	Q1RE44	Macrolide export ATP-binding/permease protein MacB	3.76e-02	NA	6.49e-08	0.3638
3. BF	Q39EV3	Lipoprotein-releasing system ATP-binding protein LolD	9.42e-05	NA	5.03e-13	0.7559
3. BF	Q87R20	Lipoprotein-releasing system ATP-binding protein LolD	4.06e-05	NA	3.74e-12	0.8015
3. BF	Q3KJS6	Methionine import ATP-binding protein MetN 2	3.14e-05	NA	3.69e-23	0.5947
3. BF	Q88KY4	Lipoprotein-releasing system ATP-binding protein LolD	2.62e-05	NA	4.55e-10	0.8229
3. BF	Q8KZR4	Taurine import ATP-binding protein TauB	2.13e-04	NA	2.52e-07	0.7457
3. BF	Q6N9W0	Methionine import ATP-binding protein MetN 1	5.55e-05	NA	6.71e-24	0.6329
3. BF	Q57T09	Methionine import ATP-binding protein MetN 1	9.29e-06	NA	3.75e-20	0.6707
3. BF	Q5PFQ7	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	3.61e-04	NA	3.51e-18	0.5636
3. BF	Q92WD6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.28e-04	NA	6.46e-12	0.5899
3. BF	Q87RS1	Methionine import ATP-binding protein MetN	1.27e-05	NA	3.39e-18	0.6522
3. BF	Q7NUJ3	Macrolide export ATP-binding/permease protein MacB	8.63e-03	NA	1.22e-06	0.3581
3. BF	Q7VMV4	Lipoprotein-releasing system ATP-binding protein LolD	1.11e-05	NA	5.31e-11	0.8193
3. BF	Q2YKR8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.25e-04	NA	1.09e-13	0.5936
3. BF	Q0SFY5	Methionine import ATP-binding protein MetN 1	9.34e-05	NA	3.82e-17	0.6358
3. BF	Q6HPN0	Energy-coupling factor transporter ATP-binding protein EcfA1	3.54e-04	NA	6.56e-10	0.7161
3. BF	Q8EPK1	Methionine import ATP-binding protein MetN 1	1.40e-05	NA	1.04e-18	0.6537
3. BF	P63355	Methionine import ATP-binding protein MetN	9.05e-06	NA	5.97e-20	0.662
3. BF	Q0I4C5	ATP-dependent lipid A-core flippase	1.76e-04	NA	4.01e-08	0.2641
3. BF	Q1MIJ4	Lipoprotein-releasing system ATP-binding protein LolD	4.62e-05	NA	3.94e-07	0.8199
3. BF	A2RKA7	Nucleoside import ATP-binding protein NupA	8.19e-05	NA	5.19e-05	0.2646
3. BF	Q7ULB5	Macrolide export ATP-binding/permease protein MacB	2.03e-02	NA	4.08e-12	0.345
3. BF	Q9F9B0	Fructose import ATP-binding protein FrcA	8.93e-04	NA	3.91e-06	0.7592
3. BF	O69051	Phosphite import ATP-binding protein PxtA	9.43e-06	NA	1.02e-12	0.7425
3. BF	P0DTT6	Xylose/arabinose import ATP-binding protein XylG	6.11e-05	NA	8.39e-06	0.7296
3. BF	Q6N7Y6	Hemin import ATP-binding protein HmuV	4.35e-04	NA	0.043	0.7186
3. BF	Q3ATR5	Macrolide export ATP-binding/permease protein MacB	5.42e-02	NA	3.99e-09	0.3702
3. BF	Q9ZCM4	Lipoprotein-releasing system ATP-binding protein LolD	1.89e-05	NA	5.56e-10	0.8313
3. BF	Q8YQ88	Putative ABC transporter ATP-binding protein alr3946	5.87e-05	NA	2.40e-07	0.777
3. BF	Q043Y8	Methionine import ATP-binding protein MetN	7.31e-05	NA	9.70e-19	0.6492
3. BF	Q8R7Y5	Energy-coupling factor transporter ATP-binding protein EcfA2	1.19e-04	NA	1.76e-12	0.7172
3. BF	Q1RD37	Lipoprotein-releasing system ATP-binding protein LolD	7.44e-06	NA	2.61e-11	0.8161
3. BF	Q88RB3	Methionine import ATP-binding protein MetN 2	2.53e-05	NA	8.59e-25	0.5942
3. BF	Q7A4T3	Putative multidrug export ATP-binding/permease protein SA1683	1.07e-05	NA	2.24e-07	0.2176
3. BF	Q1JDG6	Methionine import ATP-binding protein MetN	3.87e-05	NA	2.22e-18	0.6625
3. BF	Q71X09	Methionine import ATP-binding protein MetN 2	1.81e-05	NA	5.79e-22	0.6593
3. BF	Q3KE48	Macrolide export ATP-binding/permease protein MacB 2	3.02e-02	NA	1.03e-08	0.3775
3. BF	Q0B6I6	Methionine import ATP-binding protein MetN 2	9.41e-05	NA	6.92e-22	0.5981
3. BF	Q5MK06	Macrolide export ATP-binding/permease protein MacB	7.05e-02	NA	7.17e-08	0.3833
3. BF	Q65U21	ATP-dependent lipid A-core flippase	4.24e-04	NA	1.49e-08	0.2501
3. BF	Q46Y69	Methionine import ATP-binding protein MetN	1.44e-05	NA	2.74e-20	0.6367
3. BF	P0CI33	Methionine import ATP-binding protein MetN	7.31e-05	NA	1.63e-16	0.6137
3. BF	A0K4E8	Arabinose import ATP-binding protein AraG 1	3.98e-05	NA	0.009	0.2802
3. BF	Q87UN4	Methionine import ATP-binding protein MetN 2	2.36e-05	NA	3.17e-23	0.653
4. PB	Q6GDC0	Putative ABC transporter ATP-binding protein SAR2766	5.32e-05	7.60e-04	3.78e-06	NA
4. PB	Q5HCL3	Putative ABC transporter ATP-binding protein SACOL2708	4.75e-05	9.35e-04	4.58e-07	NA
4. PB	Q98QE1	Spermidine/putrescine import ATP-binding protein PotA	4.96e-04	1.71e-03	6.43e-18	NA
4. PB	Q1RE96	Glutathione import ATP-binding protein GsiA	1.10e-05	3.01e-06	1.05e-47	NA
4. PB	Q8DQY5	Putative ABC transporter ATP-binding protein spr0430	3.15e-04	3.09e-02	8.60e-07	NA
4. PB	P75264	Putative ABC transporter ATP-binding protein MG187 homolog	1.01e-06	4.80e-07	4.51e-16	NA
4. PB	Q59056	Uncharacterized ABC transporter ATP-binding protein MJ1662	7.70e-04	4.44e-02	2.59e-06	NA
4. PB	P47433	Putative ABC transporter ATP-binding protein MG187	1.04e-07	8.87e-09	4.17e-17	NA
4. PB	P0A9W5	Energy-dependent translational throttle protein EttA	3.39e-04	2.62e-03	1.58e-04	NA
4. PB	Q4A7I1	Spermidine/putrescine import ATP-binding protein PotA	2.93e-04	1.23e-02	1.63e-19	NA
4. PB	Q93D97	Putative ABC transporter ATP-binding protein SMU_1934c	2.94e-04	4.29e-02	6.66e-06	NA
4. PB	Q99QV7	Putative ABC transporter ATP-binding protein SAV2684	4.20e-03	9.18e-04	4.62e-07	NA
4. PB	A0A0H2VFI8	Energy-dependent translational throttle protein EttA	3.30e-04	2.97e-03	1.61e-04	NA
4. PB	Q97SA3	Putative ABC transporter ATP-binding protein SP_0483	1.69e-04	1.14e-02	1.64e-06	NA
4. PB	Q6G5Z1	Putative ABC transporter ATP-binding protein SAS2569	7.58e-05	9.26e-04	4.54e-07	NA
4. PB	Q7A342	Putative ABC transporter ATP-binding protein SA2476	5.45e-05	9.18e-04	4.62e-07	NA
4. PB	Q8NUH8	Putative ABC transporter ATP-binding protein MW2603	5.40e-05	9.26e-04	4.54e-07	NA
4. PB	Q8FJL0	Glutathione import ATP-binding protein GsiA	1.08e-05	2.13e-06	1.66e-47	NA
4. PB	Q0TJM0	Glutathione import ATP-binding protein GsiA	1.28e-05	3.25e-06	8.60e-48	NA
4. PB	P0A9W4	Energy-dependent translational throttle protein EttA	3.48e-04	2.62e-03	1.58e-04	NA
4. PB	P45127	Energy-dependent translational throttle protein EttA	3.54e-04	2.20e-03	1.01e-04	NA
4. PB	Q8XK20	Putative ABC transporter ATP-binding protein CPE1583	3.10e-05	2.23e-02	2.86e-09	NA
4. PB	Q7NB11	Spermidine/putrescine import ATP-binding protein PotA	5.29e-05	7.21e-06	1.02e-22	NA
4. PB	P75059	Spermidine/putrescine import ATP-binding protein PotA	8.00e-07	3.14e-08	4.19e-16	NA
4. PB	Q3Z3V4	Glutathione import ATP-binding protein GsiA	1.15e-05	1.24e-05	2.12e-48	NA
4. PB	Q8DY60	Putative ABC transporter ATP-binding protein SAG1633	1.54e-04	4.12e-02	1.01e-07	NA
4. PB	P0A9W3	Energy-dependent translational throttle protein EttA	3.51e-04	2.62e-03	1.58e-04	NA
4. PB	Q9PPV2	Energy-coupling factor transporter ATP-binding protein EcfA2	2.28e-05	1.08e-04	1.11e-07	NA
4. PB	P75796	Glutathione import ATP-binding protein GsiA	1.44e-05	8.62e-06	2.25e-48	NA
5. P	Q8EUR3	Spermidine/putrescine import ATP-binding protein PotA	4.92e-07	2.00e-05	NA	NA
6. F	Q1BGC0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	1.80e-04	NA	NA	0.2724
6. F	Q9ZNB0	Uncharacterized ABC transporter ATP-binding protein SCO0742	1.16e-05	NA	NA	0.2466
6. F	P75516	Putative carbohydrate transport ATP-binding protein MPN_258	4.41e-05	NA	NA	0.2419
6. F	A0KE25	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	2.02e-04	NA	NA	0.2775
6. F	P0A192	High-affinity branched-chain amino acid transport ATP-binding protein LivF	1.36e-05	NA	NA	0.8684
6. F	P47365	Putative carbohydrate transport ATP-binding protein MG119	2.26e-05	NA	NA	0.2456
7. B	Q8Z8A4	Molybdenum import ATP-binding protein ModC	1.48e-03	NA	1.19e-04	NA
7. B	Q8XZ72	Phosphate import ATP-binding protein PstB	3.02e-05	NA	4.19e-11	NA
7. B	Q81GC1	Spermidine/putrescine import ATP-binding protein PotA	6.59e-05	NA	2.17e-15	NA
7. B	A0A0H3JXA3	Metal-staphylopine import system ATP-binding protein CntD	6.29e-07	NA	2.14e-20	NA
7. B	O66646	Lipoprotein-releasing system ATP-binding protein LolD	6.81e-06	NA	1.20e-07	NA
7. B	P75095	Putative ABC transporter ATP-binding protein MG014 homolog	5.89e-06	NA	0.004	NA
7. B	Q56342	Galactose/methyl galactoside import ATP-binding protein MglA	8.80e-05	NA	0.002	NA
7. B	Q168E3	Lipoprotein-releasing system ATP-binding protein LolD	1.60e-05	NA	1.32e-06	NA
7. B	Q2SU77	sn-glycerol-3-phosphate import ATP-binding protein UgpC	4.31e-04	NA	4.66e-10	NA
7. B	Q8FUU5	Zinc import ATP-binding protein ZnuC	5.73e-03	NA	2.86e-09	NA
7. B	Q2J0F4	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	6.56e-05	NA	2.24e-06	NA
7. B	Q21NS8	ATP-dependent lipid A-core flippase	8.92e-05	NA	2.19e-06	NA
7. B	Q00449	Multidrug resistance protein homolog 49	5.35e-02	NA	8.15e-09	NA
7. B	Q8EG82	Phosphate import ATP-binding protein PstB 1	2.59e-06	NA	3.97e-11	NA
7. B	P54954	Probable amino-acid import ATP-binding protein YxeO	3.91e-06	NA	1.17e-14	NA
7. B	Q81HW8	Ribose import ATP-binding protein RbsA	6.11e-05	NA	5.53e-06	NA
7. B	A0A0H2ZH52	Di/tripeptide transport ATP-binding protein DppF	1.33e-09	NA	1.66e-49	NA
7. B	Q1RC47	Uncharacterized ABC transporter ATP-binding protein YcjV	1.70e-04	NA	9.35e-12	NA
7. B	Q8U9B0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	3.60e-05	NA	5.81e-04	NA
7. B	O59479	Putative ABC transporter ATP-binding protein PH1815	6.35e-05	NA	9.96e-12	NA
7. B	Q8FJB1	ATP-dependent lipid A-core flippase	6.03e-04	NA	7.68e-08	NA
7. B	P32721	D-allose import ATP-binding protein AlsA	4.12e-05	NA	4.53e-04	NA
7. B	Q11DN5	Phosphate import ATP-binding protein PstB	2.42e-06	NA	2.14e-09	NA
7. B	Q9HYT0	Phosphonates import ATP-binding protein PhnC 1	6.59e-05	NA	1.14e-05	NA
7. B	Q601T5	Energy-coupling factor transporter ATP-binding protein EcfA1	1.98e-04	NA	8.01e-07	NA
7. B	Q9KLQ5	Fe(3+) ions import ATP-binding protein FbpC	1.29e-04	NA	4.37e-17	NA
7. B	Q0HFA0	Molybdenum import ATP-binding protein ModC	1.41e-03	NA	1.71e-12	NA
7. B	Q5LXJ3	Energy-coupling factor transporter ATP-binding protein EcfA1	2.87e-04	NA	4.24e-11	NA
7. B	Q92UV5	Fe(3+) ions import ATP-binding protein FbpC 2	9.08e-04	NA	7.97e-16	NA
7. B	P47325	Oligopeptide transport ATP-binding protein OppD	2.36e-04	NA	3.35e-28	NA
7. B	Q89EW7	Molybdenum import ATP-binding protein ModC 2	3.68e-02	NA	1.08e-13	NA
7. B	P54592	Uncharacterized ABC transporter ATP-binding protein YhcH	6.82e-04	NA	1.87e-09	NA
7. B	Q58283	Uncharacterized ABC transporter ATP-binding protein MJ0873	3.33e-04	NA	9.80e-08	NA
7. B	O65934	ABC transporter ATP-binding/permease protein Rv1747	8.78e-02	NA	0.003	NA
7. B	Q608V9	Molybdenum import ATP-binding protein ModC	5.69e-03	NA	1.33e-11	NA
7. B	Q63Q62	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.98e-04	NA	3.53e-10	NA
7. B	Q58663	Probable branched-chain amino acid transport ATP-binding protein LivG	9.27e-05	NA	1.41e-07	NA
7. B	Q6LK34	Galactose/methyl galactoside import ATP-binding protein MglA 1	2.79e-05	NA	4.39e-04	NA
7. B	Q5F364	Multidrug resistance-associated protein 1	5.04e-02	NA	1.39e-04	NA
7. B	Q4FLF6	Phosphate import ATP-binding protein PstB	2.41e-05	NA	1.45e-10	NA
7. B	Q2NSR0	Hemin import ATP-binding protein HmuV	6.11e-05	NA	0.001	NA
7. B	Q1JLH6	Phosphate import ATP-binding protein PstB 2	3.04e-06	NA	9.53e-10	NA
7. B	B5X0E4	ATP-binding cassette sub-family B member 5	2.32e-02	NA	1.24e-08	NA
7. B	Q9MAH4	ABC transporter G family member 10	1.50e-02	NA	0.026	NA
7. B	O14286	Iron-sulfur clusters transporter atm1, mitochondrial	1.41e-04	NA	9.64e-05	NA
7. B	Q2JTU3	Phosphate import ATP-binding protein PstB 2	1.47e-03	NA	6.89e-07	NA
7. B	Q927N8	Energy-coupling factor transporter ATP-binding protein EcfA1	1.41e-04	NA	4.23e-12	NA
7. B	Q9I190	Macrolide export ATP-binding/permease protein MacB	7.84e-02	NA	4.21e-11	NA
7. B	Q032H4	Energy-coupling factor transporter ATP-binding protein EcfA1	1.02e-04	NA	3.97e-13	NA
7. B	Q1I7I9	Macrolide export ATP-binding/permease protein MacB 2	2.57e-02	NA	1.54e-08	NA
7. B	Q1C9V1	Galactose/methyl galactoside import ATP-binding protein MglA	1.45e-04	NA	2.28e-05	NA
7. B	Q8Z245	sn-glycerol-3-phosphate import ATP-binding protein UgpC	4.22e-04	NA	1.01e-10	NA
7. B	Q8FCM9	Nickel import ATP-binding protein NikE	1.20e-07	NA	2.82e-23	NA
7. B	Q6G7A0	Energy-coupling factor transporter ATP-binding protein EcfA2	9.42e-05	NA	5.13e-13	NA
7. B	Q71WH7	Energy-coupling factor transporter ATP-binding protein EcfA1	3.43e-04	NA	5.96e-12	NA
7. B	Q9KUI0	Sulfate/thiosulfate import ATP-binding protein CysA	2.66e-04	NA	2.83e-15	NA
7. B	Q16BJ3	Taurine import ATP-binding protein TauB	2.59e-05	NA	8.02e-09	NA
7. B	Q8Y7R4	Putative ABC transporter ATP-binding protein lmo1207	5.70e-05	NA	4.57e-06	NA
7. B	Q9FLT5	ABC transporter A family member 9	9.85e-04	NA	3.22e-04	NA
7. B	Q4QM77	Galactose/methyl galactoside import ATP-binding protein MglA	6.02e-04	NA	6.11e-06	NA
7. B	P63353	Sulfate/thiosulfate import ATP-binding protein CysA	1.43e-04	NA	2.91e-15	NA
7. B	Q7ANN4	Type I secretion system ATP-binding protein PrsD	6.71e-05	NA	0.010	NA
7. B	Q881U6	Aliphatic sulfonates import ATP-binding protein SsuB 2	2.03e-04	NA	1.52e-10	NA
7. B	Q2ISN3	Phosphonates import ATP-binding protein PhnC 2	2.10e-04	NA	3.93e-12	NA
7. B	Q3SVB5	Phosphate import ATP-binding protein PstB	2.28e-06	NA	9.60e-09	NA
7. B	P35020	Probable ATP-dependent transporter ycf16	7.11e-05	NA	8.22e-04	NA
7. B	P44692	Zinc import ATP-binding protein ZnuC	2.03e-04	NA	8.64e-09	NA
7. B	Q58639	Uncharacterized ABC transporter ATP-binding protein MJ1242	6.27e-05	NA	3.71e-12	NA
7. B	Q9NP78	ABC-type oligopeptide transporter ABCB9	3.21e-04	NA	7.65e-05	NA
7. B	P63390	Probable ATP-binding protein YheS	3.80e-04	NA	3.22e-06	NA
7. B	C3LLU1	Vitamin B12 import ATP-binding protein BtuD	8.61e-04	NA	2.41e-04	NA
7. B	Q8ZRV2	Thiamine import ATP-binding protein ThiQ	1.30e-05	NA	1.46e-11	NA
7. B	Q1C1B8	Ribose import ATP-binding protein RbsA	1.84e-04	NA	2.45e-05	NA
7. B	Q1M7W6	Nod factor export ATP-binding protein I	3.43e-03	NA	0.002	NA
7. B	F1RBC8	ATP-binding cassette sub-family D member 1	9.18e-03	NA	0.013	NA
7. B	Q0TBX9	Nickel import ATP-binding protein NikD	2.32e-06	NA	1.04e-18	NA
7. B	Q62L74	Phosphate import ATP-binding protein PstB	3.70e-05	NA	1.10e-11	NA
7. B	Q47908	ATP-dependent lipid A-core flippase	2.50e-05	NA	1.79e-06	NA
7. B	Q54QY9	ABC transporter H family member 4	2.87e-02	NA	0.001	NA
7. B	Q3KJQ7	Taurine import ATP-binding protein TauB	2.19e-04	NA	2.02e-08	NA
7. B	Q8VQK6	Putative peptide import ATP-binding protein BruAb2_1033	2.18e-11	NA	1.41e-31	NA
7. B	Q2FVR1	Putative hemin import ATP-binding protein HrtA	1.56e-05	NA	3.97e-12	NA
7. B	O42943	Uncharacterized ABC transporter ATP-binding protein C16H5.08c	2.18e-04	NA	7.52e-06	NA
7. B	Q99S48	Energy-coupling factor transporter ATP-binding protein EcfA2	9.48e-05	NA	5.13e-13	NA
7. B	Q83MG3	Thiamine import ATP-binding protein ThiQ	1.73e-05	NA	1.45e-11	NA
7. B	Q61102	Iron-sulfur clusters transporter ABCB7, mitochondrial	1.13e-04	NA	3.49e-06	NA
7. B	Q6XYT0	Phosphate import ATP-binding protein PstB	8.26e-07	NA	1.56e-10	NA
7. B	Q4WPP6	ABC multidrug transporter mdr2	1.39e-04	NA	4.00e-06	NA
7. B	Q39JR1	Arabinose import ATP-binding protein AraG 1	4.43e-05	NA	0.008	NA
7. B	Q18AM3	Spermidine/putrescine import ATP-binding protein PotA	1.77e-04	NA	1.01e-16	NA
7. B	Q7MMN0	Zinc import ATP-binding protein ZnuC	1.18e-03	NA	1.90e-09	NA
7. B	A0RBB0	Spermidine/putrescine import ATP-binding protein PotA	6.66e-05	NA	1.98e-15	NA
7. B	Q9K8L5	Phosphate import ATP-binding protein PstB	2.67e-06	NA	3.51e-09	NA
7. B	Q55BC0	ABC transporter A family member 8	1.12e-03	NA	0.004	NA
7. B	Q9KN37	Ribose import ATP-binding protein RbsA	3.18e-03	NA	2.64e-07	NA
7. B	Q324F4	Molybdenum import ATP-binding protein ModC	1.43e-03	NA	5.30e-05	NA
7. B	Q5LUR8	Zinc import ATP-binding protein ZnuC	3.98e-07	NA	2.94e-05	NA
7. B	Q2RWU0	Phosphate import ATP-binding protein PstB	1.24e-06	NA	5.51e-11	NA
7. B	Q1RAS6	Zinc import ATP-binding protein ZnuC	9.53e-04	NA	2.78e-09	NA
7. B	Q9HML8	Phosphate import ATP-binding protein PstB 2	1.90e-05	NA	8.35e-09	NA
7. B	P75356	Putative ABC transporter ATP-binding protein MG303 homolog	2.38e-04	NA	5.61e-06	NA
7. B	Q1CDJ0	Ribose import ATP-binding protein RbsA	6.23e-05	NA	2.45e-05	NA
7. B	Q8T9W1	Serine protease/ABC transporter B family protein tagD	4.64e-02	NA	1.84e-04	NA
7. B	Q5HPF5	Phosphate import ATP-binding protein PstB	2.73e-06	NA	6.22e-09	NA
7. B	Q08D64	ATP-binding cassette sub-family B member 6	8.46e-04	NA	5.85e-07	NA
7. B	Q2L0H5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.61e-04	NA	1.47e-12	NA
7. B	Q8EAN3	Molybdenum import ATP-binding protein ModC	2.57e-03	NA	9.16e-13	NA
7. B	Q1M589	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	1.72e-04	NA	7.89e-13	NA
7. B	P18767	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.24e-06	NA	1.32e-07	NA
7. B	Q399X3	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.20e-04	NA	1.51e-04	NA
7. B	G7CBF6	Mycobactin import ATP-binding/permease protein IrtB	1.20e-05	NA	9.59e-06	NA
7. B	Q1JGL2	Phosphate import ATP-binding protein PstB 2	3.14e-06	NA	9.53e-10	NA
7. B	Q7W148	Phosphonates import ATP-binding protein PhnC	1.11e-05	NA	1.88e-14	NA
7. B	Q0SVB6	Phosphate import ATP-binding protein PstB	1.11e-06	NA	2.24e-11	NA
7. B	Q5GRS1	Zinc import ATP-binding protein ZnuC	1.70e-03	NA	5.24e-09	NA
7. B	Q0PAR0	Macrolide export ATP-binding/permease protein MacB	3.63e-02	NA	6.62e-08	NA
7. B	O84421	Probable metal transport system ATP-binding protein CT_416	3.33e-07	NA	1.16e-05	NA
7. B	P0AAH1	Phosphate import ATP-binding protein PstB	1.21e-03	NA	1.02e-11	NA
7. B	Q4AA75	Energy-coupling factor transporter ATP-binding protein EcfA1	2.08e-04	NA	2.36e-06	NA
7. B	P31548	Thiamine import ATP-binding protein ThiQ	1.56e-05	NA	1.54e-12	NA
7. B	P61222	ATP-binding cassette sub-family E member 1	1.12e-02	NA	0.013	NA
7. B	P9WQK8	Phosphate import ATP-binding protein PstB 2	1.09e-05	NA	1.00e-10	NA
7. B	Q9R1X5	ATP-binding cassette sub-family C member 5	2.84e-02	NA	4.88e-05	NA
7. B	Q884D4	Macrolide export ATP-binding/permease protein MacB 1	3.40e-02	NA	5.63e-09	NA
7. B	Q8Y843	Teichoic acids export ATP-binding protein TagH	1.80e-03	NA	2.43e-05	NA
7. B	P9WQL4	Probable ribonucleotide transport ATP-binding protein mkl	7.02e-05	NA	4.05e-12	NA
7. B	Q8P8W4	ATP-dependent lipid A-core flippase	4.03e-04	NA	4.45e-08	NA
7. B	Q47F10	Phosphonates import ATP-binding protein PhnC	7.23e-05	NA	9.82e-08	NA
7. B	Q9ESR9	ATP-binding cassette sub-family A member 2	4.26e-02	NA	0.028	NA
7. B	Q818I7	Phosphate import ATP-binding protein PstB	1.91e-06	NA	2.66e-11	NA
7. B	P63373	Phosphate import ATP-binding protein PstB 1	1.26e-03	NA	2.08e-08	NA
7. B	J9VWU3	Iron-sulfur clusters transporter ATM1, mitochondrial	2.23e-05	NA	3.86e-06	NA
7. B	Q9RKQ4	Hemin import ATP-binding protein HmuV	3.07e-04	NA	0.001	NA
7. B	Q87Z03	Cytochrome c biogenesis ATP-binding export protein CcmA	1.40e-03	NA	2.99e-04	NA
7. B	Q5E4D8	Phosphate import ATP-binding protein PstB 1	1.77e-06	NA	1.42e-09	NA
7. B	Q65UW1	Galactose/methyl galactoside import ATP-binding protein MglA	1.81e-04	NA	1.67e-05	NA
7. B	Q9FWX8	ABC transporter B family member 12	1.44e-02	NA	2.55e-09	NA
7. B	Q1C0Q8	Hemin import ATP-binding protein HmuV	3.32e-04	NA	3.65e-08	NA
7. B	Q8E3S6	Putative ABC transporter ATP-binding protein gbs1680	7.04e-05	NA	7.03e-08	NA
7. B	Q1MAB5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.41e-06	NA	1.34e-06	NA
7. B	Q57554	Uncharacterized ABC transporter ATP-binding protein MJ0089	1.63e-04	NA	9.87e-09	NA
7. B	Q8DU24	Phosphate import ATP-binding protein PstB 1	1.25e-03	NA	3.49e-08	NA
7. B	Q63120	ATP-binding cassette sub-family C member 2	5.59e-03	NA	1.07e-04	NA
7. B	Q87RE5	Zinc import ATP-binding protein ZnuC	7.02e-04	NA	9.51e-10	NA
7. B	Q8F6L8	Lipoprotein-releasing system ATP-binding protein LolD	2.46e-05	NA	6.97e-11	NA
7. B	Q0I3Y9	Spermidine/putrescine import ATP-binding protein PotA	4.75e-05	NA	5.77e-17	NA
7. B	Q0TI47	Uncharacterized ABC transporter ATP-binding protein YcjV	3.05e-04	NA	8.93e-12	NA
7. B	P9WQL1	Phosphate import ATP-binding protein PstB 1	1.11e-03	NA	0.002	NA
7. B	Q57399	Molybdate import ATP-binding protein MolC	3.82e-04	NA	1.19e-05	NA
7. B	Q07LU3	Hemin import ATP-binding protein HmuV	7.92e-04	NA	4.93e-05	NA
7. B	Q7FB56	Putative ABC transporter C family member 15	5.02e-02	NA	0.049	NA
7. B	Q1JUP7	Arabinose import ATP-binding protein AraG	4.20e-04	NA	6.75e-04	NA
7. B	Q57HY8	Phosphate import ATP-binding protein PstB	5.05e-06	NA	1.21e-11	NA
7. B	Q8TQW9	Putative ABC transporter ATP-binding protein MA_1418	6.32e-04	NA	7.35e-10	NA
7. B	Q4A8A2	Energy-coupling factor transporter ATP-binding protein EcfA1	2.03e-04	NA	8.01e-07	NA
7. B	Q0BFU0	Ribose import ATP-binding protein RbsA 1	1.12e-03	NA	0.005	NA
7. B	Q0P9X7	Probable ABC transporter ATP-binding protein PEB1C	4.72e-06	NA	2.25e-14	NA
7. B	Q132E8	Phosphonates import ATP-binding protein PhnC	1.20e-04	NA	2.08e-11	NA
7. B	Q5BAY0	ABC multidrug transporter atrD	7.43e-03	NA	1.83e-07	NA
7. B	Q6GH27	Nickel import system ATP-binding protein NikD	4.82e-04	NA	7.31e-15	NA
7. B	P0CZ37	Phosphate import ATP-binding protein PstB 1	1.24e-03	NA	1.58e-07	NA
7. B	P63364	Phosphate import ATP-binding protein PstB 1	2.20e-06	NA	3.80e-12	NA
7. B	Q7MEV1	Ribose import ATP-binding protein RbsA	4.63e-03	NA	9.17e-08	NA
7. B	Q57180	Uncharacterized ABC transporter ATP-binding protein HI_1051	1.64e-05	NA	2.60e-08	NA
7. B	Q57SD6	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	3.14e-04	NA	1.39e-18	NA
7. B	Q3BV68	Phosphate import ATP-binding protein PstB	1.89e-06	NA	6.96e-10	NA
7. B	Q9HMZ4	Putative ABC transporter ATP-binding protein VNG_2317G	6.11e-06	NA	1.01e-06	NA
7. B	Q8CF82	Cholesterol transporter ABCA5	1.19e-02	NA	4.08e-04	NA
7. B	Q2FW34	Energy-coupling factor transporter ATP-binding protein EcfA1	1.20e-04	NA	7.19e-12	NA
7. B	Q99ZS8	Spermidine/putrescine import ATP-binding protein PotA	2.58e-04	NA	3.82e-16	NA
7. B	Q9RR46	Glycine betaine/carnitine transport ATP-binding protein GbuA	6.18e-05	NA	1.47e-12	NA
7. B	Q5X484	Methionine import ATP-binding protein MetN	7.44e-05	NA	1.98e-15	NA
7. B	P0A2V3	Octopine permease ATP-binding protein P	1.12e-05	NA	1.27e-14	NA
7. B	Q9I3N7	Cytochrome c biogenesis ATP-binding export protein CcmA	8.41e-04	NA	0.031	NA
7. B	Q3AKM8	Phosphonates import ATP-binding protein PhnC	6.14e-06	NA	1.65e-15	NA
7. B	Q6LG59	Galactose/methyl galactoside import ATP-binding protein MglA 2	6.42e-04	NA	1.44e-04	NA
7. B	Q630Y3	Teichoic acids export ATP-binding protein TagH	7.26e-02	NA	0.037	NA
7. B	Q5E0T4	Molybdenum import ATP-binding protein ModC	2.24e-03	NA	4.47e-13	NA
7. B	P0AAI2	Aliphatic sulfonates import ATP-binding protein SsuB	1.45e-04	NA	5.12e-13	NA
7. B	Q6HHI7	Aliphatic sulfonates import ATP-binding protein SsuB	1.23e-04	NA	6.70e-12	NA
7. B	Q322E8	Zinc import ATP-binding protein ZnuC	1.07e-03	NA	2.78e-09	NA
7. B	Q5LS19	Phosphate import ATP-binding protein PstB	2.02e-06	NA	4.34e-11	NA
7. B	Q8UAK2	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	8.16e-05	NA	9.32e-07	NA
7. B	P37774	L-cystine transport system ATP-binding protein TcyN	1.12e-04	NA	6.63e-18	NA
7. B	P45092	Arginine transport ATP-binding protein ArtP	3.25e-07	NA	3.24e-15	NA
7. B	Q20Y31	Phosphonates import ATP-binding protein PhnC 2	6.94e-06	NA	1.77e-10	NA
7. B	O34512	Uncharacterized ABC transporter ATP-binding protein YfmM	1.11e-04	NA	9.47e-05	NA
7. B	Q0S9A4	Ribose import ATP-binding protein RbsA	1.70e-04	NA	4.99e-06	NA
7. B	Q2YU20	Putative multidrug export ATP-binding/permease protein SAB1799c	9.16e-05	NA	2.03e-07	NA
7. B	Q0BIE1	Arabinose import ATP-binding protein AraG 1	5.71e-05	NA	0.009	NA
7. B	Q11SW8	Lipoprotein-releasing system ATP-binding protein LolD	3.42e-05	NA	6.81e-09	NA
7. B	P0A9S0	Cell division ATP-binding protein FtsE	2.20e-05	NA	4.99e-10	NA
7. B	P54683	Serine protease/ABC transporter B family protein tagB	4.40e-02	NA	5.63e-04	NA
7. B	Q933I3	Leukotoxin translocation ATP-binding protein LktB	5.20e-04	NA	1.35e-10	NA
7. B	Q5HQ70	Spermidine/putrescine import ATP-binding protein PotA	1.04e-04	NA	1.33e-13	NA
7. B	P57552	Multidrug resistance-like ATP-binding protein MdlB	6.77e-06	NA	5.73e-05	NA
7. B	Q831L8	Teichoic acids export ATP-binding protein TagH	2.52e-02	NA	2.34e-06	NA
7. B	Q2KCV5	Phosphate import ATP-binding protein PstB	9.02e-06	NA	1.21e-10	NA
7. B	Q1QSE9	Phosphate import ATP-binding protein PstB 2	1.59e-06	NA	3.31e-09	NA
7. B	P23703	Nod factor export ATP-binding protein I	1.35e-03	NA	0.001	NA
7. B	Q0SZJ3	Nickel import ATP-binding protein NikE	1.61e-07	NA	5.90e-22	NA
7. B	Q3YUV0	Maltose/maltodextrin import ATP-binding protein MalK	7.58e-04	NA	1.84e-13	NA
7. B	Q9ZR72	ABC transporter B family member 1	1.76e-02	NA	5.43e-09	NA
7. B	Q9KZW2	Phosphate import ATP-binding protein PstB	1.33e-03	NA	3.09e-08	NA
7. B	Q03PF2	Spermidine/putrescine import ATP-binding protein PotA	1.93e-04	NA	2.67e-17	NA
7. B	P0AAI1	Aliphatic sulfonates import ATP-binding protein SsuB	1.55e-04	NA	5.12e-13	NA
7. B	Q5PJX5	Ribose import ATP-binding protein RbsA	1.90e-04	NA	2.81e-07	NA
7. B	Q5HDY7	Energy-coupling factor transporter ATP-binding protein EcfA2	9.34e-05	NA	5.13e-13	NA
7. B	P37313	Dipeptide transport ATP-binding protein DppF	2.61e-09	NA	7.32e-43	NA
7. B	P32010	Daunorubicin/doxorubicin resistance ATP-binding protein DrrA	4.73e-04	NA	0.001	NA
7. B	Q3Z2S7	Arabinose import ATP-binding protein AraG	3.32e-04	NA	0.004	NA
7. B	Q9DC29	ATP-binding cassette sub-family B member 6	2.51e-04	NA	5.07e-06	NA
7. B	Q0SXV5	Phosphonates import ATP-binding protein PhnC	3.61e-09	NA	3.35e-07	NA
7. B	A1WXT0	Zinc import ATP-binding protein ZnuC	1.71e-04	NA	7.10e-08	NA
7. B	Q5FM17	Phosphate import ATP-binding protein PstB 2	1.76e-06	NA	7.36e-16	NA
7. B	Q9KLL9	Molybdenum import ATP-binding protein ModC	1.50e-03	NA	7.11e-12	NA
7. B	Q0K4I1	Phosphonates import ATP-binding protein PhnC 1	7.78e-05	NA	3.38e-07	NA
7. B	Q9AT00	Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic	6.55e-05	NA	1.43e-06	NA
7. B	P0DKX5	Cyclolysin secretion/processing ATP-binding protein CyaB	5.40e-04	NA	7.00e-09	NA
7. B	Q87UI3	Aliphatic sulfonates import ATP-binding protein SsuB 3	3.02e-04	NA	3.50e-16	NA
7. B	Q63NR0	Hemin import ATP-binding protein HmuV	3.95e-04	NA	1.32e-04	NA
7. B	Q2K2X0	Molybdenum import ATP-binding protein ModC	1.94e-03	NA	3.74e-10	NA
7. B	Q8D385	Zinc import ATP-binding protein ZnuC	1.27e-07	NA	4.67e-07	NA
7. B	P54719	Uncharacterized ABC transporter ATP-binding protein YfiC	5.69e-05	NA	9.05e-05	NA
7. B	P32386	ATP-dependent bile acid permease	4.70e-02	NA	5.10e-04	NA
7. B	Q0T6A8	Aliphatic sulfonates import ATP-binding protein SsuB	1.28e-04	NA	2.20e-13	NA
7. B	Q88HL0	Nickel import ATP-binding protein NikE	1.13e-07	NA	3.57e-16	NA
7. B	P43535	Protein GCN20	1.03e-04	NA	9.52e-06	NA
7. B	Q8Z9T1	Phosphate import ATP-binding protein PstB 2	3.56e-11	NA	7.33e-12	NA
7. B	P48243	Glutamate transport ATP-binding protein GluA	8.92e-07	NA	1.31e-17	NA
7. B	Q39E73	ATP-dependent lipid A-core flippase	4.27e-04	NA	1.04e-05	NA
7. B	Q1JGY7	Spermidine/putrescine import ATP-binding protein PotA	1.93e-04	NA	1.64e-16	NA
7. B	Q2KAW9	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	4.47e-05	NA	0.020	NA
7. B	Q6HI76	Putative ABC transporter ATP-binding protein BT9727_2424	9.72e-05	NA	2.55e-10	NA
7. B	Q7VCZ3	Phosphate import ATP-binding protein PstB	1.65e-03	NA	5.58e-08	NA
7. B	Q0I2Z4	Fe(3+) ions import ATP-binding protein FbpC	1.31e-04	NA	6.35e-15	NA
7. B	Q9FWX7	ABC transporter B family member 11	4.68e-03	NA	4.93e-10	NA
7. B	Q2SZC2	Arabinose import ATP-binding protein AraG 1	4.30e-05	NA	0.020	NA
7. B	Q72D46	Phosphate import ATP-binding protein PstB	1.10e-03	NA	7.09e-09	NA
7. B	Q1LNM0	Aliphatic sulfonates import ATP-binding protein SsuB	8.16e-04	NA	4.50e-13	NA
7. B	Q6CX96	Iron-sulfur clusters transporter ATM1, mitochondrial	4.68e-04	NA	0.001	NA
7. B	Q6KHL2	Energy-coupling factor transporter ATP-binding protein EcfA2	9.44e-05	NA	1.18e-08	NA
7. B	Q322L1	Arabinose import ATP-binding protein AraG	3.18e-04	NA	0.004	NA
7. B	Q9HYF9	Aliphatic sulfonates import ATP-binding protein SsuB 2	5.78e-04	NA	1.21e-08	NA
7. B	Q48C94	Taurine import ATP-binding protein TauB	1.96e-04	NA	2.75e-08	NA
7. B	Q1RFH8	Taurine import ATP-binding protein TauB	2.26e-04	NA	3.19e-11	NA
7. B	Q58903	Uncharacterized ABC transporter ATP-binding protein MJ1508	4.27e-06	NA	1.63e-14	NA
7. B	Q6D0F3	Thiamine import ATP-binding protein ThiQ	1.98e-05	NA	4.64e-10	NA
7. B	Q9KP42	Thiamine import ATP-binding protein ThiQ	7.16e-05	NA	2.99e-10	NA
7. B	Q1CNR8	Maltose/maltodextrin import ATP-binding protein MalK	2.56e-03	NA	6.75e-14	NA
7. B	Q6N6K5	Aliphatic sulfonates import ATP-binding protein SsuB	2.86e-04	NA	9.76e-11	NA
7. B	Q63P06	Ribose import ATP-binding protein RbsA	1.21e-03	NA	0.005	NA
7. B	Q1C951	Molybdenum import ATP-binding protein ModC	1.31e-03	NA	7.46e-09	NA
7. B	Q6MMH0	Phosphate import ATP-binding protein PstB	4.39e-05	NA	2.30e-11	NA
7. B	P30769	Probable ribonucleotide transport ATP-binding protein mkl	8.58e-05	NA	2.79e-12	NA
7. B	Q8G0T8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.58e-06	NA	7.73e-06	NA
7. B	Q48J29	Molybdenum import ATP-binding protein ModC	1.08e-03	NA	2.72e-13	NA
7. B	P23212	Erythromycin resistance ATP-binding protein MsrA	2.94e-04	NA	0.003	NA
7. B	O52618	Nod factor export ATP-binding protein I	1.26e-03	NA	0.001	NA
7. B	Q6DB03	Xylose import ATP-binding protein XylG	1.48e-03	NA	5.06e-05	NA
7. B	Q2KBP5	Biotin transport ATP-binding protein BioM	1.28e-04	NA	0.003	NA
7. B	Q65HC0	Phosphate import ATP-binding protein PstB 1	1.06e-03	NA	7.22e-09	NA
7. B	Q07LQ4	Aliphatic sulfonates import ATP-binding protein SsuB	1.82e-04	NA	4.63e-12	NA
7. B	P9WQL7	Fluoroquinolones export ATP-binding protein Rv2688c	2.43e-04	NA	1.62e-04	NA
7. B	Q88RL1	Zinc import ATP-binding protein ZnuC	2.23e-04	NA	8.96e-10	NA
7. B	Q57243	Uncharacterized ABC transporter ATP-binding protein HI_1272	4.01e-04	NA	1.87e-06	NA
7. B	Q6AM16	Phosphate import ATP-binding protein PstB	2.33e-06	NA	4.31e-11	NA
7. B	Q9HPH7	Putative ABC transporter ATP-binding protein VNG_1631G	2.34e-05	NA	7.46e-06	NA
7. B	P0CL92	Iron-sulfur clusters transporter ATM1, mitochondrial	4.37e-04	NA	1.20e-05	NA
7. B	Q8YJ04	Thiamine import ATP-binding protein ThiQ	1.52e-05	NA	2.22e-06	NA
7. B	Q9NUQ8	ATP-binding cassette sub-family F member 3	2.49e-04	NA	6.22e-06	NA
7. B	Q98DT6	Aliphatic sulfonates import ATP-binding protein SsuB 1	2.23e-04	NA	1.30e-10	NA
7. B	F2PRR1	ABC multidrug transporter MDR2	1.76e-03	NA	3.22e-08	NA
7. B	P46341	Phosphate import ATP-binding protein PstB 2	2.44e-06	NA	7.33e-12	NA
7. B	Q0TNZ3	Spermidine/putrescine import ATP-binding protein PotA	1.32e-04	NA	1.36e-14	NA
7. B	A1USS5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	9.41e-06	NA	8.92e-06	NA
7. B	O30144	Molybdate/tungstate import ATP-binding protein WtpC	1.31e-05	NA	1.25e-16	NA
7. B	Q3J3V9	Ribose import ATP-binding protein RbsA	3.54e-03	NA	1.72e-04	NA
7. B	A0R4C0	Phosphate import ATP-binding protein PstB	1.10e-03	NA	0.009	NA
7. B	Q87SV4	Thiamine import ATP-binding protein ThiQ	3.19e-06	NA	4.41e-11	NA
7. B	Q7W1F4	Molybdenum import ATP-binding protein ModC	1.73e-03	NA	7.97e-13	NA
7. B	P24693	Lipopolysaccharide export system ATP-binding protein LptB	7.71e-06	NA	1.31e-06	NA
7. B	Q6LKD4	Fe(3+) ions import ATP-binding protein FbpC	2.89e-05	NA	3.44e-14	NA
7. B	Q8K448	Cholesterol transporter ABCA5	2.27e-02	NA	3.78e-04	NA
7. B	Q8ZDX6	Vitamin B12 import ATP-binding protein BtuD	6.39e-04	NA	0.033	NA
7. B	Q8PSR0	Putative ABC transporter ATP-binding protein MM_3016	6.35e-04	NA	3.21e-08	NA
7. B	P0A4W5	Uncharacterized ABC transporter ATP-binding protein Mb1304c	2.83e-06	NA	4.70e-05	NA
7. B	O28912	Phosphate import ATP-binding protein PstB	1.19e-03	NA	5.96e-11	NA
7. B	Q8U242	Phosphate import ATP-binding protein PstB	6.74e-04	NA	9.85e-13	NA
7. B	Q31DV4	Phosphonates import ATP-binding protein PhnC	2.83e-05	NA	2.11e-12	NA
7. B	P0C529	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.41e-06	NA	4.34e-06	NA
7. B	Q83J33	Xylose import ATP-binding protein XylG	8.25e-04	NA	5.01e-05	NA
7. B	P33897	ATP-binding cassette sub-family D member 1	4.39e-03	NA	0.015	NA
7. B	P27675	Glutamine transport ATP-binding protein GlnQ	2.11e-06	NA	9.43e-19	NA
7. B	Q1GFI8	Lipoprotein-releasing system ATP-binding protein LolD	2.64e-03	NA	1.24e-06	NA
7. B	Q6HG98	Putative ABC transporter ATP-binding protein BT9727_3105	4.63e-04	NA	8.93e-10	NA
7. B	Q0WER5	Arabinose import ATP-binding protein AraG	1.73e-04	NA	0.004	NA
7. B	Q66H39	ATP-binding cassette sub-family F member 3	2.67e-04	NA	5.28e-06	NA
7. B	Q1CR30	Methionine import ATP-binding protein MetN	5.87e-06	NA	9.93e-23	NA
7. B	Q1MLW4	Phosphate import ATP-binding protein PstB 1	8.38e-06	NA	1.07e-10	NA
7. B	Q83P97	Phosphonates import ATP-binding protein PhnC	8.53e-06	NA	3.35e-07	NA
7. B	Q8G847	Fructose import ATP-binding protein FruK	8.30e-05	NA	3.73e-04	NA
7. B	Q87HN4	Molybdenum import ATP-binding protein ModC	1.58e-03	NA	2.90e-11	NA
7. B	Q55281	Manganese transport system ATP-binding protein MntA	6.16e-04	NA	6.88e-06	NA
7. B	P16532	Leukotoxin translocation ATP-binding protein LktB	4.40e-04	NA	1.45e-10	NA
7. B	Q3K506	Aliphatic sulfonates import ATP-binding protein SsuB	3.26e-04	NA	2.10e-14	NA
7. B	Q93FH3	Leukotoxin translocation ATP-binding protein LktB	6.56e-04	NA	1.45e-10	NA
7. B	Q5PJL1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.59e-04	NA	9.97e-11	NA
7. B	Q2FTF8	Phosphate import ATP-binding protein PstB	2.12e-06	NA	3.97e-13	NA
7. B	Q9FKF2	ABC transporter A family member 11	2.09e-03	NA	2.65e-04	NA
7. B	Q13ZJ1	Nod factor export ATP-binding protein I	1.65e-04	NA	0.001	NA
7. B	Q9YGA6	Trehalose/maltose import ATP-binding protein MalK	4.30e-04	NA	1.23e-19	NA
7. B	Q8E9I8	Phosphate import ATP-binding protein PstB 2	1.05e-06	NA	3.96e-12	NA
7. B	Q48IB9	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.82e-04	NA	1.65e-10	NA
7. B	A1U776	Zinc import ATP-binding protein ZnuC	8.88e-04	NA	1.17e-06	NA
7. B	O32188	Probable siderophore transport system ATP-binding protein YusV	1.63e-04	NA	2.43e-10	NA
7. B	P45094	Dipeptide transport ATP-binding protein DppF	2.97e-09	NA	6.68e-43	NA
7. B	Q82HA2	Putative ABC transporter ATP-binding protein SAV_3608	3.93e-06	NA	5.66e-09	NA
7. B	Q7NNG3	Phosphate import ATP-binding protein PstB 2	1.50e-06	NA	2.60e-06	NA
7. B	Q9ZUU9	ABC transporter G family member 3	5.81e-03	NA	2.53e-05	NA
7. B	P0A9X3	Zinc import ATP-binding protein ZnuC	4.12e-06	NA	2.78e-09	NA
7. B	A0A0D1BUH6	ABC-type transporter atr1	3.65e-04	NA	1.66e-08	NA
7. B	Q1R4L0	Phosphate import ATP-binding protein PstB	2.09e-11	NA	1.02e-11	NA
7. B	Q72RM8	UvrABC system protein A	2.81e-02	NA	0.025	NA
7. B	Q8D0W8	Sulfate/thiosulfate import ATP-binding protein CysA	7.04e-04	NA	2.06e-16	NA
7. B	Q5XBY7	Phosphate import ATP-binding protein PstB 1	1.92e-06	NA	1.55e-07	NA
7. B	Q8RFN2	Methionine import ATP-binding protein MetN	1.24e-05	NA	1.41e-20	NA
7. B	Q52815	General L-amino acid transport ATP-binding protein AapP	1.25e-06	NA	3.19e-18	NA
7. B	Q0T8D1	Thiamine import ATP-binding protein ThiQ	1.54e-05	NA	5.93e-12	NA
7. B	Q8PY27	Putative ABC transporter ATP-binding protein MM_1037	9.45e-05	NA	4.49e-06	NA
7. B	Q66AT7	Zinc import ATP-binding protein ZnuC	9.96e-04	NA	2.30e-08	NA
7. B	Q166I9	Cytochrome c biogenesis ATP-binding export protein CcmA	3.94e-03	NA	0.013	NA
7. B	Q2YKX3	Fe(3+) ions import ATP-binding protein FbpC	1.74e-04	NA	5.28e-14	NA
7. B	Q2JPW6	Phosphonates import ATP-binding protein PhnC 1	5.72e-05	NA	9.27e-15	NA
7. B	Q4WD46	ABC-type transporter fsqE	3.70e-03	NA	6.07e-09	NA
7. B	Q3B3H7	Phosphate import ATP-binding protein PstB	3.11e-06	NA	4.97e-10	NA
7. B	Q1C812	Zinc import ATP-binding protein ZnuC	8.20e-04	NA	2.41e-08	NA
7. B	Q9CP98	Ribose import ATP-binding protein RbsA 1	2.61e-03	NA	2.10e-07	NA
7. B	P0CZ29	Energy-coupling factor transporter ATP-binding protein EcfA1	7.91e-05	NA	8.90e-13	NA
7. B	Q1JBJ4	Phosphate import ATP-binding protein PstB 2	3.35e-06	NA	9.53e-10	NA
7. B	Q3KJ31	ATP-dependent lipid A-core flippase	1.41e-05	NA	4.69e-06	NA
7. B	Q6Y306	ATP-binding cassette sub-family C member 12	1.19e-02	NA	0.005	NA
7. B	Q6GEL4	Energy-coupling factor transporter ATP-binding protein EcfA2	9.82e-05	NA	1.37e-13	NA
7. B	Q8D9J4	Spermidine/putrescine import ATP-binding protein PotA	6.54e-05	NA	1.28e-16	NA
7. B	Q5RKI8	Mitochondrial potassium channel ATP-binding subunit	2.23e-03	NA	1.15e-06	NA
7. B	Q8ELR4	Spermidine/putrescine import ATP-binding protein PotA	2.03e-04	NA	1.22e-15	NA
7. B	Q0B7X0	Ribose import ATP-binding protein RbsA 2	3.61e-05	NA	0.003	NA
7. B	Q8XXY9	Nod factor export ATP-binding protein I	9.16e-05	NA	6.41e-04	NA
7. B	P0C0E3	Lantibiotic transport ATP-binding protein SrtF	6.06e-05	NA	1.64e-07	NA
7. B	Q2FH57	Nickel import system ATP-binding protein NikD	4.39e-04	NA	2.91e-14	NA
7. B	Q4FS42	ATP-dependent lipid A-core flippase	3.76e-06	NA	4.52e-08	NA
7. B	Q0HHH4	ATP-dependent lipid A-core flippase	6.24e-06	NA	4.89e-07	NA
7. B	Q9M0G9	ABC transporter B family member 24, mitochondrial	4.94e-04	NA	7.57e-08	NA
7. B	Q2K6Q4	Zinc import ATP-binding protein ZnuC	2.40e-03	NA	1.25e-05	NA
7. B	Q8YYE2	Phosphate import ATP-binding protein PstB 2	2.23e-06	NA	7.50e-09	NA
7. B	Q5SLN1	Phosphate import ATP-binding protein PstB	1.17e-03	NA	2.01e-11	NA
7. B	Q1GH74	Phosphate import ATP-binding protein PstB	2.45e-06	NA	9.38e-11	NA
7. B	Q3IS07	Phosphate import ATP-binding protein PstB 1	3.74e-06	NA	7.60e-09	NA
7. B	Q2LY16	Cobalt import ATP-binding protein CbiO	6.84e-05	NA	2.28e-10	NA
7. B	Q0VTB6	Zinc import ATP-binding protein ZnuC	2.69e-04	NA	2.23e-09	NA
7. B	Q1IKM7	Lipoprotein-releasing system ATP-binding protein LolD	3.37e-05	NA	1.29e-12	NA
7. B	Q28NZ8	Cytochrome c biogenesis ATP-binding export protein CcmA	2.58e-03	NA	0.004	NA
7. B	Q7NX01	Sulfate/thiosulfate import ATP-binding protein CysA 1	6.10e-04	NA	1.50e-13	NA
7. B	Q57CD8	Putative ABC transporter ATP-binding protein BruAb1_1365	6.82e-05	NA	7.73e-06	NA
7. B	Q7V7P0	Phosphate import ATP-binding protein PstB	4.26e-06	NA	1.97e-05	NA
7. B	A3CMQ7	Spermidine/putrescine import ATP-binding protein PotA	1.44e-04	NA	9.82e-16	NA
7. B	Q1CJS9	Fe(3+) ions import ATP-binding protein FbpC	1.06e-04	NA	2.02e-15	NA
7. B	Q895Y0	Phosphate import ATP-binding protein PstB	1.53e-06	NA	1.08e-09	NA
7. B	P0CZ34	Spermidine/putrescine import ATP-binding protein PotA	1.98e-04	NA	2.38e-16	NA
7. B	Q06034	Multidrug resistance protein 1	2.28e-03	NA	2.71e-07	NA
7. B	G5EE72	Multidrug resistance-associated protein 5	7.79e-03	NA	1.62e-04	NA
7. B	Q1BWI2	Nod factor export ATP-binding protein I	6.82e-04	NA	0.001	NA
7. B	Q8A1M1	Lipoprotein-releasing system ATP-binding protein LolD	2.60e-05	NA	1.08e-09	NA
7. B	P23596	Proteases secretion ATP-binding protein PrtD	4.25e-04	NA	0.008	NA
7. B	Q8K268	ATP-binding cassette sub-family F member 3	2.40e-04	NA	4.30e-06	NA
7. B	Q09427	ATP-binding cassette sub-family C member 8	6.52e-02	NA	9.70e-05	NA
7. B	Q7VUJ5	Molybdenum import ATP-binding protein ModC	1.69e-03	NA	8.12e-13	NA
7. B	Q28QF9	Hemin import ATP-binding protein HmuV	4.49e-04	NA	2.74e-05	NA
7. B	P77279	Probable iron export ATP-binding protein FetA	1.40e-04	NA	2.90e-04	NA
7. B	P14175	Glycine betaine/proline betaine transport system ATP-binding protein ProV	2.90e-04	NA	9.97e-19	NA
7. B	Q38YC2	Phosphate import ATP-binding protein PstB 1	2.45e-06	NA	1.79e-09	NA
7. B	Q0SY86	Xylose import ATP-binding protein XylG	2.33e-04	NA	5.28e-05	NA
7. B	P0AAG9	Galactose/methyl galactoside import ATP-binding protein MglA	2.88e-04	NA	1.45e-04	NA
7. B	O07550	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI	3.12e-05	NA	2.04e-05	NA
7. B	Q49XI8	Phosphate import ATP-binding protein PstB	2.92e-06	NA	7.13e-09	NA
7. B	Q81P94	Aliphatic sulfonates import ATP-binding protein SsuB	1.43e-04	NA	6.46e-12	NA
7. B	Q3SQ65	Hemin import ATP-binding protein HmuV	4.47e-04	NA	1.24e-04	NA
7. B	Q1RGD0	Thiamine import ATP-binding protein ThiQ	3.44e-05	NA	2.79e-12	NA
7. B	Q13DS7	Cytochrome c biogenesis ATP-binding export protein CcmA	2.23e-03	NA	0.004	NA
7. B	P0A2V9	Phosphate import ATP-binding protein PstB 3	1.64e-06	NA	1.60e-10	NA
7. B	Q7WGW1	Sulfate/thiosulfate import ATP-binding protein CysA	5.83e-04	NA	5.16e-15	NA
7. B	Q3YW77	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.01e-03	NA	9.97e-11	NA
7. B	Q38YC1	Phosphate import ATP-binding protein PstB 2	1.12e-03	NA	2.48e-12	NA
7. B	Q662E6	Phosphate import ATP-binding protein PstB	2.00e-06	NA	1.16e-09	NA
7. B	Q98G43	Fe(3+) ions import ATP-binding protein FbpC	4.72e-04	NA	1.09e-14	NA
7. B	Q8NMK1	Phosphate import ATP-binding protein PstB	1.08e-03	NA	0.002	NA
7. B	P33593	Nickel import ATP-binding protein NikD	2.57e-06	NA	2.10e-18	NA
7. B	Q8YM92	Spermidine/putrescine import ATP-binding protein PotA	4.18e-04	NA	4.92e-17	NA
7. B	Q32IG0	Molybdenum import ATP-binding protein ModC	1.48e-03	NA	5.49e-05	NA
7. B	Q834B3	Phosphate import ATP-binding protein PstB 2	1.41e-03	NA	1.75e-10	NA
7. B	Q5NN23	Aliphatic sulfonates import ATP-binding protein SsuB	9.10e-05	NA	2.21e-13	NA
7. B	Q5FA19	Fe(3+) ions import ATP-binding protein FbpC	4.12e-04	NA	6.05e-16	NA
7. B	Q31I88	Phosphate import ATP-binding protein PstB	4.44e-06	NA	9.88e-12	NA
7. B	Q6G475	Hemin import ATP-binding protein HmuV	1.15e-03	NA	1.12e-05	NA
7. B	Q0B5V4	Arabinose import ATP-binding protein AraG 2	3.59e-04	NA	0.001	NA
7. B	P44656	Uncharacterized ABC transporter ATP-binding protein HI_0354	6.45e-04	NA	1.03e-06	NA
7. B	A1UG51	Spermidine/putrescine import ATP-binding protein PotA	3.71e-04	NA	1.11e-16	NA
7. B	Q93DX8	Sulfate/thiosulfate import ATP-binding protein CysA (Fragment)	1.10e-04	NA	1.40e-17	NA
7. B	Q58967	Putative ABC transporter ATP-binding protein MJ1572	2.36e-04	NA	2.83e-12	NA
7. B	Q72PP0	Lipoprotein-releasing system ATP-binding protein LolD	2.52e-05	NA	7.10e-11	NA
7. B	Q74L62	Energy-coupling factor transporter ATP-binding protein EcfA1	1.38e-04	NA	3.33e-09	NA
7. B	P45861	Uncharacterized ABC transporter ATP-binding protein YwjA	5.74e-05	NA	3.55e-05	NA
7. B	Q12298	Uncharacterized ABC transporter ATP-binding protein YDR061W	1.68e-03	NA	0.010	NA
7. B	Q0VL18	Phosphate import ATP-binding protein PstB	7.36e-05	NA	3.94e-10	NA
7. B	B2RX12	ATP-binding cassette sub-family C member 3	1.35e-02	NA	0.012	NA
7. B	P63392	Mycobactin import ATP-binding/permease protein IrtA	2.31e-04	NA	0.019	NA
7. B	Q5PDU4	Cobalt import ATP-binding protein CbiO	3.74e-05	NA	5.60e-06	NA
7. B	Q6WB51	Phosphate import ATP-binding protein PstB	5.65e-05	NA	5.03e-10	NA
7. B	O15440	ATP-binding cassette sub-family C member 5	1.65e-02	NA	6.04e-05	NA
7. B	Q6F1N1	Phosphate import ATP-binding protein PstB	1.40e-03	NA	5.06e-10	NA
7. B	Q1JGL3	Phosphate import ATP-binding protein PstB 1	1.50e-06	NA	1.70e-07	NA
7. B	O29527	Putative ABC transporter ATP-binding protein AF_0731	1.38e-04	NA	0.004	NA
7. B	Q254K9	Methionine import ATP-binding protein MetN	2.32e-05	NA	3.65e-11	NA
7. B	O15438	ATP-binding cassette sub-family C member 3	6.59e-03	NA	0.010	NA
7. B	A0KE71	Aliphatic sulfonates import ATP-binding protein SsuB 2	5.02e-04	NA	5.23e-07	NA
7. B	Q13FD9	Putative ribose/galactose/methyl galactoside import ATP-binding protein	2.20e-03	NA	0.003	NA
7. B	P19566	Maltose/maltodextrin import ATP-binding protein MalK	3.28e-03	NA	6.81e-14	NA
7. B	P63361	Phosphate import ATP-binding protein PstB	5.52e-06	NA	7.68e-11	NA
7. B	Q83LN2	Aliphatic sulfonates import ATP-binding protein SsuB	1.33e-04	NA	2.22e-13	NA
7. B	Q2K342	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.06e-06	NA	1.19e-06	NA
7. B	Q97JB8	Putative ABC transporter ATP-binding protein CA_C1368	7.68e-06	NA	2.76e-13	NA
7. B	Q9S472	L-arabinose transport ATP-binding protein AraG	5.33e-05	NA	0.010	NA
7. B	A0B3E2	Hemin import ATP-binding protein HmuV	4.11e-04	NA	0.005	NA
7. B	Q5MB13	Broad substrate specificity ATP-binding cassette transporter ABCG2	1.67e-02	NA	0.004	NA
7. B	Q54BU4	ABC transporter B family member 1	1.31e-03	NA	7.74e-07	NA
7. B	Q8Z2R4	Ribose import ATP-binding protein RbsA	1.28e-04	NA	2.67e-07	NA
7. B	P47545	Putative ABC transporter ATP-binding protein MG303	1.72e-04	NA	9.13e-07	NA
7. B	Q3JHM1	Hemin import ATP-binding protein HmuV	4.09e-04	NA	1.32e-04	NA
7. B	Q0RYP7	Fe(3+) ions import ATP-binding protein FbpC 3	5.11e-04	NA	6.11e-15	NA
7. B	Q0D9V6	Protein STAR1	6.45e-06	NA	2.11e-09	NA
7. B	A0A125QXJ1	ATP-binding cassette sub-family B member 6	2.70e-04	NA	4.12e-06	NA
7. B	P63360	ATP-dependent lipid A-core flippase	2.97e-04	NA	1.81e-07	NA
7. B	Q9FLT4	ABC transporter A family member 10	1.58e-03	NA	7.96e-05	NA
7. B	Q9A1G5	Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242	4.46e-04	NA	0.009	NA
7. B	Q6WB63	Phosphonates import ATP-binding protein PhnC	8.29e-05	NA	1.97e-15	NA
7. B	P07821	Iron(3+)-hydroxamate import ATP-binding protein FhuC	1.15e-04	NA	2.04e-07	NA
7. B	Q2JUA1	Phosphate import ATP-binding protein PstB 1	1.55e-03	NA	9.32e-06	NA
7. B	Q2SNX4	Phosphate import ATP-binding protein PstB	1.55e-03	NA	9.03e-12	NA
7. B	Q4QK57	Spermidine/putrescine import ATP-binding protein PotA	6.20e-05	NA	5.77e-17	NA
7. B	Q8TSA8	Phosphate import ATP-binding protein PstB	1.04e-03	NA	1.30e-09	NA
7. B	Q65E84	Teichoic acids export ATP-binding protein TagH	6.90e-03	NA	3.93e-05	NA
7. B	Q81PZ8	Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461	8.85e-05	NA	1.35e-10	NA
7. B	Q1CN15	Autoinducer 2 import ATP-binding protein LsrA	2.03e-04	NA	6.26e-07	NA
7. B	Q2J1U0	Molybdenum import ATP-binding protein ModC	5.90e-03	NA	1.18e-12	NA
7. B	Q1BG93	Xylose import ATP-binding protein XylG	8.95e-05	NA	0.002	NA
7. B	Q1CJG3	Zinc import ATP-binding protein ZnuC	8.67e-04	NA	2.41e-08	NA
7. B	Q4A5A5	Energy-coupling factor transporter ATP-binding protein EcfA1	2.67e-04	NA	2.29e-11	NA
7. B	P77268	Probable D,D-dipeptide transport ATP-binding protein DdpD	8.35e-08	NA	2.04e-22	NA
7. B	A0PY57	Spermidine/putrescine import ATP-binding protein PotA	8.34e-05	NA	7.88e-17	NA
7. B	Q04473	Toxin RTX-III translocation ATP-binding protein	7.71e-04	NA	7.11e-10	NA
7. B	Q8ZGX6	Molybdenum import ATP-binding protein ModC	1.43e-03	NA	7.46e-09	NA
7. B	Q664P8	Taurine import ATP-binding protein TauB	2.10e-04	NA	5.08e-09	NA
7. B	Q6G868	Putative multidrug export ATP-binding/permease protein SAS1788	1.25e-05	NA	2.24e-07	NA
7. B	Q32AY3	Hemin import ATP-binding protein HmuV	5.74e-04	NA	5.95e-07	NA
7. B	Q1R155	Zinc import ATP-binding protein ZnuC	4.53e-06	NA	1.09e-05	NA
7. B	Q1CIX6	Arabinose import ATP-binding protein AraG	4.78e-05	NA	0.004	NA
7. B	O51236	Phosphate import ATP-binding protein PstB	1.33e-06	NA	3.38e-10	NA
7. B	D4GSY7	Probable anion import ATP-binding protein HVO_1886	2.93e-04	NA	4.52e-09	NA
7. B	A2RI78	Dipeptide transport ATP-binding protein DppF	1.01e-11	NA	8.04e-72	NA
7. B	Q8Y454	Energy-coupling factor transporter ATP-binding protein EcfA1	3.14e-04	NA	2.66e-12	NA
7. B	Q86UK0	Glucosylceramide transporter ABCA12	6.49e-02	NA	0.006	NA
7. B	Q13BH6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.04e-04	NA	5.39e-07	NA
7. B	Q1B3B4	Phosphate import ATP-binding protein PstB	1.09e-03	NA	0.021	NA
7. B	Q8ESM5	Phosphonates import ATP-binding protein PhnC 1	6.34e-06	NA	5.00e-11	NA
7. B	Q8YDJ8	Zinc import ATP-binding protein ZnuC	2.43e-03	NA	3.66e-10	NA
7. B	Q8RHK9	Energy-coupling factor transporter ATP-binding protein EcfA2	3.95e-05	NA	1.48e-12	NA
7. B	Q933E0	Leukotoxin translocation ATP-binding protein LktB	6.48e-04	NA	1.61e-10	NA
7. B	Q5P4W2	Molybdenum import ATP-binding protein ModC	2.31e-03	NA	2.23e-10	NA
7. B	P44785	Methionine import ATP-binding protein MetN	NA	NA	3.80e-18	NA
7. B	Q57855	Uncharacterized ABC transporter ATP-binding protein MJ0412	1.39e-04	NA	4.00e-10	NA
7. B	Q5KYS1	Xylose import ATP-binding protein XylG	1.24e-04	NA	1.27e-04	NA
7. B	Q222W0	Phosphonates import ATP-binding protein PhnC 1	2.71e-06	NA	6.43e-08	NA
7. B	Q4WLN7	Iron-sulfur clusters transporter atm1, mitochondrial	1.26e-03	NA	1.21e-06	NA
7. B	Q8REE1	Galactose/methyl galactoside import ATP-binding protein MglA	3.29e-05	NA	2.17e-05	NA
7. B	Q9X1Z1	Energy-coupling factor transporter ATP-binding protein EcfA1	5.48e-04	NA	8.16e-05	NA
7. B	Q8X8K4	Uncharacterized ABC transporter ATP-binding protein YcjV	1.76e-04	NA	8.77e-12	NA
7. B	Q16BC5	Phosphonates import ATP-binding protein PhnC 1	7.72e-06	NA	1.71e-13	NA
7. B	Q99X73	Phosphonates import ATP-binding protein PhnC	3.52e-06	NA	4.20e-09	NA
7. B	Q5RFQ9	Mitochondrial potassium channel ATP-binding subunit	3.79e-05	NA	9.59e-07	NA
7. B	Q31J97	Hemin import ATP-binding protein HmuV	6.10e-04	NA	0.008	NA
7. B	P09833	Molybdenum import ATP-binding protein ModC	1.51e-03	NA	5.40e-05	NA
7. B	Q2YLW6	Thiamine import ATP-binding protein ThiQ	1.89e-05	NA	1.98e-06	NA
7. B	Q3J7R8	ATP-dependent lipid A-core flippase	2.52e-04	NA	4.63e-07	NA
7. B	Q03203	Nisin transport ATP-binding protein NisT	1.86e-05	NA	4.72e-04	NA
7. B	Q1WVI7	Spermidine/putrescine import ATP-binding protein PotA	7.41e-04	NA	1.35e-17	NA
7. B	Q74R28	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.64e-04	NA	1.16e-10	NA
7. B	Q9C8G9	ABC transporter C family member 1	4.88e-02	NA	0.011	NA
7. B	Q61285	ATP-binding cassette sub-family D member 2	6.50e-04	NA	0.020	NA
7. B	Q8D740	Molybdenum import ATP-binding protein ModC	1.40e-03	NA	1.38e-13	NA
7. B	Q93FH2	Leukotoxin translocation ATP-binding protein LktB	1.14e-03	NA	1.45e-10	NA
7. B	Q7UX73	Lipoprotein-releasing system ATP-binding protein LolD 1	5.05e-04	NA	7.63e-12	NA
7. B	Q92L31	Thiamine import ATP-binding protein ThiQ	8.95e-05	NA	1.89e-08	NA
7. B	Q5H0H0	ATP-dependent lipid A-core flippase	3.32e-04	NA	5.67e-08	NA
7. B	P72477	Putative ABC transporter ATP-binding protein	4.46e-04	NA	0.007	NA
7. B	Q66EN1	Thiamine import ATP-binding protein ThiQ	2.24e-05	NA	1.92e-10	NA
7. B	O30506	Arginine/ornithine transport ATP-binding protein AotP	9.86e-06	NA	1.59e-09	NA
7. B	F2RP52	ABC multidrug transporter MDR2	8.56e-03	NA	3.22e-08	NA
7. B	Q3Z057	Galactose/methyl galactoside import ATP-binding protein MglA	1.28e-04	NA	1.45e-04	NA
7. B	Q5M243	Energy-coupling factor transporter ATP-binding protein EcfA1	2.61e-04	NA	4.24e-11	NA
7. B	Q8FMN9	Phosphate import ATP-binding protein PstB	1.17e-03	NA	3.61e-04	NA
7. B	Q50294	Energy-coupling factor transporter ATP-binding protein EcfA1	3.80e-05	NA	5.89e-08	NA
7. B	Q5WET8	Phosphate import ATP-binding protein PstB 1	1.33e-03	NA	5.44e-12	NA
7. B	Q9WY65	Energy-coupling factor transporter ATP-binding protein EcfA2	3.64e-06	NA	3.55e-08	NA
7. B	Q1GZH6	Lipoprotein-releasing system ATP-binding protein LolD	2.54e-05	NA	5.15e-09	NA
7. B	P50332	Nod factor export ATP-binding protein I	2.41e-04	NA	4.47e-04	NA
7. B	Q890D1	Nickel import ATP-binding protein LarO	2.44e-06	NA	6.86e-06	NA
7. B	Q6F9A8	Sulfate/thiosulfate import ATP-binding protein CysA	3.62e-04	NA	3.10e-16	NA
7. B	Q88HL1	Nickel import ATP-binding protein NikD	1.18e-06	NA	2.92e-15	NA
7. B	Q8TYV9	Putative ABC transporter ATP-binding protein MK0182	2.78e-05	NA	8.39e-06	NA
7. B	Q0HH38	Phosphate import ATP-binding protein PstB	2.49e-06	NA	3.42e-11	NA
7. B	Q3ATA4	Phosphate import ATP-binding protein PstB	1.73e-06	NA	1.28e-12	NA
7. B	Q92337	ATP-binding cassette transporter abc1	1.01e-02	NA	0.002	NA
7. B	Q217B2	Hemin import ATP-binding protein HmuV	8.32e-04	NA	0.007	NA
7. B	Q54RU1	ABC transporter B family member 6	1.74e-04	NA	6.38e-06	NA
7. B	Q21Y06	Phosphonates import ATP-binding protein PhnC 2	1.58e-04	NA	3.12e-07	NA
7. B	Q6CYU2	Aliphatic sulfonates import ATP-binding protein SsuB	2.93e-04	NA	5.13e-12	NA
7. B	P57403	Zinc import ATP-binding protein ZnuC	7.19e-04	NA	0.030	NA
7. B	Q9Y8G1	ABC multidrug transporter atrD	2.32e-03	NA	1.88e-07	NA
7. B	Q57R14	ATP-dependent lipid A-core flippase	2.93e-04	NA	1.81e-07	NA
7. B	Q46ZA5	Phosphate import ATP-binding protein PstB	3.01e-05	NA	5.94e-11	NA
7. B	Q2W1R8	Molybdenum import ATP-binding protein ModC	8.79e-04	NA	1.54e-11	NA
7. B	Q8UBY6	Thiamine import ATP-binding protein ThiQ	7.03e-06	NA	1.66e-08	NA
7. B	Q6FWS5	Pleiotropic ABC efflux transporter of multiple drugs YBT1	5.12e-02	NA	1.09e-05	NA
7. B	Q8DEW5	Phosphate import ATP-binding protein PstB 1	1.29e-03	NA	4.48e-09	NA
7. B	Q0PAB6	Methionine import ATP-binding protein MetN	1.40e-04	NA	1.41e-19	NA
7. B	Q7M9G3	Phosphate import ATP-binding protein PstB	1.47e-06	NA	9.55e-11	NA
7. B	Q52402	Transport ATP-binding protein AarD	1.07e-04	NA	0.001	NA
7. B	P70864	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.73e-06	NA	8.92e-06	NA
7. B	Q66C83	Galactose/methyl galactoside import ATP-binding protein MglA	1.17e-04	NA	2.28e-05	NA
7. B	P25371	Probable ATP-dependent permease	6.28e-02	NA	7.28e-04	NA
7. B	Q1C1S0	Aliphatic sulfonates import ATP-binding protein SsuB	2.33e-03	NA	2.73e-16	NA
7. B	P0AAF8	Arginine transport ATP-binding protein ArtP	2.72e-07	NA	4.88e-15	NA
7. B	Q81K31	Teichoic acids export ATP-binding protein TagH	5.92e-02	NA	0.001	NA
7. B	Q668K6	Sulfate/thiosulfate import ATP-binding protein CysA	3.44e-04	NA	3.26e-16	NA
7. B	Q8KLG1	Nod factor export ATP-binding protein I	6.93e-04	NA	1.11e-04	NA
7. B	Q8UBB7	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	1.89e-04	NA	8.21e-13	NA
7. B	Q65T42	Sulfate/thiosulfate import ATP-binding protein CysA	4.11e-04	NA	8.15e-18	NA
7. B	A6TEB8	Autoinducer 2 import ATP-binding protein LsrA	3.08e-03	NA	9.65e-05	NA
7. B	Q54NL1	ABC transporter C family member 9	2.86e-02	NA	6.68e-05	NA
7. B	Q21PQ7	Zinc import ATP-binding protein ZnuC	1.32e-03	NA	1.82e-10	NA
7. B	Q47L96	Phosphate import ATP-binding protein PstB	4.68e-06	NA	2.53e-08	NA
7. B	Q81LW6	Phosphate import ATP-binding protein PstB	1.86e-06	NA	2.89e-11	NA
7. B	P76909	Uncharacterized ABC transporter ATP-binding protein YnjD	3.11e-03	NA	1.20e-07	NA
7. B	Q8PVF6	Phosphate import ATP-binding protein PstB	1.83e-06	NA	6.81e-12	NA
7. B	Q8RD07	Putative ABC transporter ATP-binding protein TTE0246	4.23e-06	NA	1.19e-06	NA
7. B	Q0TC10	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.81e-04	NA	7.68e-11	NA
7. B	Q180A5	Phosphate import ATP-binding protein PstB	1.27e-06	NA	2.03e-11	NA
7. B	Q3MBW2	Phosphate import ATP-binding protein PstB 2	1.80e-03	NA	5.74e-07	NA
7. B	Q6NBX6	Phosphonates import ATP-binding protein PhnC 1	7.00e-06	NA	2.99e-11	NA
7. B	O06476	Uncharacterized ABC transporter ATP-binding protein YfmR	1.63e-04	NA	4.11e-04	NA
7. B	Q3ILC5	Phosphate import ATP-binding protein PstB	3.08e-06	NA	2.36e-10	NA
7. B	P37009	Fe(3+) ions import ATP-binding protein FbpC	8.74e-05	NA	1.45e-16	NA
7. B	Q839D5	Energy-coupling factor transporter ATP-binding protein EcfA1	7.30e-05	NA	2.18e-09	NA
7. B	B1IRU7	Autoinducer 2 import ATP-binding protein LsrA	9.20e-05	NA	1.82e-07	NA
7. B	Q74PI5	Aliphatic sulfonates import ATP-binding protein SsuB	2.23e-03	NA	2.73e-16	NA
7. B	Q0A9K1	Phosphate import ATP-binding protein PstB	1.40e-03	NA	2.19e-09	NA
7. B	Q8F435	UvrABC system protein A	2.65e-02	NA	0.025	NA
7. B	Q1QBW0	ATP-dependent lipid A-core flippase	1.22e-05	NA	3.38e-08	NA
7. B	Q9UBJ2	ATP-binding cassette sub-family D member 2	1.59e-03	NA	0.006	NA
7. B	Q5HG40	Nickel import system ATP-binding protein NikD	4.08e-04	NA	2.91e-14	NA
7. B	Q9C7F2	ABC transporter B family member 14	5.34e-03	NA	2.78e-10	NA
7. B	Q9LZB8	ABC transporter B family member 29, chloroplastic	7.38e-05	NA	1.62e-05	NA
7. B	Q3YW48	Nickel import ATP-binding protein NikE	1.28e-07	NA	1.50e-23	NA
7. B	Q93SS1	Hemin import ATP-binding protein HmuV	9.10e-05	NA	2.56e-05	NA
7. B	Q08381	Molybdenum import ATP-binding protein ModC	2.02e-02	NA	2.50e-09	NA
7. B	P75094	Putative ABC transporter ATP-binding protein MG015 homolog	1.92e-05	NA	0.002	NA
7. B	Q99PE8	ATP-binding cassette sub-family G member 5	4.94e-03	NA	2.30e-04	NA
7. B	Q3IWB5	Zinc import ATP-binding protein ZnuC	3.55e-07	NA	1.14e-08	NA
7. B	Q8TI15	Putative ABC transporter ATP-binding protein MA_4342	6.95e-05	NA	4.99e-09	NA
7. B	Q9JUX4	Sulfate/thiosulfate import ATP-binding protein CysA	4.08e-04	NA	1.40e-15	NA
7. B	Q896Y2	Galactose/methyl galactoside import ATP-binding protein MglA	1.14e-04	NA	2.12e-08	NA
7. B	P12866	Alpha-factor-transporting ATPase	2.04e-03	NA	3.46e-06	NA
7. B	Q9PJX9	Probable metal transport system ATP-binding protein TC_0697	1.48e-04	NA	1.03e-07	NA
7. B	Q2P3E7	ATP-dependent lipid A-core flippase	1.72e-04	NA	5.67e-08	NA
7. B	Q58488	Energy-coupling factor transporter ATP-binding protein EcfA	6.81e-05	NA	9.06e-13	NA
7. B	P18813	Maltose/maltodextrin import ATP-binding protein MalK (Fragment)	9.43e-05	NA	2.45e-08	NA
7. B	P44884	Galactose/methyl galactoside import ATP-binding protein MglA	5.31e-04	NA	6.11e-06	NA
7. B	Q0WJE4	Thiamine import ATP-binding protein ThiQ	2.09e-05	NA	1.85e-10	NA
7. B	Q1QR47	Cytochrome c biogenesis ATP-binding export protein CcmA	2.32e-03	NA	0.001	NA
7. B	P15031	Fe(3+) dicitrate transport ATP-binding protein FecE	2.74e-04	NA	1.27e-05	NA
7. B	Q93FH0	Leukotoxin translocation ATP-binding protein LktB	5.04e-04	NA	1.62e-10	NA
7. B	Q0K1N8	Phosphonates import ATP-binding protein PhnC 2	4.66e-09	NA	3.31e-05	NA
7. B	Q6G194	sn-glycerol-3-phosphate import ATP-binding protein UgpC	5.63e-05	NA	6.30e-16	NA
7. B	Q8CK44	Ribose import ATP-binding protein RbsA 1	7.98e-05	NA	9.42e-05	NA
7. B	Q1BJA5	Hemin import ATP-binding protein HmuV	4.06e-04	NA	0.005	NA
7. B	Q4K441	Aliphatic sulfonates import ATP-binding protein SsuB 2	2.84e-04	NA	1.40e-14	NA
7. B	Q3ZWN4	Phosphate import ATP-binding protein PstB	6.66e-07	NA	3.34e-10	NA
7. B	Q8UI76	Phosphate import ATP-binding protein PstB	4.52e-07	NA	1.21e-09	NA
7. B	Q9KIF7	Glycine betaine transport ATP-binding protein OpuAA	7.38e-05	NA	5.26e-16	NA
7. B	Q5FFT1	Phosphate import ATP-binding protein PstB	8.72e-12	NA	2.04e-14	NA
7. B	P36636	Peptide transport system ATP-binding protein SapD	1.67e-07	NA	3.36e-21	NA
7. B	Q7NA79	Ribose import ATP-binding protein RbsA	3.29e-05	NA	3.14e-08	NA
7. B	Q4A5A4	Energy-coupling factor transporter ATP-binding protein EcfA2	1.62e-04	NA	6.55e-10	NA
7. B	P63389	Probable ATP-binding protein YheS	1.32e-04	NA	3.22e-06	NA
7. B	Q87EF0	ATP-dependent lipid A-core flippase	9.85e-05	NA	2.03e-04	NA
7. B	O60706	ATP-binding cassette sub-family C member 9	2.03e-04	NA	2.33e-04	NA
7. B	Q6FIK3	Iron-sulfur clusters transporter ATM1, mitochondrial	2.83e-04	NA	1.70e-04	NA
7. B	Q1C5N7	Phosphate import ATP-binding protein PstB 1	1.16e-10	NA	2.13e-08	NA
7. B	Q39BJ8	Arabinose import ATP-binding protein AraG 2	5.27e-04	NA	0.001	NA
7. B	Q9KXJ6	Putative ABC transporter ATP-binding protein SCO2324	2.46e-03	NA	1.05e-04	NA
7. B	P63369	Phosphate import ATP-binding protein PstB 2	2.48e-10	NA	2.93e-11	NA
7. B	Q7CHQ3	Galactose/methyl galactoside import ATP-binding protein MglA	1.54e-04	NA	2.28e-05	NA
7. B	Q5PJE7	Autoinducer 2 import ATP-binding protein LsrA	1.03e-03	NA	2.32e-07	NA
7. B	Q2NUD6	Galactose/methyl galactoside import ATP-binding protein MglA	1.69e-04	NA	9.68e-06	NA
7. B	Q2IGQ6	Phosphate import ATP-binding protein PstB	1.35e-03	NA	2.75e-11	NA
7. B	Q9X196	Spermidine/putrescine import ATP-binding protein PotA	6.93e-04	NA	6.31e-18	NA
7. B	Q3YSK9	Zinc import ATP-binding protein ZnuC	2.49e-04	NA	6.51e-07	NA
7. B	Q1MBG4	Arabinose import ATP-binding protein AraG	4.73e-05	NA	0.043	NA
7. B	Q57GZ7	Maltose/maltodextrin import ATP-binding protein MalK	3.32e-03	NA	6.81e-14	NA
7. B	Q7A5Q8	Nickel import system ATP-binding protein NikD	3.65e-04	NA	3.35e-14	NA
7. B	Q0T3U8	Zinc import ATP-binding protein ZnuC	1.07e-03	NA	7.36e-09	NA
7. B	O84071	Probable metal transport system ATP-binding protein CT_068	2.57e-04	NA	1.31e-04	NA
7. B	Q895C4	Methionine import ATP-binding protein MetN	2.45e-05	NA	6.54e-18	NA
7. B	Q6LU82	Phosphate import ATP-binding protein PstB 1	1.31e-03	NA	9.80e-10	NA
7. B	Q48HD9	Phosphate import ATP-binding protein PstB 1	8.52e-04	NA	4.37e-11	NA
7. B	Q834B4	Phosphate import ATP-binding protein PstB 1	9.91e-04	NA	2.23e-12	NA
7. B	P0AAH3	Phosphate import ATP-binding protein PstB	1.11e-03	NA	1.02e-11	NA
7. B	A3PRY1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.02e-04	NA	7.26e-12	NA
7. B	Q46BM0	Phosphate import ATP-binding protein PstB	1.10e-03	NA	2.94e-09	NA
7. B	Q5HGY5	Spermidine/putrescine import ATP-binding protein PotA	1.27e-04	NA	1.05e-12	NA
7. B	Q9Y8G2	ABC multidrug transporter atrC	2.55e-03	NA	1.09e-06	NA
7. B	Q8XAY7	Autoinducer 2 import ATP-binding protein LsrA	6.17e-05	NA	1.68e-07	NA
7. B	Q8RQL7	Glutamate transport ATP-binding protein GluA	8.62e-07	NA	1.90e-17	NA
7. B	P34358	ABC transporter ced-7	2.10e-02	NA	3.30e-09	NA
7. B	A0A1U8QG99	ABC multidrug transporter atrC	6.75e-03	NA	1.18e-06	NA
7. B	Q74KF8	Phosphate import ATP-binding protein PstB 2	1.77e-06	NA	2.11e-14	NA
7. B	P82451	ATP-binding cassette sub-family C member 9	1.94e-04	NA	0.005	NA
7. B	Q5L222	Spermidine/putrescine import ATP-binding protein PotA	1.55e-04	NA	6.08e-15	NA
7. B	Q32HC7	Arabinose import ATP-binding protein AraG	2.55e-04	NA	0.004	NA
7. B	Q2ULH4	Iron-sulfur clusters transporter atm1, mitochondrial	2.46e-04	NA	1.37e-05	NA
7. B	Q8YD40	Methionine import ATP-binding protein MetN	2.18e-05	NA	4.43e-19	NA
7. B	Q55774	Uncharacterized ABC transporter ATP-binding protein sll0182	1.83e-03	NA	0.017	NA
7. B	A0R6H8	Mycobactin import ATP-binding/permease protein IrtA	2.38e-04	NA	0.014	NA
7. B	Q9CNJ7	Phosphate import ATP-binding protein PstB	1.35e-03	NA	2.74e-12	NA
7. B	P33310	ATP-dependent permease MDL1, mitochondrial	1.34e-04	NA	3.49e-08	NA
7. B	P22040	Uncharacterized ABC transporter ATP-binding protein sll0415	1.12e-04	NA	1.44e-07	NA
7. B	P91660	Probable multidrug resistance-associated protein lethal(2)03659	1.01e-01	NA	0.001	NA
7. B	A0B297	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.46e-04	NA	3.36e-04	NA
7. B	Q8G838	Putative ABC transporter ATP-binding protein BL0043	2.44e-03	NA	4.57e-06	NA
7. B	Q57BC2	Thiamine import ATP-binding protein ThiQ	1.51e-05	NA	1.98e-06	NA
7. B	Q3K8M7	Arabinose import ATP-binding protein AraG	3.91e-04	NA	0.025	NA
7. B	Q7VZ66	Phosphate import ATP-binding protein PstB	5.11e-06	NA	4.95e-11	NA
7. B	Q830W6	Spermidine/putrescine import ATP-binding protein PotA	8.03e-04	NA	1.96e-17	NA
7. B	P59852	Lactococcin-G-processing and transport ATP-binding protein LagD	1.48e-04	NA	9.32e-09	NA
7. B	Q8E281	Ribose import ATP-binding protein RbsA	2.30e-05	NA	2.60e-04	NA
7. B	P96117	Zinc transport system ATP-binding protein TroB	1.22e-03	NA	1.28e-04	NA
7. B	P0CZ42	Probable ABC transporter ATP-binding protein SpyM3_0208	4.58e-04	NA	0.009	NA
7. B	Q0TPX5	Ribose import ATP-binding protein RbsA	7.35e-05	NA	2.33e-05	NA
7. B	Q142P6	ATP-dependent lipid A-core flippase	5.91e-05	NA	1.26e-05	NA
7. B	P19844	Probable ABC transporter ATP-binding protein NosF	3.78e-04	NA	0.001	NA
7. B	Q825P1	Ribose import ATP-binding protein RbsA 2	7.31e-05	NA	3.69e-04	NA
7. B	Q8FYU9	Thiamine import ATP-binding protein ThiQ	1.58e-05	NA	2.22e-06	NA
7. B	Q97N50	Energy-coupling factor transporter ATP-binding protein EcfA1	7.40e-05	NA	3.97e-14	NA
7. B	Q65M64	Aliphatic sulfonates import ATP-binding protein SsuB	1.76e-04	NA	1.94e-12	NA
7. B	Q7A088	Energy-coupling factor transporter ATP-binding protein EcfA2	9.46e-05	NA	5.13e-13	NA
7. B	Q92S10	Ribose import ATP-binding protein RbsA 1	6.58e-05	NA	8.11e-05	NA
7. B	P59738	Molybdenum import ATP-binding protein ModC	1.42e-03	NA	6.00e-05	NA
7. B	Q8DGZ3	Phosphate import ATP-binding protein PstB	4.91e-05	NA	3.74e-09	NA
7. B	Q92G36	Zinc import ATP-binding protein ZnuC	3.84e-04	NA	4.00e-07	NA
7. B	Q8T689	ABC transporter G family member 4	3.11e-04	NA	0.004	NA
7. B	Q47MA5	Hemin import ATP-binding protein HmuV	5.53e-04	NA	0.024	NA
7. B	P77257	Autoinducer 2 import ATP-binding protein LsrA	1.05e-03	NA	1.56e-07	NA
7. B	Q92887	ATP-binding cassette sub-family C member 2	3.24e-03	NA	1.71e-04	NA
7. B	Q3J8J2	Phosphate import ATP-binding protein PstB 2	1.35e-03	NA	3.86e-09	NA
7. B	Q6LX68	Energy-coupling factor transporter ATP-binding protein EcfA	5.33e-05	NA	2.55e-12	NA
7. B	P44662	Probable iron transport system ATP-binding protein HI_0361	1.18e-03	NA	6.11e-06	NA
7. B	P63359	ATP-dependent lipid A-core flippase	2.93e-04	NA	1.81e-07	NA
7. B	Q67RG2	Phosphate import ATP-binding protein PstB 1	8.97e-04	NA	1.03e-08	NA
7. B	Q0SWH9	Energy-coupling factor transporter ATP-binding protein EcfA2	3.94e-05	NA	1.23e-14	NA
7. B	Q3JYF4	Energy-coupling factor transporter ATP-binding protein EcfA1	6.47e-05	NA	3.08e-13	NA
7. B	O31427	SkfA peptide export ATP-binding protein SkfE	2.04e-05	NA	0.014	NA
7. B	Q5R9Z5	ATP-binding cassette sub-family F member 3	3.10e-04	NA	2.59e-05	NA
7. B	A7FMJ7	Autoinducer 2 import ATP-binding protein LsrA	7.99e-05	NA	5.69e-07	NA
7. B	Q1LKJ2	Nod factor export ATP-binding protein I	4.08e-04	NA	0.002	NA
7. B	Q2UPC0	ABC transporter aclQ	4.86e-05	NA	2.95e-05	NA
7. B	Q5E6M2	Zinc import ATP-binding protein ZnuC 1	1.08e-03	NA	4.82e-09	NA
7. B	Q98FA5	Thiamine import ATP-binding protein ThiQ	9.45e-06	NA	7.79e-08	NA
7. B	Q578M5	Putative ATP-binding protein BruAb2_0487	2.15e-04	NA	6.82e-14	NA
7. B	Q1M7A6	Aliphatic sulfonates import ATP-binding protein SsuB 2	8.28e-05	NA	2.28e-10	NA
7. B	O95255	ATP-binding cassette sub-family C member 6	1.84e-03	NA	3.96e-04	NA
7. B	Q48FT0	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.67e-04	NA	4.10e-09	NA
7. B	Q1J982	Energy-coupling factor transporter ATP-binding protein EcfA1	7.42e-05	NA	7.74e-13	NA
7. B	Q5HVF4	Phosphate import ATP-binding protein PstB	1.53e-05	NA	1.14e-15	NA
7. B	Q2GE91	Lipoprotein-releasing system ATP-binding protein LolD	1.38e-04	NA	8.01e-08	NA
7. B	Q7NNW9	Putative ABC transporter ATP-binding protein gll0289	2.96e-05	NA	7.75e-05	NA
7. B	Q7MFC4	Maltose/maltodextrin import ATP-binding protein MalK	1.64e-04	NA	1.70e-15	NA
7. B	Q9C7F8	ABC transporter B family member 13	8.22e-04	NA	2.10e-10	NA
7. B	Q0S736	Phosphate import ATP-binding protein PstB	1.10e-03	NA	0.002	NA
7. B	Q92AF9	Manganese transport system ATP-binding protein MntB	5.15e-05	NA	4.56e-04	NA
7. B	P9WQI5	Uncharacterized ABC transporter ATP-binding protein Rv2564	3.01e-03	NA	3.78e-06	NA
7. B	Q0TBN5	Xylose import ATP-binding protein XylG	2.28e-04	NA	5.06e-05	NA
7. B	Q8ZJD0	Taurine import ATP-binding protein TauB	2.16e-04	NA	4.94e-09	NA
7. B	E9PU17	ATP-binding cassette sub-family A member 17	2.48e-02	NA	8.11e-06	NA
7. B	Q56927	Fe(3+) ions import ATP-binding protein FbpC	8.50e-05	NA	7.28e-15	NA
7. B	Q31TP8	Phosphonates import ATP-binding protein PhnC	4.05e-09	NA	5.74e-07	NA
7. B	Q55DA0	ABC transporter G family member 22	7.35e-03	NA	3.21e-04	NA
7. B	O80725	ABC transporter B family member 4	1.44e-02	NA	5.02e-10	NA
7. B	Q13RD3	Aliphatic sulfonates import ATP-binding protein SsuB 2	8.16e-05	NA	3.45e-08	NA
7. B	Q8U6M1	Fe(3+) ions import ATP-binding protein FbpC	1.86e-04	NA	3.42e-15	NA
7. B	Q2FW35	Energy-coupling factor transporter ATP-binding protein EcfA2	9.27e-05	NA	5.13e-13	NA
7. B	P78363	Retinal-specific phospholipid-transporting ATPase ABCA4	3.46e-02	NA	2.71e-04	NA
7. B	O88269	ATP-binding cassette sub-family C member 6	1.03e-02	NA	0.002	NA
7. B	Q045Z8	Energy-coupling factor transporter ATP-binding protein EcfA1	1.91e-04	NA	9.78e-10	NA
7. B	Q8G7F4	Phosphate import ATP-binding protein PstB	1.12e-03	NA	1.71e-04	NA
7. B	Q97X60	Putative ABC transporter ATP-binding protein SSO1893	2.81e-04	NA	1.70e-05	NA
7. B	O70127	Bile salt export pump	3.98e-03	NA	5.14e-06	NA
7. B	Q8LPJ4	ABC transporter E family member 2	3.56e-02	NA	0.013	NA
7. B	O60102	Translation initiation factor rli1	5.65e-02	NA	0.012	NA
7. B	O34510	Fe(3+)-citrate import ATP-binding protein YfmF	2.53e-04	NA	3.47e-07	NA
7. B	Q5YYR7	Aliphatic sulfonates import ATP-binding protein SsuB 2	8.31e-05	NA	7.53e-10	NA
7. B	Q8FVM9	Nickel import ATP-binding protein NikD	3.44e-06	NA	2.12e-12	NA
7. B	Q1LQD3	ATP-dependent lipid A-core flippase	1.70e-04	NA	1.33e-05	NA
7. B	Q11D92	Thiamine import ATP-binding protein ThiQ	8.01e-06	NA	4.26e-08	NA
7. B	P63374	Phosphate import ATP-binding protein PstB 1	1.24e-03	NA	2.08e-08	NA
7. B	Q1CCR9	Taurine import ATP-binding protein TauB	2.03e-04	NA	4.94e-09	NA
7. B	Q138A9	Hemin import ATP-binding protein HmuV	6.73e-04	NA	0.017	NA
7. B	Q56953	Chelated iron transport system membrane protein YfeB	1.02e-03	NA	4.01e-05	NA
7. B	Q1LJ08	Phosphonates import ATP-binding protein PhnC 2	9.37e-05	NA	1.79e-15	NA
7. B	Q48IS7	Arabinose import ATP-binding protein AraG	4.00e-05	NA	0.002	NA
7. B	Q7JUN3	ATP-binding cassette sub-family D member	5.95e-04	NA	0.033	NA
7. B	Q63QQ7	Arabinose import ATP-binding protein AraG	3.36e-04	NA	0.014	NA
7. B	Q46YX6	Nod factor export ATP-binding protein I	5.52e-05	NA	0.002	NA
7. B	Q83J77	Nickel import ATP-binding protein NikE	1.73e-07	NA	5.73e-22	NA
7. B	Q9K9G7	Formylaminopyrimidine import ATP-binding protein ThiZ	7.39e-03	NA	4.66e-04	NA
7. B	Q0VQ44	Molybdenum import ATP-binding protein ModC	1.34e-03	NA	0.013	NA
7. B	Q6GHY6	Spermidine/putrescine import ATP-binding protein PotA	1.27e-04	NA	1.05e-12	NA
7. B	Q576H3	Xylose import ATP-binding protein XylG	1.22e-04	NA	2.05e-05	NA
7. B	Q8D3S8	Hemin import ATP-binding protein HmuV	1.83e-04	NA	4.41e-07	NA
7. B	Q8T6J1	ABC transporter A family member 6	6.55e-03	NA	2.04e-04	NA
7. B	Q823C4	Methionine import ATP-binding protein MetN	2.85e-05	NA	1.46e-10	NA
7. B	Q97WT4	Putative ABC transporter ATP-binding protein SSO2030	9.48e-04	NA	3.17e-05	NA
7. B	Q7U172	Phosphate import ATP-binding protein PstB 1	1.10e-03	NA	0.002	NA
7. B	Q8FUN3	Putative ATP-binding protein BRA1187/BS1330_II1178	2.67e-04	NA	0.002	NA
7. B	Q0BIZ6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.71e-04	NA	1.22e-09	NA
7. B	Q0S0X2	Aliphatic sulfonates import ATP-binding protein SsuB 3	1.11e-04	NA	8.25e-09	NA
7. B	Q97KZ3	Putative ABC transporter ATP-binding protein CA_C0773	2.65e-06	NA	6.66e-05	NA
7. B	Q9PR42	UvrABC system protein A	1.27e-01	NA	0.001	NA
7. B	Q39HM4	Phosphate import ATP-binding protein PstB	4.29e-05	NA	2.59e-11	NA
7. B	Q5XBY6	Phosphate import ATP-binding protein PstB 2	3.21e-06	NA	9.53e-10	NA
7. B	P37608	Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3	1.16e-03	NA	1.95e-04	NA
7. B	P0AAF4	Arabinose import ATP-binding protein AraG	3.12e-04	NA	0.004	NA
7. B	Q65UE1	Spermidine/putrescine import ATP-binding protein PotA	4.88e-05	NA	5.01e-18	NA
7. B	Q9U2G5	Multidrug resistance protein mrp-7	1.54e-03	NA	0.002	NA
7. B	A2RI01	Energy-coupling factor transporter ATP-binding protein EcfA1	1.35e-04	NA	3.97e-13	NA
7. B	Q5LBT4	Spermidine/putrescine import ATP-binding protein PotA	1.18e-03	NA	2.31e-11	NA
7. B	Q2J3F7	Cytochrome c biogenesis ATP-binding export protein CcmA	2.73e-02	NA	0.003	NA
7. B	Q9STT8	ABC transporter A family member 4	6.95e-03	NA	8.37e-05	NA
7. B	Q734T1	Putative ABC transporter ATP-binding protein BCE_3323	4.44e-04	NA	1.40e-09	NA
7. B	P0DKX6	Cyclolysin secretion/processing ATP-binding protein CyaB	5.02e-04	NA	7.37e-09	NA
7. B	A1BC20	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.64e-04	NA	0.007	NA
7. B	Q87PH3	Spermidine/putrescine import ATP-binding protein PotA	2.04e-04	NA	1.72e-16	NA
7. B	Q04HV7	Energy-coupling factor transporter ATP-binding protein EcfA1	1.67e-04	NA	3.97e-14	NA
7. B	Q98KI3	Molybdenum import ATP-binding protein ModC	1.58e-03	NA	7.70e-10	NA
7. B	Q5B1Q2	Iron-sulfur clusters transporter atm1, mitochondrial	9.54e-05	NA	9.77e-09	NA
7. B	Q32K28	Thiamine import ATP-binding protein ThiQ	1.00e-05	NA	1.38e-12	NA
7. B	Q71WT2	Phosphate import ATP-binding protein PstB 2	2.43e-06	NA	1.62e-12	NA
7. B	Q8Z5N5	Cobalt import ATP-binding protein CbiO	4.18e-05	NA	5.92e-06	NA
7. B	Q89WG0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.30e-04	NA	2.20e-12	NA
7. B	Q8T6J0	ABC transporter A family member 7	1.73e-03	NA	0.003	NA
7. B	Q7A5Q9	Nickel import system ATP-binding protein NikE	1.44e-06	NA	1.10e-17	NA
7. B	Q3JSR6	Aliphatic sulfonates import ATP-binding protein SsuB	4.67e-04	NA	3.66e-12	NA
7. B	Q1ARR5	Ribose import ATP-binding protein RbsA 3	4.43e-05	NA	1.08e-04	NA
7. B	Q6GH28	Nickel import system ATP-binding protein NikE	7.57e-07	NA	8.41e-18	NA
7. B	Q6LQC0	Hemin import ATP-binding protein HmuV	3.57e-04	NA	0.046	NA
7. B	P21447	ATP-dependent translocase ABCB1	9.01e-03	NA	5.81e-09	NA
7. B	Q81GU1	Sulfate/thiosulfate import ATP-binding protein CysA	5.74e-04	NA	6.81e-19	NA
7. B	Q6LSC4	Phosphate import ATP-binding protein PstB 2	1.02e-06	NA	1.12e-12	NA
7. B	Q8YNJ3	Phosphate import ATP-binding protein PstB 3	1.31e-03	NA	3.29e-07	NA
7. B	Q32AQ2	Nickel import ATP-binding protein NikD	2.44e-06	NA	1.99e-18	NA
7. B	P21448	ATP-dependent translocase ABCB1	6.17e-02	NA	9.30e-09	NA
7. B	Q88YK8	Phosphate import ATP-binding protein PstB 1	3.23e-06	NA	1.97e-10	NA
7. B	Q8FJ95	Aliphatic sulfonates import ATP-binding protein SsuB	1.76e-04	NA	7.96e-13	NA
7. B	Q55740	Putative ABC transporter ATP-binding protein sll0385	2.46e-05	NA	6.12e-14	NA
7. B	Q8TUR7	Phosphate import ATP-binding protein PstB	2.55e-06	NA	1.32e-07	NA
7. B	Q8E8K8	Sulfate/thiosulfate import ATP-binding protein CysA 2	5.38e-04	NA	9.41e-19	NA
7. B	Q1GAD3	Phosphate import ATP-binding protein PstB	8.73e-04	NA	1.27e-12	NA
7. B	A0A059JJ46	ABC multidrug transporter MDR2	9.40e-03	NA	3.25e-08	NA
7. B	Q4ZYK8	Phosphonates import ATP-binding protein PhnC 1	4.96e-05	NA	2.30e-07	NA
7. B	P49938	Iron(3+)-hydroxamate import ATP-binding protein FhuC	3.14e-04	NA	3.98e-10	NA
7. B	P0A9R7	Cell division ATP-binding protein FtsE	1.43e-05	NA	4.99e-10	NA
7. B	P94420	Petrobactin import ATP-binding protein YclP	1.30e-04	NA	1.49e-06	NA
7. B	Q8T6B7	ABC transporter F family member 2	1.94e-04	NA	4.90e-04	NA
7. B	Q8YUI9	Phosphonates import ATP-binding protein PhnC 2	3.84e-05	NA	1.77e-12	NA
7. B	Q3Z542	Taurine import ATP-binding protein TauB	2.09e-04	NA	5.17e-12	NA
7. B	Q9LSJ6	ABC transporter B family member 17	4.91e-03	NA	9.32e-09	NA
7. B	Q9YG51	Phosphate import ATP-binding protein PstB	5.85e-06	NA	6.23e-15	NA
7. B	Q9ZCC4	Zinc import ATP-binding protein ZnuC	7.31e-07	NA	1.46e-06	NA
7. B	O95342	Bile salt export pump	3.21e-03	NA	3.06e-06	NA
7. B	Q42093	ABC transporter C family member 2	7.06e-02	NA	0.018	NA
7. B	D5AQY6	Nickel import ATP-binding protein NikO	5.84e-06	NA	2.42e-08	NA
7. B	Q5FHB0	Zinc import ATP-binding protein ZnuC	2.17e-04	NA	3.78e-07	NA
7. B	A5U7B7	Cell division ATP-binding protein FtsE	9.80e-06	NA	3.25e-10	NA
7. B	Q55462	Bicarbonate transport ATP-binding protein CmpC	3.90e-02	NA	9.69e-12	NA
7. B	P80866	Vegetative protein 296	9.91e-05	NA	0.038	NA
7. B	Q8LEF6	ABC transporter I family member 11, chloroplastic	1.15e-03	NA	0.031	NA
7. B	Q0T4L9	Autoinducer 2 import ATP-binding protein LsrA	1.02e-03	NA	3.82e-06	NA
7. B	Q03518	Antigen peptide transporter 1	8.27e-05	NA	2.23e-06	NA
7. B	Q1JLT7	Spermidine/putrescine import ATP-binding protein PotA	1.87e-04	NA	1.64e-16	NA
7. B	Q9CM80	Fe(3+) ions import ATP-binding protein FbpC	1.54e-04	NA	1.50e-14	NA
7. B	P36879	Uncharacterized ABC transporter ATP-binding protein YadG	1.48e-03	NA	9.16e-07	NA
7. B	Q2NHA1	Energy-coupling factor transporter ATP-binding protein EcfA	1.83e-05	NA	5.89e-15	NA
7. B	P0AAG0	Dipeptide transport ATP-binding protein DppD	1.51e-07	NA	2.63e-30	NA
7. B	Q88R93	Aliphatic sulfonates import ATP-binding protein SsuB	2.43e-04	NA	6.23e-14	NA
7. B	Q8FCN0	Nickel import ATP-binding protein NikD	2.36e-06	NA	4.93e-19	NA
7. B	Q8GDV4	Phosphate import ATP-binding protein PstB (Fragment)	1.62e-11	NA	1.19e-08	NA
7. B	Q8PVG9	Putative ABC transporter ATP-binding protein MM_1996	8.09e-04	NA	9.94e-11	NA
7. B	Q8YDH1	Putative peptide import ATP-binding protein BMEII0205	2.24e-08	NA	9.96e-43	NA
7. B	Q8FAV1	Phosphonates import ATP-binding protein PhnC	3.30e-09	NA	9.94e-07	NA
7. B	Q91V24	ATP-binding cassette sub-family A member 7	3.03e-02	NA	0.001	NA
7. B	P54537	Arginine transport ATP-binding protein ArtM	1.72e-06	NA	3.76e-14	NA
7. B	Q55196	Phosphate import ATP-binding protein PstB 1	3.57e-06	NA	1.12e-05	NA
7. B	Q3MA91	Phosphate import ATP-binding protein PstB 3	3.14e-06	NA	1.34e-06	NA
7. B	Q04BY7	Energy-coupling factor transporter ATP-binding protein EcfA1	3.95e-05	NA	1.81e-11	NA
7. B	O75027	Iron-sulfur clusters transporter ABCB7, mitochondrial	5.68e-05	NA	3.83e-06	NA
7. B	P38735	ABC transporter ATP-binding protein/permease VMR1	5.53e-02	NA	0.010	NA
7. B	Q7MG07	Galactose/methyl galactoside import ATP-binding protein MglA	2.78e-04	NA	2.01e-04	NA
7. B	P96605	Uncharacterized ABC transporter ATP-binding protein YdbJ	3.25e-04	NA	2.57e-06	NA
7. B	Q8FVT0	Putative ATP-binding protein BRA0745/BS1330_II0738	2.38e-04	NA	6.28e-14	NA
7. B	Q9BZC7	ATP-binding cassette sub-family A member 2	6.74e-02	NA	0.009	NA
7. B	A0A348AXX9	ABC-type transporter TR06	1.01e-02	NA	5.03e-09	NA
7. B	P55476	Nod factor export ATP-binding protein I	1.28e-03	NA	6.40e-04	NA
7. B	P77737	Oligopeptide transport ATP-binding protein OppF	7.33e-10	NA	1.85e-58	NA
7. B	Q2JKC2	Phosphate import ATP-binding protein PstB 2	1.48e-03	NA	4.20e-05	NA
7. B	Q63FX9	Ribose import ATP-binding protein RbsA	8.44e-05	NA	6.07e-06	NA
7. B	Q7CMM7	Energy-coupling factor transporter ATP-binding protein EcfA1	7.83e-05	NA	8.90e-13	NA
7. B	P45769	Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ	1.19e-06	NA	1.39e-19	NA
7. B	Q6KHL1	Energy-coupling factor transporter ATP-binding protein EcfA1	2.46e-04	NA	6.44e-10	NA
7. B	Q4AA74	Energy-coupling factor transporter ATP-binding protein EcfA2	8.12e-06	NA	9.83e-09	NA
7. B	P43672	ATP-binding protein Uup	6.24e-04	NA	1.53e-08	NA
7. B	Q9M1H3	ABC transporter F family member 4	1.53e-04	NA	3.55e-05	NA
7. B	Q9LHD1	ABC transporter B family member 15	1.24e-03	NA	3.82e-08	NA
7. B	Q30W28	Phosphonates import ATP-binding protein PhnC	9.42e-06	NA	3.32e-06	NA
7. B	Q7AH43	Fe(3+) ions import ATP-binding protein FbpC	3.91e-05	NA	1.44e-16	NA
7. B	A0A0D1CZ63	Multidrug resistance protein fer6	3.27e-03	NA	6.55e-06	NA
7. B	Q2S3A3	Lipoprotein-releasing system ATP-binding protein LolD	6.12e-05	NA	8.35e-09	NA
7. B	Q08201	Phosphatidylcholine translocator ABCB4	8.01e-04	NA	3.48e-09	NA
7. B	Q5FM62	Energy-coupling factor transporter ATP-binding protein EcfA2	1.06e-04	NA	3.28e-10	NA
7. B	Q6D4E2	Spermidine/putrescine import ATP-binding protein PotA	3.02e-04	NA	6.72e-18	NA
7. B	Q52666	Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD	1.38e-06	NA	1.67e-16	NA
7. B	Q8ZPK4	Osmoprotectant import ATP-binding protein OsmV	4.00e-04	NA	1.33e-15	NA
7. B	Q2NIT5	Energy-coupling factor transporter ATP-binding protein EcfA	1.94e-05	NA	9.31e-06	NA
7. B	O28882	Probable branched-chain amino acid transport ATP-binding protein LivF	3.23e-05	NA	0.004	NA
7. B	P63358	Probable ribonucleotide transport ATP-binding protein mkl	7.00e-05	NA	4.05e-12	NA
7. B	Q39GW5	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.12e-03	NA	2.97e-13	NA
7. B	Q7VP69	Thiamine import ATP-binding protein ThiQ	4.61e-05	NA	4.08e-08	NA
7. B	Q14Q07	Spermidine/putrescine import ATP-binding protein PotA	1.17e-04	NA	2.50e-15	NA
7. B	Q8WWZ4	ATP-binding cassette sub-family A member 10	8.78e-03	NA	0.001	NA
7. B	Q2YX74	Spermidine/putrescine import ATP-binding protein PotA	1.21e-04	NA	1.05e-12	NA
7. B	Q04BG2	Spermidine/putrescine import ATP-binding protein PotA	1.71e-04	NA	1.23e-12	NA
7. B	Q2T751	Taurine import ATP-binding protein TauB	2.40e-04	NA	3.87e-07	NA
7. B	Q01937	Lactose transport ATP-binding protein LacK	7.35e-04	NA	1.68e-11	NA
7. B	Q3IX40	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.79e-04	NA	7.88e-12	NA
7. B	F2SQT8	ABC multidrug transporter MDR5	4.98e-03	NA	5.34e-08	NA
7. B	Q9QY30	Bile salt export pump	3.77e-03	NA	4.23e-06	NA
7. B	Q60350	Uncharacterized ABC transporter ATP-binding protein MJ0035	7.58e-05	NA	2.63e-06	NA
7. B	Q1R0Z6	Phosphonates import ATP-binding protein PhnC	9.49e-05	NA	8.25e-14	NA
7. B	Q9CEW8	Phosphate import ATP-binding protein PstB 1	1.25e-03	NA	1.73e-08	NA
7. B	Q99UA2	Nickel import system ATP-binding protein NikD	4.99e-06	NA	3.35e-14	NA
7. B	P0A2V8	Phosphate import ATP-binding protein PstB 3	8.08e-04	NA	1.60e-10	NA
7. B	Q6F0V4	Spermidine/putrescine import ATP-binding protein PotA	1.67e-04	NA	1.40e-16	NA
7. B	Q4K9A4	Macrolide export ATP-binding/permease protein MacB 2	6.29e-02	NA	1.03e-09	NA
7. B	Q2HIE9	Iron-sulfur clusters transporter ATM1, mitochondrial	3.29e-05	NA	5.26e-06	NA
7. B	P45171	Spermidine/putrescine import ATP-binding protein PotA	6.75e-05	NA	4.85e-17	NA
7. B	P9WQJ9	Mycobactin import ATP-binding/permease protein IrtA	2.22e-04	NA	0.019	NA
7. B	Q0BTP1	Phosphate import ATP-binding protein PstB	2.60e-05	NA	2.06e-10	NA
7. B	Q9NRK6	ATP-binding cassette sub-family B member 10, mitochondrial	7.69e-05	NA	2.14e-06	NA
7. B	Q1LQB5	Phosphonates import ATP-binding protein PhnC 1	2.13e-06	NA	1.46e-05	NA
7. B	P14772	Bile pigment transporter 1	6.92e-03	NA	5.84e-04	NA
7. B	Q0B697	Hemin import ATP-binding protein HmuV	3.96e-04	NA	0.005	NA
7. B	Q63TW1	Aliphatic sulfonates import ATP-binding protein SsuB	1.39e-03	NA	3.11e-12	NA
7. B	Q1Q8K4	Phosphate import ATP-binding protein PstB	1.68e-06	NA	5.40e-11	NA
7. B	P69874	Spermidine/putrescine import ATP-binding protein PotA	4.57e-05	NA	4.96e-17	NA
7. B	Q927N9	Energy-coupling factor transporter ATP-binding protein EcfA2	7.79e-05	NA	8.19e-15	NA
7. B	Q2SR40	Phosphonates import ATP-binding protein PhnC	7.98e-06	NA	4.41e-08	NA
7. B	P23924	Galactose/methyl galactoside import ATP-binding protein MglA	1.47e-04	NA	1.57e-04	NA
7. B	Q9LSJ2	ABC transporter B family member 22	4.92e-03	NA	1.12e-06	NA
7. B	Q0TGT7	Arabinose import ATP-binding protein AraG	3.34e-04	NA	0.004	NA
7. B	Q8EUF1	Energy-coupling factor transporter ATP-binding protein EcfA	4.78e-05	NA	2.49e-08	NA
7. B	Q8FUW8	Putative peptide import ATP-binding protein BRA1094/BS1330_II1086	4.42e-12	NA	1.41e-31	NA
7. B	Q1C0A2	Phosphate import ATP-binding protein PstB 2	1.15e-03	NA	7.33e-12	NA
7. B	P0CZ28	Energy-coupling factor transporter ATP-binding protein EcfA1	7.69e-05	NA	8.90e-13	NA
7. B	Q74I62	Putative ABC transporter ATP-binding protein LJ_1704	1.83e-04	NA	5.47e-08	NA
7. B	Q2G506	ATM1-type heavy metal exporter	8.79e-05	NA	5.12e-04	NA
7. B	Q4K3K9	Phosphate import ATP-binding protein PstB	1.33e-03	NA	1.61e-09	NA
7. B	Q6HNE7	Ribose import ATP-binding protein RbsA	7.03e-05	NA	6.73e-06	NA
7. B	Q55EH8	ABC transporter G family member 23	8.21e-03	NA	1.11e-07	NA
7. B	Q2YXY2	Phosphate import ATP-binding protein PstB	2.05e-06	NA	1.58e-10	NA
7. B	Q62K82	Sulfate/thiosulfate import ATP-binding protein CysA	1.85e-04	NA	1.87e-15	NA
7. B	Q8VI47	ATP-binding cassette sub-family C member 2	6.69e-03	NA	1.06e-04	NA
7. B	Q9Y7M7	ATP-dependent permease MDL1, mitochondrial	9.42e-05	NA	2.62e-08	NA
7. B	Q9PHQ1	Phosphate import ATP-binding protein PstB	1.73e-05	NA	1.15e-15	NA
7. B	P0A2V1	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.56e-06	NA	1.77e-06	NA
7. B	Q0B1U4	Xylose import ATP-binding protein XylG	1.76e-04	NA	4.65e-04	NA
7. B	Q73DH7	Ribose import ATP-binding protein RbsA	1.23e-04	NA	2.00e-06	NA
7. B	Q8RI39	Spermidine/putrescine import ATP-binding protein PotA	2.33e-04	NA	3.12e-18	NA
7. B	Q8H0V6	ABC transporter F family member 3	4.69e-04	NA	6.63e-05	NA
7. B	O94489	Elongation factor 3	1.61e-02	NA	0.047	NA
7. B	Q3JDJ6	Phosphate import ATP-binding protein PstB 1	4.92e-11	NA	8.91e-11	NA
7. B	P55469	Uncharacterized ABC transporter ATP-binding protein y4gM	2.52e-05	NA	6.47e-07	NA
7. B	Q53I83	Methionine import ATP-binding protein MetN	4.65e-04	NA	3.16e-18	NA
7. B	A4WER4	Autoinducer 2 import ATP-binding protein LsrA	1.32e-04	NA	5.04e-05	NA
7. B	Q57AC2	Phosphate import ATP-binding protein PstB	4.98e-06	NA	7.68e-11	NA
7. B	Q9V2E4	Putative ABC transporter ATP-binding protein PYRAB01300	3.36e-04	NA	1.38e-09	NA
7. B	P33116	Subtilin transport ATP-binding protein SpaT	7.51e-05	NA	1.46e-06	NA
7. B	Q92VJ2	Sulfate/thiosulfate import ATP-binding protein CysA 2	5.84e-04	NA	3.64e-16	NA
7. B	Q88YK7	Phosphate import ATP-binding protein PstB 2	1.12e-03	NA	7.91e-08	NA
7. B	Q7MFE8	Phosphate import ATP-binding protein PstB 2	4.43e-06	NA	3.43e-11	NA
7. B	Q57242	ATP-binding protein Uup	2.86e-04	NA	1.51e-07	NA
7. B	Q05360	Protein white	NA	NA	0.005	NA
7. B	Q30YR3	Phosphate import ATP-binding protein PstB	1.03e-03	NA	3.94e-09	NA
7. B	O27764	Phosphate import ATP-binding protein PstB	1.49e-06	NA	3.30e-08	NA
7. B	O67154	Phosphate import ATP-binding protein PstB	3.36e-05	NA	2.17e-11	NA
7. B	Q6UR05	Multidrug resistance-associated protein 1	1.87e-02	NA	2.78e-04	NA
7. B	Q5LI72	Lipoprotein-releasing system ATP-binding protein LolD	3.15e-05	NA	1.32e-11	NA
7. B	Q8T6B4	ABC transporter F family member 4	1.70e-03	NA	5.44e-06	NA
7. B	Q63TY1	Sulfate/thiosulfate import ATP-binding protein CysA	1.87e-04	NA	1.66e-15	NA
7. B	Q9QYM0	ATP-binding cassette sub-family C member 5	1.77e-02	NA	5.27e-05	NA
7. B	Q03SI5	Teichoic acids export ATP-binding protein TagH	2.04e-02	NA	6.09e-04	NA
7. B	Q7A679	Spermidine/putrescine import ATP-binding protein PotA	1.24e-04	NA	1.05e-12	NA
7. B	Q50046	Phosphate import ATP-binding protein PstB	1.25e-03	NA	0.015	NA
7. B	P63378	Phosphate import ATP-binding protein PstB 2	1.78e-06	NA	9.53e-10	NA
7. B	Q8K984	Multidrug resistance-like ATP-binding protein MdlB	6.68e-06	NA	6.03e-05	NA
7. B	Q4L691	Phosphate import ATP-binding protein PstB	6.31e-06	NA	4.05e-09	NA
7. B	Q8T9W4	ABC transporter B family member 3	1.19e-02	NA	2.16e-07	NA
7. B	B1JLQ0	Autoinducer 2 import ATP-binding protein LsrA	1.73e-04	NA	5.55e-07	NA
7. B	Q9M1C7	ABC transporter C family member 9	3.52e-02	NA	0.042	NA
7. B	Q6D7D0	Molybdenum import ATP-binding protein ModC	1.36e-03	NA	3.81e-11	NA
7. B	Q99V03	Spermidine/putrescine import ATP-binding protein PotA	1.28e-04	NA	1.05e-12	NA
7. B	Q6YR39	Energy-coupling factor transporter ATP-binding protein EcfA	4.59e-05	NA	1.56e-05	NA
7. B	Q5ZWE4	Spermidine/putrescine import ATP-binding protein PotA	1.30e-04	NA	3.16e-14	NA
7. B	O94911	ABC-type organic anion transporter ABCA8	1.64e-02	NA	0.002	NA
7. B	Q5WNX0	Bacitracin transport ATP-binding protein BcrA	7.84e-04	NA	6.65e-09	NA
7. B	Q4ZRT7	Phosphate import ATP-binding protein PstB 1	8.76e-04	NA	4.25e-11	NA
7. B	Q2G607	Phosphate import ATP-binding protein PstB	2.40e-06	NA	3.61e-10	NA
7. B	P10907	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.29e-04	NA	9.12e-11	NA
7. B	Q54V86	ABC transporter C family member 13	4.59e-03	NA	8.48e-05	NA
7. B	Q71ED1	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.21e-06	NA	7.29e-07	NA
7. B	Q97ZT9	Phosphate import ATP-binding protein PstB	1.08e-06	NA	7.18e-15	NA
7. B	Q8XMP8	Phosphate import ATP-binding protein PstB	1.11e-06	NA	2.24e-11	NA
7. B	Q578S8	Nickel import ATP-binding protein NikD	3.33e-06	NA	1.06e-12	NA
7. B	Q1BJW2	Arabinose import ATP-binding protein AraG 2	3.57e-04	NA	4.59e-04	NA
7. B	Q92GP9	Putative export ATP-binding/permease protein RC1073	1.24e-04	NA	3.64e-06	NA
7. B	Q5LVC2	Phosphonates import ATP-binding protein PhnC	3.24e-05	NA	1.05e-07	NA
7. B	Q28VN1	Zinc import ATP-binding protein ZnuC	1.47e-04	NA	2.46e-06	NA
7. B	Q54W24	ABC transporter B family member 4	9.40e-04	NA	1.03e-08	NA
7. B	P33594	Nickel import ATP-binding protein NikE	1.69e-07	NA	1.40e-23	NA
7. B	P0CZ38	Phosphate import ATP-binding protein PstB 2	3.13e-06	NA	9.53e-10	NA
7. B	P77481	Putative uncharacterized ABC transporter ATP-binding protein YcjV	1.88e-04	NA	7.53e-12	NA
7. B	Q80WJ6	ATP-binding cassette sub-family C member 12	2.12e-03	NA	0.005	NA
7. B	Q9MUN1	Sulfate/thiosulfate import ATP-binding protein CysA	1.36e-04	NA	1.96e-19	NA
7. B	Q8R9I2	Phosphate import ATP-binding protein PstB 2	1.03e-06	NA	1.58e-09	NA
7. B	Q7MLB8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-04	NA	1.66e-15	NA
7. B	Q2SJY7	Spermidine/putrescine import ATP-binding protein PotA	1.66e-04	NA	3.10e-17	NA
7. B	Q8FFB3	Sulfate/thiosulfate import ATP-binding protein CysA	7.99e-04	NA	5.37e-15	NA
7. B	Q1J6D2	Phosphate import ATP-binding protein PstB 1	1.92e-06	NA	1.70e-07	NA
7. B	A2XCD4	ABC transporter C family member 13	2.65e-03	NA	0.029	NA
7. B	Q7U6R4	Phosphate import ATP-binding protein PstB	1.44e-03	NA	1.63e-06	NA
7. B	Q8ZAS8	Maltose/maltodextrin import ATP-binding protein MalK	1.80e-04	NA	6.75e-14	NA
7. B	Q478L3	Cytochrome c biogenesis ATP-binding export protein CcmA	1.39e-03	NA	0.037	NA
7. B	Q1AXT9	Phosphate import ATP-binding protein PstB	5.96e-06	NA	6.21e-07	NA
7. B	Q329R2	Phosphate import ATP-binding protein PstB	1.13e-03	NA	1.02e-11	NA
7. B	Q1R5D9	Nickel import ATP-binding protein NikD	2.56e-06	NA	1.04e-18	NA
7. B	Q1CCI2	Phosphate import ATP-binding protein PstB 2	6.76e-11	NA	7.33e-12	NA
7. B	Q3JHZ1	Ribose import ATP-binding protein RbsA 2	1.19e-03	NA	0.005	NA
7. B	Q1BG75	Aliphatic sulfonates import ATP-binding protein SsuB 2	4.82e-04	NA	5.23e-07	NA
7. B	P36370	Antigen peptide transporter 1	2.47e-05	NA	5.95e-05	NA
7. B	P0A9V1	Lipopolysaccharide export system ATP-binding protein LptB	7.19e-06	NA	0.001	NA
7. B	Q6LV32	Thiamine import ATP-binding protein ThiQ	3.11e-06	NA	7.85e-10	NA
7. B	Q7W9U5	Sulfate/thiosulfate import ATP-binding protein CysA	5.94e-04	NA	4.84e-15	NA
7. B	Q82WT5	Sulfate/thiosulfate import ATP-binding protein CysA	4.88e-04	NA	3.75e-19	NA
7. B	Q8ZQR6	Molybdenum import ATP-binding protein ModC	1.55e-03	NA	1.16e-04	NA
7. B	Q02MI4	Macrolide export ATP-binding/permease protein MacB	1.13e-01	NA	3.21e-10	NA
7. B	Q2M3G0	ATP-binding cassette sub-family B member 5	1.53e-02	NA	4.79e-08	NA
7. B	Q93FH6	Leukotoxin translocation ATP-binding protein LktB	7.78e-04	NA	1.51e-10	NA
7. B	Q8PY26	Putative ABC transporter ATP-binding protein MM_1038	2.20e-04	NA	7.77e-11	NA
7. B	Q21WN9	ATP-dependent lipid A-core flippase	6.47e-05	NA	1.29e-07	NA
7. B	Q9VL32	ATP-binding cassette sub-family C member Sur	8.70e-02	NA	0.002	NA
7. B	Q972J5	Putative ABC transporter ATP-binding protein STK_11360	1.67e-04	NA	3.54e-06	NA
7. B	Q48BP8	Phosphate import ATP-binding protein PstB 2	1.38e-03	NA	1.34e-09	NA
7. B	Q2J534	Phosphate import ATP-binding protein PstB	1.06e-03	NA	3.33e-08	NA
7. B	Q56A55	Mitochondrial potassium channel ATP-binding subunit	5.43e-05	NA	5.20e-07	NA
7. B	Q8FBS3	Ribose import ATP-binding protein RbsA	1.27e-04	NA	3.02e-07	NA
7. B	P23702	Leukotoxin export ATP-binding protein LtxB	4.99e-04	NA	1.49e-09	NA
7. B	P0A9V2	Lipopolysaccharide export system ATP-binding protein LptB	8.05e-06	NA	0.001	NA
7. B	P15361	Probable ABC transporter ATP-binding protein p29	4.36e-05	NA	2.45e-09	NA
7. B	Q8FCE2	Xylose import ATP-binding protein XylG	2.18e-04	NA	5.06e-05	NA
7. B	Q6G5J0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.26e-04	NA	1.88e-14	NA
7. B	Q1BQ82	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	5.13e-05	NA	3.36e-04	NA
7. B	Q8FL82	Thiamine import ATP-binding protein ThiQ	3.44e-05	NA	2.87e-12	NA
7. B	P31134	Putrescine transport ATP-binding protein PotG	2.98e-04	NA	1.54e-15	NA
7. B	P9WQJ0	Uncharacterized ABC transporter ATP-binding protein MT1311	9.50e-06	NA	4.35e-05	NA
7. B	Q63A38	Aliphatic sulfonates import ATP-binding protein SsuB	3.94e-04	NA	1.98e-11	NA
7. B	P9WQL5	Probable ribonucleotide transport ATP-binding protein mkl	5.02e-05	NA	4.05e-12	NA
7. B	Q9HYG4	Aliphatic sulfonates import ATP-binding protein SsuB 1	2.83e-04	NA	2.23e-14	NA
7. B	Q92TS8	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.43e-04	NA	1.16e-05	NA
7. B	Q5V6B8	Phosphonates import ATP-binding protein PhnC 1	1.17e-02	NA	2.30e-04	NA
7. B	O05779	Cell division ATP-binding protein FtsE	1.04e-05	NA	3.49e-10	NA
7. B	O34814	Cell division ATP-binding protein FtsE	1.18e-05	NA	2.41e-07	NA
7. B	Q8ZGU5	Phosphonates import ATP-binding protein PhnC	8.12e-09	NA	1.29e-10	NA
7. B	Q0T2X5	Galactose/methyl galactoside import ATP-binding protein MglA	1.47e-04	NA	1.39e-04	NA
7. B	Q8MIB3	Broad substrate specificity ATP-binding cassette transporter ABCG2	1.32e-02	NA	0.002	NA
7. B	Q1M7R4	Taurine import ATP-binding protein TauB	1.31e-04	NA	4.33e-10	NA
7. B	Q9HZS1	Histidine transport ATP-binding protein HisP	8.04e-06	NA	1.16e-13	NA
7. B	P63394	Mycobactin import ATP-binding/permease protein IrtB	7.93e-06	NA	0.004	NA
7. B	Q88D92	ATP-dependent lipid A-core flippase	1.05e-04	NA	3.16e-06	NA
7. B	P44735	Ribose import ATP-binding protein RbsA	4.83e-03	NA	8.29e-08	NA
7. B	Q89AJ0	Zinc import ATP-binding protein ZnuC	6.04e-04	NA	6.68e-09	NA
7. B	Q03519	Antigen peptide transporter 2	2.45e-04	NA	1.05e-05	NA
7. B	Q7V1X3	Phosphate import ATP-binding protein PstB	7.78e-04	NA	5.76e-05	NA
7. B	Q7RX59	Iron-sulfur clusters transporter atm1, mitochondrial	1.38e-03	NA	0.002	NA
7. B	Q9FT51	ABC transporter G family member 27	1.14e-02	NA	0.004	NA
7. B	Q8ZCM2	Fe(3+) ions import ATP-binding protein FbpC	1.20e-04	NA	2.02e-15	NA
7. B	Q9SJK6	Putative white-brown complex homolog protein 30	7.87e-03	NA	0.039	NA
7. B	Q9HY19	Spermidine/putrescine import ATP-binding protein PotA 2	1.25e-04	NA	1.21e-15	NA
7. B	P0CZ39	Phosphate import ATP-binding protein PstB 2	3.41e-06	NA	9.53e-10	NA
7. B	Q5KUX3	Ribose import ATP-binding protein RbsA	5.24e-04	NA	1.28e-04	NA
7. B	Q66FK0	Hemin import ATP-binding protein HmuV	3.30e-04	NA	3.65e-08	NA
7. B	P0AAG5	Multidrug resistance-like ATP-binding protein MdlB	2.61e-04	NA	3.75e-04	NA
7. B	A7KVC2	ABC transporter C family MRP4	2.36e-03	NA	0.038	NA
7. B	P33916	Uncharacterized ABC transporter ATP-binding protein YejF	1.64e-05	NA	4.20e-38	NA
7. B	Q45460	Choline transport ATP-binding protein OpuBA	4.78e-05	NA	2.38e-19	NA
7. B	Q54BT3	ABC transporter B family member 2	5.97e-02	NA	6.40e-09	NA
7. B	Q8YCG3	Fe(3+) ions import ATP-binding protein FbpC	1.89e-04	NA	1.19e-13	NA
7. B	Q9Z8J5	Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355	1.74e-04	NA	2.62e-04	NA
7. B	Q0SIB7	Hemin import ATP-binding protein HmuV	3.38e-04	NA	0.008	NA
7. B	Q8DFQ4	Zinc import ATP-binding protein ZnuC	6.23e-06	NA	1.90e-09	NA
7. B	P0AAH0	Phosphate import ATP-binding protein PstB	1.21e-03	NA	1.02e-11	NA
7. B	P77795	Uncharacterized ABC transporter ATP-binding protein YdcT	6.44e-05	NA	1.39e-17	NA
7. B	Q2YXY9	Nickel import system ATP-binding protein NikD	5.57e-06	NA	9.06e-14	NA
7. B	Q03PY5	Energy-coupling factor transporter ATP-binding protein EcfA1	6.81e-05	NA	8.32e-10	NA
7. B	Q3JUI6	ATP-dependent lipid A-core flippase	3.35e-05	NA	1.96e-06	NA
7. B	Q3M4H5	Phosphate import ATP-binding protein PstB 5	2.10e-06	NA	7.78e-09	NA
7. B	Q47087	Achromobactin transport ATP-binding protein CbrD	1.50e-04	NA	8.33e-09	NA
7. B	A1TXH7	Spermidine/putrescine import ATP-binding protein PotA	3.09e-04	NA	5.52e-17	NA
7. B	Q8LPK2	ABC transporter B family member 2	2.41e-02	NA	2.88e-08	NA
7. B	Q7M8M4	Phosphonates import ATP-binding protein PhnC	4.99e-05	NA	1.14e-17	NA
7. B	Q6D4A8	Zinc import ATP-binding protein ZnuC	1.11e-03	NA	1.65e-08	NA
7. B	P40860	Sulfate/thiosulfate import ATP-binding protein CysA	3.67e-04	NA	8.38e-15	NA
7. B	Q2FHY1	Spermidine/putrescine import ATP-binding protein PotA	1.28e-04	NA	1.05e-12	NA
7. B	O34900	L-cystine import ATP-binding protein TcyN	3.94e-06	NA	6.20e-13	NA
7. B	Q1CFV9	Phosphonates import ATP-binding protein PhnC	5.22e-09	NA	1.29e-10	NA
7. B	Q1C9L0	Phosphonates import ATP-binding protein PhnC	8.41e-09	NA	1.29e-10	NA
7. B	Q12XW6	Phosphate import ATP-binding protein PstB	2.06e-06	NA	3.31e-11	NA
7. B	Q0P887	Tungstate uptake system ATP-binding protein TupC	9.23e-03	NA	3.21e-06	NA
7. B	D3ZCM3	ATP-binding cassette subfamily G member 4	1.58e-02	NA	2.04e-04	NA
7. B	Q5WC31	Ribose import ATP-binding protein RbsA	5.86e-05	NA	1.91e-08	NA
7. B	Q5Z0P5	Aliphatic sulfonates import ATP-binding protein SsuB 1	7.65e-05	NA	0.003	NA
7. B	Q03ZQ0	Spermidine/putrescine import ATP-binding protein PotA	1.49e-04	NA	2.63e-14	NA
7. B	Q329I3	Phosphonates import ATP-binding protein PhnC	7.77e-06	NA	2.87e-07	NA
7. B	P22638	Heterocyst differentiation ATP-binding protein HepA	5.38e-05	NA	3.83e-07	NA
7. B	Q2K0S7	Ribose import ATP-binding protein RbsA 3	2.20e-03	NA	3.72e-04	NA
7. B	Q1B8U4	Aliphatic sulfonates import ATP-binding protein SsuB	6.82e-05	NA	3.53e-08	NA
7. B	Q8XA06	Thiamine import ATP-binding protein ThiQ	1.51e-05	NA	1.35e-12	NA
7. B	Q48GL0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.32e-03	NA	0.004	NA
7. B	Q73KT5	Putative ABC transporter ATP-binding protein TDE_2132	2.93e-05	NA	1.71e-09	NA
7. B	Q6GKG3	Phosphonates import ATP-binding protein PhnC	3.53e-06	NA	3.98e-09	NA
7. B	O26096	Methionine import ATP-binding protein MetN	6.59e-06	NA	4.29e-23	NA
7. B	Q9XBG1	Phosphate import ATP-binding protein PstB	2.06e-10	NA	6.50e-13	NA
7. B	Q2GFZ6	Zinc import ATP-binding protein ZnuC	1.72e-04	NA	1.08e-07	NA
7. B	Q12R52	Hemin import ATP-binding protein HmuV	3.91e-05	NA	3.14e-05	NA
7. B	P78966	Mating factor M secretion protein mam1	2.54e-03	NA	1.55e-06	NA
7. B	Q87DT9	Sulfate/thiosulfate import ATP-binding protein CysA	3.68e-04	NA	5.15e-18	NA
7. B	Q7W359	Hemin import ATP-binding protein HmuV	1.68e-04	NA	0.005	NA
7. B	Q0TBX8	Nickel import ATP-binding protein NikE	5.91e-07	NA	2.82e-23	NA
7. B	A0KPH6	Zinc import ATP-binding protein ZnuC	3.92e-06	NA	9.56e-10	NA
7. B	Q68W42	Putative export ATP-binding/permease protein RT0691	1.25e-04	NA	1.32e-07	NA
7. B	Q164K3	Ribose import ATP-binding protein RbsA	5.59e-05	NA	2.39e-04	NA
7. B	Q9S4Z0	Methionine import ATP-binding protein MetN	2.96e-05	NA	5.61e-22	NA
7. B	Q668E1	Phosphate import ATP-binding protein PstB 1	1.13e-10	NA	2.13e-08	NA
7. B	P0C0E9	Energy-coupling factor transporter ATP-binding protein EcfA	7.84e-05	NA	8.90e-13	NA
7. B	Q5XDV5	Probable ABC transporter ATP-binding protein M6_Spy0273	4.66e-04	NA	0.009	NA
7. B	Q8T5Z7	ABC transporter A family member 1	6.77e-04	NA	2.66e-04	NA
7. B	Q10185	ATP-binding cassette transporter abc2	3.55e-03	NA	0.014	NA
7. B	P16679	Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL	7.12e-03	NA	3.96e-04	NA
7. B	Q55195	Phosphate import ATP-binding protein PstB 2	1.36e-03	NA	6.91e-09	NA
7. B	P11599	Alpha-hemolysin translocation ATP-binding protein HlyB	7.06e-04	NA	3.49e-10	NA
7. B	Q5LZU2	Phosphate import ATP-binding protein PstB 2	1.85e-06	NA	4.04e-08	NA
7. B	Q66AF5	Arabinose import ATP-binding protein AraG	5.41e-05	NA	0.004	NA
7. B	Q49ZD9	Energy-coupling factor transporter ATP-binding protein EcfA2	5.59e-05	NA	2.56e-12	NA
7. B	Q8YCN7	Nickel import ATP-binding protein NikE	4.68e-08	NA	4.65e-26	NA
7. B	Q1H377	Phosphate import ATP-binding protein PstB	3.29e-05	NA	2.72e-10	NA
7. B	Q578S7	Nickel import ATP-binding protein NikE	6.94e-07	NA	4.65e-26	NA
7. B	Q927Z7	Phosphate import ATP-binding protein PstB 2	2.54e-06	NA	1.70e-12	NA
7. B	Q2GJA5	Zinc import ATP-binding protein ZnuC	5.96e-05	NA	2.95e-11	NA
7. B	Q17VE0	Methionine import ATP-binding protein MetN	6.75e-06	NA	1.23e-21	NA
7. B	Q86HQ2	ABC transporter G family member 8	1.33e-02	NA	7.25e-04	NA
7. B	Q00564	Lactococcin-A transport/processing ATP-binding protein LcnC	2.56e-04	NA	3.96e-08	NA
7. B	Q73GK9	Zinc import ATP-binding protein ZnuC	2.92e-04	NA	2.40e-08	NA
7. B	Q9PBK0	Phosphate import ATP-binding protein PstB	2.09e-06	NA	4.66e-09	NA
7. B	Q7NPP4	Phosphate import ATP-binding protein PstB 1	1.61e-04	NA	2.60e-12	NA
7. B	Q66EY9	Autoinducer 2 import ATP-binding protein LsrA	8.97e-04	NA	5.04e-07	NA
7. B	Q18K56	Phosphate import ATP-binding protein PstB	1.01e-05	NA	2.97e-10	NA
7. B	P0AAG4	Glutamate/aspartate import ATP-binding protein GltL	5.91e-12	NA	1.91e-15	NA
7. B	Q7CIC2	Zinc import ATP-binding protein ZnuC	8.46e-04	NA	2.41e-08	NA
7. B	P16676	Sulfate/thiosulfate import ATP-binding protein CysA	5.92e-04	NA	5.32e-15	NA
7. B	Q880A6	Phosphate import ATP-binding protein PstB 1	8.91e-04	NA	4.25e-11	NA
7. B	Q0C0L5	Phosphate import ATP-binding protein PstB	1.68e-06	NA	9.46e-11	NA
7. B	Q11NG0	Phosphate import ATP-binding protein PstB	8.94e-07	NA	7.15e-12	NA
7. B	Q8XJX3	Ribose import ATP-binding protein RbsA	7.41e-05	NA	2.54e-05	NA
7. B	Q6FCW7	Phosphate import ATP-binding protein PstB	2.40e-06	NA	1.04e-12	NA
7. B	Q3YUN6	Phosphonates import ATP-binding protein PhnC	9.56e-06	NA	6.41e-07	NA
7. B	Q2FYQ0	Phosphate import ATP-binding protein PstB	1.97e-06	NA	1.73e-10	NA
7. B	Q1D320	Phosphate import ATP-binding protein PstB	2.43e-06	NA	1.10e-10	NA
7. B	Q47CB7	Molybdenum import ATP-binding protein ModC	1.37e-03	NA	6.18e-12	NA
7. B	Q9FNU2	ABC transporter B family member 25	2.47e-04	NA	1.01e-09	NA
7. B	Q54K24	ABC transporter C family member 14	1.70e-02	NA	0.016	NA
7. B	Q1LFZ8	Cytochrome c biogenesis ATP-binding export protein CcmA 2	6.95e-04	NA	0.001	NA
7. B	Q5JEB0	Molybdate/tungstate import ATP-binding protein WtpC	6.93e-05	NA	4.59e-14	NA
7. B	Q5LBQ4	Phosphate import ATP-binding protein PstB	1.85e-06	NA	1.20e-10	NA
7. B	Q4WSI1	ABC multidrug transporter mdr4	3.63e-03	NA	2.23e-08	NA
7. B	Q9LHK4	Putative ABC transporter B family member 8	2.21e-02	NA	1.34e-07	NA
7. B	F1MWM0	Retinal-specific phospholipid-transporting ATPase ABCA4	NA	NA	2.80e-04	NA
7. B	P48410	ATP-binding cassette sub-family D member 1	8.71e-03	NA	0.018	NA
7. B	Q54VJ0	ABC transporter C family member 2	4.66e-03	NA	0.002	NA
7. B	Q3JYY5	Phosphate import ATP-binding protein PstB 3	8.37e-07	NA	2.24e-11	NA
7. B	Q9UNQ0	Broad substrate specificity ATP-binding cassette transporter ABCG2	1.11e-02	NA	0.005	NA
7. B	Q576E0	Putative ATP-binding protein BruAb2_1123	3.19e-04	NA	0.001	NA
7. B	Q6G9I1	Nickel import system ATP-binding protein NikE	9.54e-07	NA	6.03e-18	NA
7. B	Q5V0G3	Phosphate import ATP-binding protein PstB 2	8.72e-06	NA	1.21e-09	NA
7. B	Q9CHL8	Multidrug resistance ABC transporter ATP-binding and permease protein	1.88e-05	NA	2.23e-06	NA
7. B	Q66D26	Phosphonates import ATP-binding protein PhnC	5.23e-09	NA	1.29e-10	NA
7. B	Q8VZZ4	ABC transporter C family member 6	2.49e-02	NA	0.007	NA
7. B	Q83D84	ATP-dependent lipid A-core flippase	7.26e-05	NA	2.54e-05	NA
7. B	Q2NHW1	Phosphate import ATP-binding protein PstB	1.34e-06	NA	1.46e-08	NA
7. B	Q5Z293	Phosphate import ATP-binding protein PstB	1.15e-03	NA	0.018	NA
7. B	Q8FHR3	Uncharacterized ABC transporter ATP-binding protein YcjV	1.62e-04	NA	8.31e-12	NA
7. B	H6TB12	Sophorolipid transporter	4.23e-03	NA	3.23e-08	NA
7. B	D4AYW0	ABC transporter G family member ARB_01379	3.64e-02	NA	0.003	NA
7. B	Q57IS3	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.21e-04	NA	1.05e-10	NA
7. B	O83078	Probable metal transport system ATP-binding protein TP_0035	7.37e-04	NA	0.009	NA
7. B	Q12M46	ATP-dependent lipid A-core flippase	4.38e-06	NA	3.29e-06	NA
7. B	Q4QK92	Phosphate import ATP-binding protein PstB	6.99e-11	NA	2.40e-12	NA
7. B	Q13LC4	Phosphonates import ATP-binding protein PhnC	4.49e-06	NA	1.32e-08	NA
7. B	Q5E5I1	Hemin import ATP-binding protein HmuV	3.34e-04	NA	6.33e-05	NA
7. B	Q1MAA2	Putative ribose/galactose/methyl galactoside import ATP-binding protein	6.30e-05	NA	4.07e-05	NA
7. B	Q9KL04	Maltose/maltodextrin import ATP-binding protein MalK	1.95e-04	NA	1.28e-14	NA
7. B	D4GP39	Xylose/arabinose import ATP-binding protein XacK	2.66e-04	NA	4.98e-13	NA
7. B	Q99PE7	ATP-binding cassette sub-family G member 5	5.76e-03	NA	8.01e-04	NA
7. B	Q9NUT2	Mitochondrial potassium channel ATP-binding subunit	4.16e-04	NA	6.09e-06	NA
7. B	Q8D4H4	Galactose/methyl galactoside import ATP-binding protein MglA	6.16e-04	NA	2.12e-04	NA
7. B	Q9KSD1	Galactose/methyl galactoside import ATP-binding protein MglA	2.32e-04	NA	8.46e-05	NA
7. B	Q1J6D1	Phosphate import ATP-binding protein PstB 2	3.28e-06	NA	9.53e-10	NA
7. B	Q9HNI8	Phosphonates import ATP-binding protein PhnC	1.66e-04	NA	9.57e-11	NA
7. B	P07109	Histidine transport ATP-binding protein HisP	1.16e-05	NA	1.45e-13	NA
7. B	P40416	Iron-sulfur clusters transporter ATM1, mitochondrial	2.12e-04	NA	3.29e-04	NA
7. B	Q49XC6	Phosphonates import ATP-binding protein PhnC	3.80e-06	NA	1.14e-10	NA
7. B	Q13GD4	Aliphatic sulfonates import ATP-binding protein SsuB 3	9.56e-08	NA	1.08e-07	NA
7. B	Q897I2	Putative ABC transporter ATP-binding protein CTC_00753	1.03e-03	NA	6.99e-07	NA
7. B	A1VYW8	Macrolide export ATP-binding/permease protein MacB	3.30e-02	NA	1.72e-07	NA
7. B	Q0TJD9	ATP-dependent lipid A-core flippase	3.96e-04	NA	7.68e-08	NA
7. B	Q7VLS9	Zinc import ATP-binding protein ZnuC	2.17e-04	NA	1.00e-09	NA
7. B	P16677	Phosphonates import ATP-binding protein PhnC	3.94e-09	NA	6.35e-07	NA
7. B	P0AAH4	Putrescine export system ATP-binding protein SapD	1.82e-07	NA	2.05e-22	NA
7. B	Q6N0P7	Molybdenum import ATP-binding protein ModC	2.15e-03	NA	2.96e-13	NA
7. B	Q8UH62	Sulfate/thiosulfate import ATP-binding protein CysA 1	8.18e-04	NA	4.63e-18	NA
7. B	Q02XM9	Ribose import ATP-binding protein RbsA	1.40e-05	NA	2.76e-05	NA
7. B	Q8E2L2	Energy-coupling factor transporter ATP-binding protein EcfA1	6.72e-05	NA	3.08e-13	NA
7. B	Q6G9H4	Phosphate import ATP-binding protein PstB	3.64e-06	NA	1.73e-10	NA
7. B	Q6CYN3	Phosphate import ATP-binding protein PstB 2	1.14e-03	NA	2.10e-12	NA
7. B	Q704E8	Iron-sulfur clusters transporter ABCB7, mitochondrial	7.49e-05	NA	4.11e-06	NA
7. B	Q1PEH6	ABC transporter A family member 3	1.21e-03	NA	1.31e-04	NA
7. B	Q92UX0	Taurine import ATP-binding protein TauB	7.62e-05	NA	3.11e-10	NA
7. B	Q7XA72	ABC transporter G family member 21	3.78e-02	NA	0.010	NA
7. B	Q99758	Phospholipid-transporting ATPase ABCA3	9.28e-03	NA	2.06e-05	NA
7. B	Q8L1U3	Hemin import ATP-binding protein HmuV	2.42e-04	NA	8.97e-05	NA
7. B	Q8FVV5	Fe(3+) ions import ATP-binding protein FbpC	2.07e-04	NA	8.29e-13	NA
7. B	Q8Z9I6	Thiamine import ATP-binding protein ThiQ	1.34e-05	NA	1.48e-11	NA
7. B	Q7N986	Maltose/maltodextrin import ATP-binding protein MalK	1.88e-04	NA	2.41e-15	NA
7. B	B8K1W2	Bile salt export pump	7.82e-03	NA	4.05e-06	NA
7. B	Q9FUT3	ABC transporter B family member 23, mitochondrial	7.65e-04	NA	8.15e-07	NA
7. B	Q552P3	ABC transporter A family member 11	8.51e-04	NA	0.001	NA
7. B	A1A9L0	Aliphatic sulfonates import ATP-binding protein SsuB	1.78e-04	NA	1.97e-13	NA
7. B	Q5FMM1	Phosphonates import ATP-binding protein PhnC	6.91e-05	NA	3.49e-09	NA
7. B	Q9LK62	ABC transporter C family member 7	5.64e-02	NA	0.007	NA
7. B	Q96J66	ATP-binding cassette sub-family C member 11	2.24e-02	NA	0.027	NA
7. B	Q3K198	Phosphate import ATP-binding protein PstB 2	3.17e-10	NA	2.93e-11	NA
7. B	P63377	Phosphate import ATP-binding protein PstB 1	1.54e-06	NA	1.58e-07	NA
7. B	Q8Z2X5	Autoinducer 2 import ATP-binding protein LsrA	5.82e-04	NA	2.36e-07	NA
7. B	Q7UU57	Ribose import ATP-binding protein RbsA	1.78e-04	NA	0.011	NA
7. B	Q1CMQ3	Thiamine import ATP-binding protein ThiQ	2.21e-05	NA	1.85e-10	NA
7. B	Q9M2V6	ABC transporter G family member 17	5.54e-02	NA	0.042	NA
7. B	Q63563	ATP-binding cassette sub-family C member 9	7.60e-03	NA	2.76e-04	NA
7. B	Q9K7C3	L-arabinose transport ATP-binding protein AraG	4.43e-05	NA	3.38e-05	NA
7. B	Q7CFR2	Xylose import ATP-binding protein XylG	1.69e-04	NA	1.65e-04	NA
7. B	Q2LVL0	ATP-dependent lipid A-core flippase	5.43e-05	NA	1.11e-08	NA
7. B	Q9KHT9	Carnitine transport ATP-binding protein OpuCA	9.00e-05	NA	1.53e-16	NA
7. B	Q1GL85	Zinc import ATP-binding protein ZnuC	2.87e-07	NA	3.54e-07	NA
7. B	Q7N3S7	Hemin import ATP-binding protein HmuV	2.69e-04	NA	4.94e-06	NA
7. B	A3DDF6	Spermidine/putrescine import ATP-binding protein PotA	3.24e-04	NA	1.42e-12	NA
7. B	Q81LM1	Petrobactin import ATP-binding protein FpuC	2.49e-04	NA	1.73e-08	NA
7. B	Q3AXX4	Phosphate import ATP-binding protein PstB	3.67e-06	NA	1.03e-05	NA
7. B	Q4QP85	Fe(3+) ions import ATP-binding protein FbpC	5.30e-04	NA	2.44e-16	NA
7. B	Q89A97	Multidrug resistance-like ATP-binding protein MdlA	7.38e-05	NA	3.21e-05	NA
7. B	Q5X627	Spermidine/putrescine import ATP-binding protein PotA	4.36e-04	NA	2.86e-14	NA
7. B	Q8FVN0	Nickel import ATP-binding protein NikE	5.80e-08	NA	4.43e-26	NA
7. B	Q28VL7	Thiamine import ATP-binding protein ThiQ	4.34e-06	NA	2.53e-09	NA
7. B	P76027	Oligopeptide transport ATP-binding protein OppD	6.75e-08	NA	1.03e-33	NA
7. B	Q13ZK7	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.17e-03	NA	5.30e-13	NA
7. B	Q9NP58	ATP-binding cassette sub-family B member 6	7.78e-04	NA	3.60e-06	NA
7. B	Q57RH4	Molybdenum import ATP-binding protein ModC	1.61e-03	NA	1.16e-04	NA
7. B	Q9VSS1	Protein Pixie	1.00e-02	NA	0.002	NA
7. B	Q1BT84	Taurine import ATP-binding protein TauB	1.17e-04	NA	1.84e-10	NA
7. B	P9WQM1	Sulfate/thiosulfate import ATP-binding protein CysA	2.19e-04	NA	1.70e-19	NA
7. B	Q8ZX91	Phosphate import ATP-binding protein PstB	7.29e-07	NA	2.40e-12	NA
7. B	Q9M9E1	ABC transporter G family member 40	3.40e-02	NA	0.041	NA
7. B	Q9CIS8	Energy-coupling factor transporter ATP-binding protein EcfA2	3.13e-04	NA	8.84e-12	NA
7. B	Q8XNY7	Putative ABC transporter ATP-binding protein CPE0195	4.15e-05	NA	1.38e-13	NA
7. B	Q9SGY1	ABC transporter B family member 10	1.26e-02	NA	3.91e-09	NA
7. B	Q5M4F2	Phosphate import ATP-binding protein PstB 2	1.87e-06	NA	4.04e-08	NA
7. B	Q9Z810	Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563	1.32e-04	NA	6.63e-08	NA
7. B	Q92N13	Hemin import ATP-binding protein HmuV	4.07e-04	NA	3.46e-05	NA
7. B	Q81V82	Petrobactin import ATP-binding protein FpuD	1.24e-04	NA	4.69e-08	NA
7. B	Q4UV65	ATP-dependent lipid A-core flippase	4.11e-04	NA	4.45e-08	NA
7. B	Q5HVG3	Macrolide export ATP-binding/permease protein MacB	3.72e-02	NA	6.34e-08	NA
7. B	Q13W55	Phosphate import ATP-binding protein PstB	3.70e-05	NA	6.06e-11	NA
7. B	Q02R79	Spermidine/putrescine import ATP-binding protein PotA	1.26e-04	NA	1.11e-15	NA
7. B	Q4ZQE3	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.22e-04	NA	3.08e-09	NA
7. B	Q8XZX8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.50e-04	NA	5.84e-11	NA
7. B	Q07PZ0	Phosphonates import ATP-binding protein PhnC 1	6.31e-05	NA	3.23e-13	NA
7. B	P97998	ATP-dependent permease MDL1	2.36e-04	NA	7.85e-10	NA
7. B	Q0TUN8	Energy-coupling factor transporter ATP-binding protein EcfA3	4.96e-05	NA	1.70e-14	NA
7. B	Q4QN44	Ribose import ATP-binding protein RbsA	5.82e-03	NA	8.81e-08	NA
7. B	Q6LR20	Spermidine/putrescine import ATP-binding protein PotA	6.01e-05	NA	9.03e-17	NA
7. B	Q665B6	Aliphatic sulfonates import ATP-binding protein SsuB	2.13e-03	NA	3.42e-16	NA
7. B	Q4WTT9	ABC multidrug transporter mdr1	2.09e-02	NA	1.81e-07	NA
7. B	O06967	Multidrug resistance ABC transporter ATP-binding/permease protein BmrA	1.40e-04	NA	2.27e-05	NA
7. B	Q8CRI7	Energy-coupling factor transporter ATP-binding protein EcfA2	9.53e-05	NA	1.01e-15	NA
7. B	P44513	Fe(3+) ions import ATP-binding protein FbpC 2	5.13e-04	NA	1.99e-16	NA
7. B	Q983H5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.16e-05	NA	2.61e-06	NA
7. B	Q8X5N2	Hemin import ATP-binding protein HmuV	5.83e-04	NA	2.94e-07	NA
7. B	Q5FL41	Spermidine/putrescine import ATP-binding protein PotA	1.30e-04	NA	6.11e-12	NA
7. B	Q3E9B8	ABC transporter G family member 23	3.85e-02	NA	4.27e-05	NA
7. B	Q88ZJ6	Spermidine/putrescine import ATP-binding protein PotA	2.99e-04	NA	2.94e-15	NA
7. B	Q8X6U5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.03e-03	NA	1.07e-10	NA
7. B	A5F1V0	Vitamin B12 import ATP-binding protein BtuD	9.19e-04	NA	0.001	NA
7. B	Q21BF6	Molybdenum import ATP-binding protein ModC	2.12e-03	NA	4.41e-12	NA
7. B	Q4ZZS2	Zinc import ATP-binding protein ZnuC	1.54e-04	NA	5.36e-10	NA
7. B	P23174	Phosphatidylcholine translocator ABCB4	8.73e-04	NA	3.57e-09	NA
7. B	A0K739	Aliphatic sulfonates import ATP-binding protein SsuB 1	9.39e-04	NA	3.60e-13	NA
7. B	Q1MCN6	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	1.36e-04	NA	1.19e-12	NA
7. B	Q5NIG3	ATP-dependent lipid A-core flippase	6.20e-05	NA	5.66e-07	NA
7. B	Q8Y0X3	Methionine import ATP-binding protein MetN	1.70e-05	NA	4.41e-23	NA
7. B	Q8D7T7	Ribose import ATP-binding protein RbsA	2.60e-03	NA	8.93e-08	NA
7. B	P16521	Elongation factor 3A	9.24e-03	NA	0.020	NA
7. B	Q48CA0	Aliphatic sulfonates import ATP-binding protein SsuB 3	3.13e-04	NA	5.34e-16	NA
7. B	Q9FJH6	ABC transporter F family member 1	6.21e-05	NA	0.001	NA
7. B	Q0ASQ1	Phosphonates import ATP-binding protein PhnC	2.67e-09	NA	1.59e-07	NA
7. B	P74548	Sulfate/thiosulfate import ATP-binding protein CysA	2.77e-04	NA	4.65e-17	NA
7. B	Q98DW6	Taurine import ATP-binding protein TauB	2.84e-04	NA	2.83e-07	NA
7. B	Q02QE8	Phosphonates import ATP-binding protein PhnC 2	1.32e-04	NA	1.09e-05	NA
7. B	A9MZG1	Autoinducer 2 import ATP-binding protein LsrA	9.97e-04	NA	2.32e-07	NA
7. B	Q160Y9	Zinc import ATP-binding protein ZnuC	1.64e-04	NA	1.41e-05	NA
7. B	Q20Z38	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.32e-04	NA	4.06e-07	NA
7. B	Q65E55	Ribose import ATP-binding protein RbsA	3.68e-05	NA	2.81e-05	NA
7. B	Q9CNP9	Thiamine import ATP-binding protein ThiQ	4.34e-05	NA	1.48e-10	NA
7. B	Q0A4U4	ATP-dependent lipid A-core flippase	2.88e-04	NA	3.91e-08	NA
7. B	Q8U4L3	Putative ABC transporter ATP-binding protein PF0068	1.89e-04	NA	2.54e-10	NA
7. B	P0A2V0	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.77e-06	NA	1.77e-06	NA
7. B	Q7ME63	Molybdenum import ATP-binding protein ModC	1.60e-03	NA	1.42e-13	NA
7. B	Q4UMZ3	Putative export ATP-binding/permease protein RF_0214	1.07e-05	NA	2.83e-06	NA
7. B	Q8DMX9	Energy-coupling factor transporter ATP-binding protein EcfA1	1.66e-04	NA	3.97e-14	NA
7. B	Q4JXC5	Phosphate import ATP-binding protein PstB	1.14e-03	NA	0.003	NA
7. B	Q8UIW7	Phosphonates import ATP-binding protein PhnC	1.57e-04	NA	3.19e-09	NA
7. B	Q3YVL7	Phosphate import ATP-binding protein PstB	1.09e-03	NA	1.02e-11	NA
7. B	Q8PC11	Sulfate/thiosulfate import ATP-binding protein CysA	2.52e-04	NA	1.31e-18	NA
7. B	Q8FB37	Maltose/maltodextrin import ATP-binding protein MalK	2.70e-03	NA	1.68e-13	NA
7. B	A1AGY1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.67e-04	NA	6.78e-11	NA
7. B	Q1R528	Xylose import ATP-binding protein XylG	2.24e-04	NA	5.42e-05	NA
7. B	Q3Z3I7	Aliphatic sulfonates import ATP-binding protein SsuB	1.42e-04	NA	2.18e-13	NA
7. B	Q4FMG5	Taurine import ATP-binding protein TauB	1.60e-04	NA	2.26e-08	NA
7. B	Q3KF57	Macrolide export ATP-binding/permease protein MacB 1	6.38e-02	NA	2.93e-08	NA
7. B	Q48TC2	Phosphate import ATP-binding protein PstB 2	3.23e-06	NA	9.53e-10	NA
7. B	Q5L5Z1	Methionine import ATP-binding protein MetN	3.30e-05	NA	2.75e-10	NA
7. B	Q21XJ9	Aliphatic sulfonates import ATP-binding protein SsuB	2.48e-04	NA	5.83e-12	NA
7. B	Q9N0V3	Bile salt export pump	7.58e-03	NA	7.49e-06	NA
7. B	Q0TKS1	Taurine import ATP-binding protein TauB	2.29e-04	NA	3.19e-11	NA
7. B	Q0I4A9	Zinc import ATP-binding protein ZnuC	2.64e-07	NA	7.21e-09	NA
7. B	P77265	Multidrug resistance-like ATP-binding protein MdlA	7.99e-05	NA	4.12e-04	NA
7. B	Q7MKU3	Spermidine/putrescine import ATP-binding protein PotA	6.68e-05	NA	1.28e-16	NA
7. B	Q7MNI7	Phosphate import ATP-binding protein PstB 1	1.29e-03	NA	4.48e-09	NA
7. B	Q8Z4V6	Sulfate/thiosulfate import ATP-binding protein CysA	6.41e-04	NA	1.13e-14	NA
7. B	P30750	Methionine import ATP-binding protein MetN	8.15e-06	NA	9.42e-20	NA
7. B	Q88CL2	Sulfate/thiosulfate import ATP-binding protein CysA	7.46e-05	NA	6.91e-19	NA
7. B	Q3JNY2	Phosphonates import ATP-binding protein PhnC	7.99e-09	NA	1.23e-09	NA
7. B	Q579Z3	Molybdenum import ATP-binding protein ModC	1.47e-03	NA	1.09e-05	NA
7. B	Q03EE4	Energy-coupling factor transporter ATP-binding protein EcfA	2.34e-04	NA	1.81e-12	NA
7. B	Q1MA70	Molybdenum import ATP-binding protein ModC	1.84e-03	NA	2.19e-10	NA
7. B	Q0RKH4	Aliphatic sulfonates import ATP-binding protein SsuB 2	5.40e-04	NA	2.01e-11	NA
7. B	K3VYH8	ABC transporter FPSE_09185	6.73e-03	NA	3.21e-06	NA
7. B	Q8DUF7	Spermidine/putrescine import ATP-binding protein PotA	1.54e-04	NA	4.30e-16	NA
7. B	Q92WJ0	Fe(3+) ions import ATP-binding protein FbpC 1	3.57e-04	NA	1.00e-15	NA
7. B	Q3KDI1	Phosphonates import ATP-binding protein PhnC	1.45e-04	NA	1.71e-09	NA
7. B	Q9SW08	ABC transporter G family member 4	8.61e-03	NA	0.048	NA
7. B	A1B9H9	Aliphatic sulfonates import ATP-binding protein SsuB 1	6.12e-05	NA	2.55e-11	NA
7. B	O85818	Spermidine/putrescine import ATP-binding protein PotA	5.34e-05	NA	3.13e-17	NA
7. B	Q0HYN8	Molybdenum import ATP-binding protein ModC	2.57e-03	NA	1.73e-12	NA
7. B	Q89UD2	Sulfate/thiosulfate import ATP-binding protein CysA	6.54e-04	NA	9.12e-15	NA
7. B	Q8FJR4	Molybdenum import ATP-binding protein ModC	1.61e-03	NA	3.80e-05	NA
7. B	O34677	Glutamine transport ATP-binding protein GlnQ	2.32e-06	NA	9.51e-17	NA
7. B	Q2YJE7	Xylose import ATP-binding protein XylG	3.31e-04	NA	2.05e-05	NA
7. B	Q6G0L7	Phosphate import ATP-binding protein PstB	1.15e-06	NA	2.40e-09	NA
7. B	Q48KB2	Macrolide export ATP-binding/permease protein MacB	6.99e-02	NA	1.71e-08	NA
7. B	Q9SIT6	ABC transporter G family member 5	9.11e-03	NA	0.035	NA
7. B	Q88YN5	Phosphonates import ATP-binding protein PhnC	1.42e-04	NA	1.00e-14	NA
7. B	Q730R7	Phosphate import ATP-binding protein PstB	1.88e-06	NA	2.89e-11	NA
7. B	A0R6H7	Mycobactin import ATP-binding/permease protein IrtB	3.39e-06	NA	2.72e-05	NA
7. B	P0AAF9	Arginine transport ATP-binding protein ArtP	2.74e-07	NA	4.88e-15	NA
7. B	Q6F0P3	Phosphonates import ATP-binding protein PhnC	7.70e-06	NA	1.79e-09	NA
7. B	Q0AUL1	Energy-coupling factor transporter ATP-binding protein EcfA	8.44e-05	NA	5.40e-11	NA
7. B	Q49WM4	Spermidine/putrescine import ATP-binding protein PotA	1.24e-04	NA	1.69e-12	NA
7. B	Q32IZ6	Taurine import ATP-binding protein TauB	2.21e-04	NA	7.51e-12	NA
7. B	P60752	ATP-dependent lipid A-core flippase	1.10e-03	NA	7.62e-08	NA
7. B	Q9PEE7	ATP-dependent lipid A-core flippase	1.24e-04	NA	1.98e-04	NA
7. B	Q6N1Y7	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.75e-04	NA	1.68e-06	NA
7. B	Q0SBZ1	Fe(3+) ions import ATP-binding protein FbpC 1	8.22e-04	NA	1.16e-16	NA
7. B	Q2G2M9	Putative multidrug export ATP-binding/permease protein SAOUHSC_02003	1.06e-05	NA	2.24e-07	NA
7. B	P57013	Capsule polysaccharide export ATP-binding protein CtrD	1.00e-03	NA	0.028	NA
7. B	H2LNR5	Iron-sulfur clusters transporter ABCB7, mitochondrial	4.81e-05	NA	1.25e-08	NA
7. B	O14134	mRNA export factor elf1	9.16e-03	NA	2.28e-04	NA
7. B	Q2T8T6	Ribose import ATP-binding protein RbsA 2	2.00e-03	NA	0.002	NA
7. B	P56344	Probable sulfate/thiosulfate import ATP-binding protein CysA	1.60e-06	NA	3.90e-19	NA
7. B	Q2RGX2	Xylose import ATP-binding protein XylG	2.37e-04	NA	3.19e-05	NA
7. B	Q82MV1	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.87e-03	NA	1.07e-08	NA
7. B	Q5P1F3	Phosphate import ATP-binding protein PstB	5.46e-05	NA	6.00e-09	NA
7. B	Q7MPC5	Thiamine import ATP-binding protein ThiQ	3.72e-06	NA	5.91e-10	NA
7. B	P9WQL9	Doxorubicin resistance ATP-binding protein DrrA	6.89e-04	NA	3.27e-04	NA
7. B	Q87UN0	Zinc import ATP-binding protein ZnuC	1.78e-04	NA	3.06e-10	NA
7. B	P23878	Ferric enterobactin transport ATP-binding protein FepC	1.36e-04	NA	1.24e-05	NA
7. B	A0QFE1	Aliphatic sulfonates import ATP-binding protein SsuB	5.35e-05	NA	6.99e-11	NA
7. B	Q664X5	Maltose/maltodextrin import ATP-binding protein MalK	2.48e-03	NA	6.75e-14	NA
7. B	Q62K56	Aliphatic sulfonates import ATP-binding protein SsuB	1.29e-04	NA	3.72e-12	NA
7. B	Q87GB5	Maltose/maltodextrin import ATP-binding protein MalK	7.40e-04	NA	1.23e-13	NA
7. B	P63362	Phosphate import ATP-binding protein PstB	5.64e-06	NA	7.68e-11	NA
7. B	Q5PKW4	Phosphate import ATP-binding protein PstB	5.04e-06	NA	1.08e-11	NA
7. B	Q0SK28	Aliphatic sulfonates import ATP-binding protein SsuB 1	3.39e-04	NA	1.31e-10	NA
7. B	Q6DB87	Ribose import ATP-binding protein RbsA	9.09e-05	NA	3.78e-07	NA
7. B	Q5E4V6	Ribose import ATP-binding protein RbsA	4.28e-03	NA	3.60e-07	NA
7. B	P41909	Peroxisomal long-chain fatty acid import protein 2	1.52e-02	NA	0.003	NA
7. B	P33982	Probable ABC transporter ATP-binding protein AZC_3926	3.58e-05	NA	5.89e-04	NA
7. B	Q8YYE3	Phosphate import ATP-binding protein PstB 1	4.45e-07	NA	4.08e-10	NA
7. B	Q6MD10	Lipoprotein-releasing system ATP-binding protein LolD	3.30e-05	NA	3.05e-05	NA
7. B	P21439	Phosphatidylcholine translocator ABCB4	8.26e-04	NA	3.96e-09	NA
7. B	Q3K4F5	Phosphate import ATP-binding protein PstB	1.33e-03	NA	9.61e-10	NA
7. B	Q987E7	Ribose import ATP-binding protein RbsA 2	7.01e-05	NA	0.010	NA
7. B	Q87U31	Phosphate import ATP-binding protein PstB 2	1.30e-03	NA	9.54e-09	NA
7. B	Q62AW4	Taurine import ATP-binding protein TauB	1.01e-04	NA	8.06e-07	NA
7. B	Q2SPI3	Zinc import ATP-binding protein ZnuC 1	1.44e-03	NA	4.36e-10	NA
7. B	G5EFD4	Heavy metal tolerance factor 1	9.23e-05	NA	3.20e-07	NA
7. B	Q6Q876	Multidrug resistance protein sirA	1.22e-03	NA	2.82e-07	NA
7. B	A1JJ55	Autoinducer 2 import ATP-binding protein LsrA	1.01e-04	NA	3.86e-07	NA
7. B	Q83KR7	Zinc import ATP-binding protein ZnuC	1.44e-03	NA	7.36e-09	NA
7. B	P0AAF6	Arginine transport ATP-binding protein ArtP	2.66e-07	NA	4.88e-15	NA
7. B	Q31BF6	Phosphate import ATP-binding protein PstB	1.23e-03	NA	1.36e-04	NA
7. B	Q9ZU35	ABC transporter G family member 7	3.96e-02	NA	0.009	NA
7. B	Q4QLQ1	Thiamine import ATP-binding protein ThiQ	4.12e-05	NA	2.62e-14	NA
7. B	Q8ZKV9	Ribose import ATP-binding protein RbsA	1.26e-04	NA	2.96e-07	NA
7. B	Q7UP21	Phosphate import ATP-binding protein PstB	1.26e-10	NA	1.05e-10	NA
7. B	P0AAG3	Glutamate/aspartate import ATP-binding protein GltL	6.52e-12	NA	1.91e-15	NA
7. B	Q31V51	Xylose import ATP-binding protein XylG	8.55e-04	NA	5.23e-05	NA
7. B	P0C0E8	Energy-coupling factor transporter ATP-binding protein EcfA1	7.58e-05	NA	8.49e-13	NA
7. B	Q9RCG7	Exotoxin translocation ATP-binding protein PaxB	6.18e-04	NA	7.49e-10	NA
7. B	A3DJK5	Energy-coupling factor transporter ATP-binding protein EcfA2	5.69e-05	NA	5.46e-11	NA
7. B	Q166A0	Phosphate import ATP-binding protein PstB	1.13e-03	NA	8.79e-11	NA
7. B	Q2W8B4	Phosphate import ATP-binding protein PstB 1	1.34e-06	NA	1.50e-11	NA
7. B	Q3IZT1	Lipoprotein-releasing system ATP-binding protein LolD	1.87e-05	NA	1.28e-05	NA
7. B	Q58129	Uncharacterized ABC transporter ATP-binding protein MJ0719	3.68e-02	NA	0.007	NA
7. B	Q9K876	Sulfate/thiosulfate import ATP-binding protein CysA	7.30e-04	NA	1.35e-18	NA
7. B	A0ALT7	Energy-coupling factor transporter ATP-binding protein EcfA1	1.17e-04	NA	5.00e-12	NA
7. B	Q7N8B9	Fe(3+) ions import ATP-binding protein FbpC	1.72e-04	NA	7.53e-16	NA
7. B	Q2YKZ7	Putative ATP-binding protein BAB2_0493	2.05e-04	NA	6.82e-14	NA
7. B	P25885	Uncharacterized ABC transporter ATP-binding protein R00382	8.60e-05	NA	2.81e-05	NA
7. B	Q9KRT4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.92e-04	NA	1.33e-15	NA
7. B	A0A0H2ZGN6	Di/tripeptide transport ATP-binding protein DppD	4.54e-08	NA	9.13e-33	NA
7. B	Q1J449	Energy-coupling factor transporter ATP-binding protein EcfA1	7.50e-05	NA	8.90e-13	NA
7. B	F9X9V4	ABC-type transporter MYCGRDRAFT_41235	1.80e-03	NA	1.37e-04	NA
7. B	Q93SH7	Hemin import ATP-binding protein HmuV	4.70e-04	NA	0.023	NA
7. B	Q8PAG0	Phosphate import ATP-binding protein PstB	8.71e-04	NA	8.53e-10	NA
7. B	Q7TMS5	Broad substrate specificity ATP-binding cassette transporter ABCG2	5.23e-02	NA	0.008	NA
7. B	P53049	Oligomycin resistance ATP-dependent permease YOR1	9.16e-03	NA	7.75e-04	NA
7. B	Q7U0Z9	Phosphate import ATP-binding protein PstB 2	1.85e-06	NA	1.00e-10	NA
7. B	P41233	Phospholipid-transporting ATPase ABCA1	6.21e-02	NA	1.86e-06	NA
7. B	Q609Q1	Sulfate/thiosulfate import ATP-binding protein CysA	4.48e-04	NA	7.01e-17	NA
7. B	Q57HW1	Ribose import ATP-binding protein RbsA	1.94e-04	NA	2.99e-07	NA
7. B	Q0BKJ3	ATP-dependent lipid A-core flippase	5.58e-05	NA	6.96e-07	NA
7. B	Q46TK4	Phosphonates import ATP-binding protein PhnC	1.27e-06	NA	8.52e-07	NA
7. B	Q9LID6	ABC transporter E family member 1	8.91e-03	NA	2.44e-04	NA
7. B	Q8RLB6	Aliphatic sulfonates import ATP-binding protein SsuB	9.28e-05	NA	1.96e-12	NA
7. B	P45022	Probable amino-acid ABC transporter ATP-binding protein HI_1078	6.58e-07	NA	6.80e-18	NA
7. B	Q9H172	ATP-binding cassette sub-family G member 4	1.79e-02	NA	5.60e-05	NA
7. B	Q7N6Z2	Sulfate/thiosulfate import ATP-binding protein CysA	2.03e-04	NA	1.01e-15	NA
7. B	D0MYB4	Elongation factor 3	3.75e-02	NA	6.69e-05	NA
7. B	P9WQK5	Uncharacterized ABC transporter ATP-binding protein Rv0073	4.31e-03	NA	5.23e-05	NA
7. B	Q62IG3	ATP-dependent lipid A-core flippase	3.73e-05	NA	1.96e-06	NA
7. B	Q2IN45	Phosphonates import ATP-binding protein PhnC	2.46e-03	NA	4.75e-04	NA
7. B	Q54LE6	ABC transporter C family member 5	2.14e-02	NA	2.07e-05	NA
7. B	Q160G4	Hemin import ATP-binding protein HmuV	5.81e-04	NA	1.96e-05	NA
7. B	Q98G42	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.51e-04	NA	1.17e-13	NA
7. B	Q8KZQ6	Aliphatic sulfonates import ATP-binding protein SsuB	2.43e-04	NA	5.32e-15	NA
7. B	Q221H2	Phosphate import ATP-binding protein PstB	2.85e-05	NA	6.64e-11	NA
7. B	Q8XAW7	Ribose import ATP-binding protein RbsA 1	1.31e-04	NA	2.96e-07	NA
7. B	Q8E7N9	Ribose import ATP-binding protein RbsA	1.97e-05	NA	2.49e-04	NA
7. B	Q3K3R2	Ribose import ATP-binding protein RbsA	3.28e-05	NA	2.74e-04	NA
7. B	Q49588	Phosphate import ATP-binding protein PstB	1.71e-05	NA	6.15e-11	NA
7. B	P75370	Probable ABC transporter ATP-binding protein p29	1.36e-05	NA	1.34e-10	NA
7. B	Q18KE1	Phosphonates import ATP-binding protein PhnC 1	2.92e-05	NA	1.45e-12	NA
7. B	P45321	Molybdenum import ATP-binding protein ModC	1.36e-03	NA	3.48e-12	NA
7. B	Q1CDC0	Xylose import ATP-binding protein XylG	1.72e-04	NA	1.65e-04	NA
7. B	Q3Z2L6	Zinc import ATP-binding protein ZnuC	1.05e-03	NA	2.78e-09	NA
7. B	Q5WCI1	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.57e-04	NA	3.44e-12	NA
7. B	Q8XPK6	Xylose import ATP-binding protein XylG	4.03e-05	NA	0.002	NA
7. B	Q634R8	Phosphate import ATP-binding protein PstB	1.80e-06	NA	2.89e-11	NA
7. B	Q4ZLA7	Phosphate import ATP-binding protein PstB 2	1.32e-03	NA	1.22e-09	NA
7. B	P9WQL0	Phosphate import ATP-binding protein PstB 1	1.09e-03	NA	0.002	NA
7. B	Q8Z5W6	Zinc import ATP-binding protein ZnuC	1.67e-04	NA	4.10e-09	NA
7. B	Q68Y13	Zinc import ATP-binding protein ZnuC	5.93e-07	NA	3.58e-06	NA
7. B	Q28689	ATP-binding cassette sub-family C member 2	4.46e-02	NA	3.22e-04	NA
7. B	P44808	Probable ATP-binding protein YheS	4.81e-04	NA	0.025	NA
7. B	Q2SVN0	Aliphatic sulfonates import ATP-binding protein SsuB	1.25e-03	NA	2.94e-12	NA
7. B	Q6P542	ATP-binding cassette sub-family F member 1	4.96e-04	NA	4.06e-07	NA
7. B	P0AAF3	Arabinose import ATP-binding protein AraG	3.59e-04	NA	0.004	NA
7. B	P9WER4	ABC-type transporter braE	NA	NA	0.029	NA
7. B	Q7N8V0	Thiamine import ATP-binding protein ThiQ	1.29e-05	NA	2.62e-12	NA
7. B	P9WQK9	Phosphate import ATP-binding protein PstB 2	1.19e-05	NA	1.00e-10	NA
7. B	Q03ZL5	Energy-coupling factor transporter ATP-binding protein EcfA2	5.42e-07	NA	7.59e-07	NA
7. B	Q8FUR8	Xylose import ATP-binding protein XylG	9.72e-05	NA	9.90e-05	NA
7. B	Q4KC87	Fe(3+) ions import ATP-binding protein FbpC	1.52e-04	NA	1.89e-17	NA
7. B	Q1M8R6	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	1.61e-04	NA	1.74e-12	NA
7. B	Q1LLB5	Phosphate import ATP-binding protein PstB	3.41e-05	NA	4.63e-11	NA
7. B	Q2YQP3	Putative ABC transporter ATP-binding protein BAB1_1388	5.22e-05	NA	7.73e-06	NA
7. B	Q2YL69	Nickel import ATP-binding protein NikE	1.46e-08	NA	4.65e-26	NA
7. B	Q03I82	Energy-coupling factor transporter ATP-binding protein EcfA1	1.11e-04	NA	4.92e-11	NA
7. B	P69878	Phosphate import ATP-binding protein PstB	1.96e-06	NA	1.73e-10	NA
7. B	Q8SRV5	Probable ATP-binding cassette sub-family F member 3 homolog	1.44e-03	NA	0.002	NA
7. B	P73450	Nitrate import ATP-binding protein NrtC	1.00e-01	NA	5.48e-10	NA
7. B	Q1GZI0	ATP-dependent lipid A-core flippase	2.23e-04	NA	5.52e-07	NA
7. B	Q1BX03	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	6.17e-05	NA	1.60e-04	NA
7. B	Q6HDP8	Phosphate import ATP-binding protein PstB	1.95e-06	NA	2.89e-11	NA
7. B	O27739	Energy-coupling factor transporter ATP-binding protein EcfA	1.22e-04	NA	9.77e-10	NA
7. B	Q9ZJ34	Methionine import ATP-binding protein MetN	7.10e-06	NA	2.58e-23	NA
7. B	P97046	Multidrug resistance ABC transporter ATP-binding and permease protein	2.06e-05	NA	1.37e-06	NA
7. B	Q5WIL7	Phosphonates import ATP-binding protein PhnC	7.14e-06	NA	1.47e-10	NA
7. B	Q0SQH5	Energy-coupling factor transporter ATP-binding protein EcfA1	2.76e-05	NA	1.81e-16	NA
7. B	Q4FQ27	Zinc import ATP-binding protein ZnuC	8.27e-07	NA	1.51e-06	NA
7. B	Q1R597	Hemin import ATP-binding protein HmuV	5.47e-04	NA	8.21e-07	NA
7. B	Q5E586	Spermidine/putrescine import ATP-binding protein PotA	5.83e-05	NA	9.20e-17	NA
7. B	Q5PIA5	Zinc import ATP-binding protein ZnuC	2.16e-04	NA	4.10e-09	NA
7. B	Q91WA9	ATP-binding cassette subfamily G member 4	1.69e-02	NA	2.20e-04	NA
7. B	Q9I2N4	Molybdenum import ATP-binding protein ModC	2.00e-03	NA	4.45e-12	NA
7. B	Q2SSS4	Spermidine/putrescine import ATP-binding protein PotA	1.59e-04	NA	2.83e-18	NA
7. B	Q0ASG3	Phosphate import ATP-binding protein PstB	8.36e-11	NA	1.88e-08	NA
7. B	Q8FKF5	Taurine import ATP-binding protein TauB	2.27e-04	NA	1.31e-11	NA
7. B	Q5HJM6	Phosphonates import ATP-binding protein PhnC	4.05e-06	NA	4.20e-09	NA
7. B	Q93YS4	ABC transporter G family member 22	6.51e-02	NA	0.013	NA
7. B	Q3Z5U5	Thiamine import ATP-binding protein ThiQ	3.42e-05	NA	3.21e-12	NA
7. B	Q62A98	Hemin import ATP-binding protein HmuV	5.15e-04	NA	1.32e-04	NA
7. B	Q73BM0	Spermidine/putrescine import ATP-binding protein PotA	6.81e-05	NA	1.98e-15	NA
7. B	Q6D645	Hemin import ATP-binding protein HmuV	1.13e-04	NA	1.43e-07	NA
7. B	Q5SSE9	ATP-binding cassette sub-family A member 13	NA	NA	2.52e-04	NA
7. B	Q9UG63	ATP-binding cassette sub-family F member 2	2.96e-04	NA	8.89e-04	NA
7. B	Q2K6L3	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	2.34e-04	NA	6.65e-12	NA
7. B	Q8K449	ATP-binding cassette sub-family A member 9	1.10e-02	NA	3.22e-06	NA
7. B	Q7WP62	Molybdenum import ATP-binding protein ModC	1.94e-03	NA	7.97e-13	NA
7. B	Q8LPK0	ABC transporter A family member 8	3.40e-04	NA	2.05e-04	NA
7. B	P0AAG7	Multidrug resistance-like ATP-binding protein MdlB	2.59e-04	NA	3.75e-04	NA
7. B	Q4GZT4	Broad substrate specificity ATP-binding cassette transporter ABCG2	1.02e-02	NA	0.002	NA
7. B	Q1RAN8	Arabinose import ATP-binding protein AraG	3.51e-04	NA	0.004	NA
7. B	A0A0M3R8G1	ABC transporter G family member STR	1.39e-01	NA	3.06e-04	NA
7. B	Q2YJJ9	Putative peptide import ATP-binding protein BAB2_1052	2.46e-12	NA	1.41e-31	NA
7. B	Q9CXJ4	Mitochondrial potassium channel ATP-binding subunit	1.05e-05	NA	9.75e-07	NA
7. B	Q65SW3	Molybdenum import ATP-binding protein ModC	1.41e-03	NA	2.72e-12	NA
7. B	Q8UCD5	Molybdenum import ATP-binding protein ModC	1.06e-03	NA	2.04e-11	NA
7. B	Q84K47	ABC transporter A family member 2	2.62e-03	NA	7.30e-04	NA
7. B	P68188	Maltose/maltodextrin import ATP-binding protein MalK	2.95e-04	NA	1.84e-13	NA
7. B	Q3K0Y6	Spermidine/putrescine import ATP-binding protein PotA	1.77e-04	NA	1.75e-16	NA
7. B	P23886	ATP-binding/permease protein CydC	3.83e-05	NA	2.93e-07	NA
7. B	P34712	Multidrug resistance protein pgp-1	9.91e-03	NA	4.12e-08	NA
7. B	Q2FZZ2	Methionine import ATP-binding protein MetN 2	1.78e-05	NA	7.68e-20	NA
7. B	Q480N3	ATP-dependent lipid A-core flippase 2	1.61e-04	NA	2.59e-06	NA
7. B	P45843	Protein scarlet	1.21e-02	NA	0.019	NA
7. B	Q2S081	Phosphate import ATP-binding protein PstB	1.00e-03	NA	3.22e-11	NA
7. B	Q3IM36	Phosphate import ATP-binding protein PstB 3	2.79e-03	NA	4.13e-09	NA
7. B	Q8X5I6	Taurine import ATP-binding protein TauB	2.07e-04	NA	8.63e-12	NA
7. B	O34392	ABC transporter ATP-binding protein YtrE	7.91e-06	NA	1.61e-14	NA
7. B	Q3SVV2	Cytochrome c biogenesis ATP-binding export protein CcmA	3.18e-02	NA	0.002	NA
7. B	Q53194	Probable peptide ABC transporter ATP-binding protein y4tS	2.82e-09	NA	2.37e-52	NA
7. B	Q5YZY9	Sulfate/thiosulfate import ATP-binding protein CysA	1.72e-04	NA	2.35e-17	NA
7. B	G7CBF5	Mycobactin import ATP-binding/permease protein IrtA	1.11e-02	NA	0.003	NA
7. B	Q5E3B8	Phosphate import ATP-binding protein PstB 2	1.18e-06	NA	3.65e-10	NA
7. B	P63375	Phosphate import ATP-binding protein PstB 1	1.23e-03	NA	1.58e-07	NA
7. B	Q9CMS0	Molybdenum import ATP-binding protein ModC	1.91e-03	NA	4.61e-11	NA
7. B	Q9USH9	Uncharacterized ABC transporter ATP-binding protein C825.01	8.35e-04	NA	6.88e-04	NA
7. B	P0AAF7	Arginine transport ATP-binding protein ArtP	3.34e-07	NA	4.88e-15	NA
7. B	Q13IS7	Taurine import ATP-binding protein TauB 3	4.30e-04	NA	7.55e-09	NA
7. B	Q0I354	Thiamine import ATP-binding protein ThiQ	4.58e-05	NA	3.17e-15	NA
7. B	Q5JEP9	Phosphate import ATP-binding protein PstB	7.14e-04	NA	2.01e-12	NA
7. B	P94367	ATP-binding/permease protein CydD	4.17e-06	NA	0.002	NA
7. B	Q83HT1	Phosphate import ATP-binding protein PstB	2.41e-06	NA	5.85e-10	NA
7. B	Q9SKX0	ABC transporter C family member 13	2.12e-02	NA	1.09e-04	NA
7. B	P47650	Phosphate import ATP-binding protein PstB	5.21e-07	NA	9.32e-11	NA
7. B	Q1RDU4	ATP-dependent lipid A-core flippase	5.76e-04	NA	7.68e-08	NA
7. B	Q4FQD1	Phosphate import ATP-binding protein PstB	1.77e-06	NA	7.77e-11	NA
7. B	P9WQL2	Molybdenum import ATP-binding protein ModC	3.87e-03	NA	6.20e-11	NA
7. B	Q576K0	Zinc import ATP-binding protein ZnuC	3.85e-03	NA	3.91e-10	NA
7. B	Q89VF2	Phosphate import ATP-binding protein PstB	2.65e-06	NA	2.44e-09	NA
7. B	Q8T6H8	ABC transporter C family member 1	1.24e-03	NA	4.56e-05	NA
7. B	Q9V1Q4	Putative ABC transporter ATP-binding protein PYRAB03730	8.02e-05	NA	1.01e-11	NA
7. B	Q99LE6	ATP-binding cassette sub-family F member 2	1.10e-04	NA	0.001	NA
7. B	Q9C9W0	ABC transporter I family member 17	7.48e-06	NA	1.13e-09	NA
7. B	Q8TIW9	Putative ABC transporter ATP-binding protein MA_4021	8.63e-05	NA	1.12e-04	NA
7. B	Q24PY8	Phosphate import ATP-binding protein PstB	1.02e-03	NA	9.35e-10	NA
7. B	Q6KIS8	Phosphate import ATP-binding protein PstB	6.71e-05	NA	8.42e-11	NA
7. B	P0A9S7	High-affinity branched-chain amino acid transport ATP-binding protein LivG	6.51e-05	NA	2.13e-08	NA
7. B	Q748K0	Putative ABC transporter ATP-binding protein GSU3001	2.20e-04	NA	6.51e-07	NA
7. B	Q83MA0	Taurine import ATP-binding protein TauB	2.14e-04	NA	7.04e-11	NA
7. B	Q4WA92	ABC multidrug transporter E	1.25e-02	NA	7.35e-07	NA
7. B	Q4HVU7	Iron-sulfur clusters transporter ATM1, mitochondrial	1.52e-06	NA	6.38e-07	NA
7. B	P45844	ATP-binding cassette sub-family G member 1	1.29e-02	NA	1.55e-04	NA
7. B	Q7UC29	Sulfate/thiosulfate import ATP-binding protein CysA	4.24e-04	NA	1.39e-15	NA
7. B	P63354	Sulfate/thiosulfate import ATP-binding protein CysA	1.52e-04	NA	2.91e-15	NA
7. B	Q885N4	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.38e-04	NA	2.77e-09	NA
7. B	Q1B8V9	Spermidine/putrescine import ATP-binding protein PotA	3.52e-04	NA	1.11e-16	NA
7. B	Q7N545	Zinc import ATP-binding protein ZnuC	7.84e-04	NA	3.89e-08	NA
7. B	Q4ZTW1	Arabinose import ATP-binding protein AraG	7.10e-04	NA	0.005	NA
7. B	Q0IAC3	Phosphate import ATP-binding protein PstB	3.84e-06	NA	4.71e-06	NA
7. B	P9WQL6	Fluoroquinolones export ATP-binding protein MT2762	2.20e-04	NA	1.36e-04	NA
7. B	Q9AE30	Hemin import ATP-binding protein HmuV	5.95e-04	NA	5.02e-08	NA
7. B	Q5HM28	Energy-coupling factor transporter ATP-binding protein EcfA2	1.04e-04	NA	8.09e-16	NA
7. B	Q1DCP5	Hemin import ATP-binding protein HmuV	5.06e-05	NA	1.09e-04	NA
7. B	Q9CIQ6	Phosphonates import ATP-binding protein PhnC	7.92e-06	NA	2.92e-09	NA
7. B	Q9K6J9	Ribose import ATP-binding protein RbsA	5.10e-05	NA	2.14e-07	NA
7. B	Q9QYJ4	ABC-type oligopeptide transporter ABCB9	3.67e-04	NA	2.31e-04	NA
7. B	Q9FLT8	ABC transporter A family member 12	4.71e-03	NA	7.98e-06	NA
7. B	Q9V2C0	Molybdate/tungstate import ATP-binding protein WtpC	1.79e-04	NA	1.76e-14	NA
7. B	A1B9K8	Zinc import ATP-binding protein ZnuC	7.58e-04	NA	1.22e-05	NA
7. B	Q50966	Fe(3+) ions import ATP-binding protein FbpC	4.39e-04	NA	6.52e-16	NA
7. B	Q31I51	Zinc import ATP-binding protein ZnuC	1.71e-07	NA	6.52e-08	NA
7. B	Q7VI92	Methionine import ATP-binding protein MetN	1.01e-05	NA	7.67e-26	NA
7. B	Q3MH62	Phosphate import ATP-binding protein PstB 1	4.93e-06	NA	3.17e-09	NA
7. B	Q8X5U1	Nickel import ATP-binding protein NikD	2.36e-06	NA	1.68e-18	NA
7. B	P0AAG6	Multidrug resistance-like ATP-binding protein MdlB	3.23e-04	NA	3.75e-04	NA
7. B	Q55107	Bicarbonate transport ATP-binding protein CmpC	4.68e-03	NA	1.04e-09	NA
7. B	P35116	Nopaline permease ATP-binding protein P	1.34e-05	NA	1.26e-16	NA
7. B	Q6D654	Vitamin B12 import ATP-binding protein BtuD	5.69e-04	NA	8.07e-04	NA
7. B	Q74DN5	Putative ABC transporter ATP-binding protein GSU1281	2.16e-04	NA	7.42e-12	NA
7. B	Q8D954	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.32e-04	NA	1.47e-15	NA
7. B	Q2YJB5	Putative ATP-binding protein BAB2_1147	3.13e-04	NA	0.002	NA
7. B	Q8DIA0	Sulfate/thiosulfate import ATP-binding protein CysA	2.79e-04	NA	2.65e-17	NA
7. B	Q63VX7	ATP-dependent lipid A-core flippase	3.55e-05	NA	1.96e-06	NA
7. B	Q2SB47	Hemin import ATP-binding protein HmuV	8.68e-04	NA	1.20e-05	NA
7. B	Q483B6	ATP-dependent lipid A-core flippase 1	2.29e-04	NA	7.21e-09	NA
7. B	O95477	Phospholipid-transporting ATPase ABCA1	1.78e-02	NA	2.67e-05	NA
7. B	Q8KDZ5	Phosphate import ATP-binding protein PstB	4.69e-06	NA	3.63e-10	NA
7. B	P0A2U7	Zinc transport system ATP-binding protein AdcC	2.83e-06	NA	1.23e-04	NA
7. B	Q578K3	Fe(3+) ions import ATP-binding protein FbpC	1.35e-04	NA	5.28e-14	NA
7. B	Q54U44	ABC transporter C family member 12	1.27e-02	NA	2.59e-04	NA
7. B	P35598	Putative ABC transporter ATP-binding protein exp8	2.34e-05	NA	4.35e-04	NA
7. B	Q1IGY7	Zinc import ATP-binding protein ZnuC	1.03e-03	NA	9.74e-10	NA
7. B	Q881C1	Molybdenum import ATP-binding protein ModC	1.45e-03	NA	1.59e-13	NA
7. B	Q62K72	Nod factor export ATP-binding protein I	1.18e-03	NA	0.006	NA
7. B	Q8H1R4	ABC transporter I family member 10	7.68e-05	NA	0.001	NA
7. B	B1XEA1	Autoinducer 2 import ATP-binding protein LsrA	1.13e-03	NA	1.56e-07	NA
7. B	Q9AB70	Phosphonates import ATP-binding protein PhnC	2.39e-09	NA	7.32e-08	NA
7. B	P63366	Phosphate import ATP-binding protein PstB	1.14e-03	NA	1.08e-11	NA
7. B	P94411	Uncharacterized ABC transporter ATP-binding protein YclH	9.55e-05	NA	1.02e-05	NA
7. B	Q6GCY2	Phosphonates import ATP-binding protein PhnC	3.53e-06	NA	4.20e-09	NA
7. B	Q8PKS5	ATP-dependent lipid A-core flippase	2.34e-04	NA	2.98e-07	NA
7. B	P45046	Xylose import ATP-binding protein XylG	2.23e-04	NA	9.48e-05	NA
7. B	Q8RGC8	Fe(3+) ions import ATP-binding protein FbpC	2.36e-04	NA	1.82e-16	NA
7. B	Q63R24	Phosphonates import ATP-binding protein PhnC	8.04e-09	NA	1.23e-09	NA
7. B	P0AAH2	Phosphate import ATP-binding protein PstB	1.12e-03	NA	1.02e-11	NA
7. B	Q6VMN4	Xylose import ATP-binding protein XylG	6.12e-05	NA	1.36e-06	NA
7. B	A0KE53	Xylose import ATP-binding protein XylG	9.61e-05	NA	0.002	NA
7. B	Q0S6U9	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.73e-04	NA	1.28e-13	NA
7. B	Q0BUR6	Aliphatic sulfonates import ATP-binding protein SsuB	1.23e-04	NA	2.46e-10	NA
7. B	Q17320	Protein white	1.72e-02	NA	0.013	NA
7. B	P10346	Glutamine transport ATP-binding protein GlnQ	2.29e-06	NA	2.86e-14	NA
7. B	Q65UG3	Zinc import ATP-binding protein ZnuC	1.67e-04	NA	7.62e-09	NA
7. B	Q882S0	Phosphonates import ATP-binding protein PhnC 2	1.38e-06	NA	3.01e-07	NA
7. B	Q2G2A7	Spermidine/putrescine import ATP-binding protein PotA	1.28e-04	NA	1.05e-12	NA
7. B	P0A9T8	Uncharacterized ABC transporter ATP-binding protein YbbA	2.57e-03	NA	9.59e-09	NA
7. B	Q9KSL1	Vitamin B12 import ATP-binding protein BtuD	9.97e-04	NA	2.41e-04	NA
7. B	Q1GUY1	Phosphate import ATP-binding protein PstB	1.75e-06	NA	3.86e-09	NA
7. B	Q9QY44	ATP-binding cassette sub-family D member 2	7.05e-03	NA	0.017	NA
7. B	Q5X9B5	Energy-coupling factor transporter ATP-binding protein EcfA1	7.58e-05	NA	8.90e-13	NA
7. B	Q57293	Fe(3+) ions import ATP-binding protein FbpC	3.37e-04	NA	3.96e-12	NA
7. B	P63363	Phosphate import ATP-binding protein PstB 1	2.00e-06	NA	3.80e-12	NA
7. B	Q63TX3	Nod factor export ATP-binding protein I	1.21e-03	NA	0.006	NA
7. B	Q2FYQ8	Nickel import system ATP-binding protein NikE	9.72e-07	NA	8.91e-18	NA
7. B	P36947	Ribose import ATP-binding protein RbsA	5.43e-05	NA	3.55e-05	NA
7. B	Q81C68	Aliphatic sulfonates import ATP-binding protein SsuB	1.18e-04	NA	2.67e-11	NA
7. B	Q9HYL7	Phosphonates import ATP-binding protein PhnC 2	1.45e-06	NA	1.30e-06	NA
7. B	Q9KAG5	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.35e-03	NA	4.75e-04	NA
7. B	Q6G2Z5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.52e-06	NA	2.51e-05	NA
7. B	Q2RM86	Phosphate import ATP-binding protein PstB	2.00e-06	NA	8.14e-08	NA
7. B	Q9TLX1	Probable ATP-dependent transporter ycf16	8.63e-05	NA	7.50e-04	NA
7. B	Q20ZP0	Phosphonates import ATP-binding protein PhnC 1	6.53e-05	NA	2.54e-15	NA
7. B	Q9PPV1	Energy-coupling factor transporter ATP-binding protein EcfA1	2.32e-05	NA	1.60e-07	NA
7. B	Q66D71	Molybdenum import ATP-binding protein ModC	1.36e-03	NA	7.80e-09	NA
7. B	Q1MIN0	Phosphate import ATP-binding protein PstB 2	1.91e-06	NA	9.05e-08	NA
7. B	P47261	Putative ABC transporter ATP-binding protein MG015	8.23e-06	NA	0.004	NA
7. B	Q6N999	Lipoprotein-releasing system ATP-binding protein LolD 1	1.88e-05	NA	2.97e-08	NA
7. B	Q20ZS6	Lipoprotein-releasing system ATP-binding protein LolD 2	2.16e-05	NA	1.20e-08	NA
7. B	Q3BTC8	ATP-dependent lipid A-core flippase	1.95e-04	NA	2.17e-07	NA
7. B	Q54R52	ABC transporter A family member 10	1.34e-03	NA	4.20e-05	NA
7. B	Q3IQI3	Phosphate import ATP-binding protein PstB 2	6.77e-06	NA	1.81e-05	NA
7. B	Q5HG41	Nickel import system ATP-binding protein NikE	6.37e-07	NA	8.91e-18	NA
7. B	Q5FM18	Phosphate import ATP-binding protein PstB 1	2.92e-05	NA	1.71e-10	NA
7. B	Q6G4Q8	Putative ABC transporter ATP-binding protein BH02760	5.95e-05	NA	5.14e-07	NA
7. B	Q751N2	Iron-sulfur clusters transporter ATM1, mitochondrial	1.90e-04	NA	0.002	NA
7. B	Q9X051	Ribose import ATP-binding protein RbsA 2	3.24e-04	NA	8.66e-07	NA
7. B	Q1WUX1	Phosphate import ATP-binding protein PstB 2	2.25e-06	NA	2.69e-08	NA
7. B	Q1IMC7	Phosphate import ATP-binding protein PstB	1.46e-05	NA	6.70e-07	NA
7. B	Q0SNU4	Phosphate import ATP-binding protein PstB	1.56e-06	NA	3.85e-10	NA
7. B	Q6AJW3	ATP-dependent lipid A-core flippase	5.75e-05	NA	2.49e-07	NA
7. B	Q8UA73	Sulfate/thiosulfate import ATP-binding protein CysA 2	9.38e-05	NA	2.13e-13	NA
7. B	Q3YW49	Nickel import ATP-binding protein NikD	2.46e-06	NA	4.70e-19	NA
7. B	Q8CMU4	Phosphonates import ATP-binding protein PhnC	3.59e-06	NA	2.09e-10	NA
7. B	Q62H59	Phosphonates import ATP-binding protein PhnC	1.75e-05	NA	1.16e-09	NA
7. B	P97027	Aliphatic sulfonates import ATP-binding protein SsuB	1.86e-04	NA	1.66e-09	NA
7. B	P63368	Phosphate import ATP-binding protein PstB 1	1.19e-03	NA	7.74e-10	NA
7. B	Q1JEC8	Energy-coupling factor transporter ATP-binding protein EcfA1	7.50e-05	NA	8.90e-13	NA
7. B	Q720M2	Putative ABC transporter ATP-binding protein LMOf2365_1216	6.99e-05	NA	4.21e-06	NA
7. B	Q73YZ5	Aliphatic sulfonates import ATP-binding protein SsuB	5.30e-05	NA	6.99e-11	NA
7. B	Q981Y8	Aliphatic sulfonates import ATP-binding protein SsuB 2	1.21e-04	NA	5.83e-10	NA
7. B	Q8CPN0	Spermidine/putrescine import ATP-binding protein PotA	1.00e-04	NA	1.31e-13	NA
7. B	Q6LH11	Ribose import ATP-binding protein RbsA	5.91e-03	NA	2.83e-07	NA
7. B	Q5HV18	Methionine import ATP-binding protein MetN	1.37e-04	NA	1.41e-19	NA
7. B	Q1GMA8	Phosphonates import ATP-binding protein PhnC 1	9.02e-05	NA	4.61e-14	NA
7. B	Q8EB59	Hemin import ATP-binding protein HmuV	5.11e-05	NA	3.08e-09	NA
7. B	Q02QM1	Phosphonates import ATP-binding protein PhnC 1	1.51e-06	NA	5.68e-07	NA
7. B	P08716	Alpha-hemolysin translocation ATP-binding protein HlyB	6.12e-04	NA	9.73e-11	NA
7. B	P20162	Lipopolysaccharide export system ATP-binding protein LptB (Fragment)	NA	NA	0.001	NA
7. B	Q9LJX0	ABC transporter B family member 19	9.90e-03	NA	1.36e-09	NA
7. B	Q4W575	Fe(3+) ions import ATP-binding protein FbpC	3.50e-04	NA	6.11e-16	NA
7. B	Q2PBM3	Autoinducer 2 import ATP-binding protein LsrA	1.44e-04	NA	1.02e-06	NA
7. B	Q83GE8	Phosphate import ATP-binding protein PstB	2.50e-06	NA	1.70e-10	NA
7. B	O31339	Sulfate/thiosulfate import ATP-binding protein CysA	6.21e-04	NA	8.90e-19	NA
7. B	A1B9Q7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.48e-04	NA	1.00e-09	NA
7. B	P36372	Antigen peptide transporter 2	5.35e-04	NA	1.78e-06	NA
7. B	Q0I348	Xylose import ATP-binding protein XylG	3.68e-04	NA	4.21e-05	NA
7. B	Q9X0Y8	Phosphate import ATP-binding protein PstB	1.96e-06	NA	1.07e-11	NA
7. B	Q74KF9	Phosphate import ATP-binding protein PstB 1	8.68e-05	NA	5.96e-09	NA
7. B	Q10418	Mesentericin-Y105 transport/processing ATP-binding protein MesD	1.62e-04	NA	3.07e-06	NA
7. B	Q97EK8	Energy-coupling factor transporter ATP-binding protein EcfA1	3.27e-05	NA	6.72e-13	NA
7. B	O31723	Uncharacterized ABC transporter ATP-binding protein YlmA	3.25e-03	NA	1.35e-05	NA
7. B	Q72D73	Putative ABC transporter ATP-binding protein DVU_1056	1.22e-04	NA	1.65e-04	NA
7. B	Q8T9W2	ABC transporter B family member 5	1.78e-04	NA	6.03e-05	NA
7. B	Q4ZTG9	Aliphatic sulfonates import ATP-binding protein SsuB 1	4.96e-04	NA	1.66e-07	NA
7. B	Q46ZU5	Aliphatic sulfonates import ATP-binding protein SsuB	6.51e-04	NA	1.13e-12	NA
7. B	P42246	Uncharacterized ABC transporter ATP-binding protein YcbN	4.69e-04	NA	1.46e-08	NA
7. B	Q9XDA6	Zinc uptake system ATP-binding protein ZurA	2.15e-04	NA	2.55e-09	NA
7. B	Q5H002	Phosphate import ATP-binding protein PstB	1.84e-06	NA	6.41e-10	NA
7. B	Q4QJQ0	Molybdenum import ATP-binding protein ModC	1.30e-03	NA	2.80e-12	NA
7. B	Q7NC40	Phosphate import ATP-binding protein PstB	3.00e-06	NA	3.91e-11	NA
7. B	Q2SRI2	Energy-coupling factor transporter ATP-binding protein EcfA2	4.43e-05	NA	6.91e-11	NA
7. B	Q21E72	Phosphate import ATP-binding protein PstB	1.50e-04	NA	3.10e-10	NA
7. B	Q119J0	Phosphonates import ATP-binding protein PhnC 1	8.31e-05	NA	7.12e-12	NA
7. B	A3DJK3	Energy-coupling factor transporter ATP-binding protein EcfA1	1.46e-04	NA	4.11e-12	NA
7. B	Q4L5B3	Spermidine/putrescine import ATP-binding protein PotA	1.45e-04	NA	3.43e-14	NA
7. B	Q8D3X4	Phosphate import ATP-binding protein PstB 2	1.44e-06	NA	6.67e-11	NA
7. B	Q5YRK2	Aliphatic sulfonates import ATP-binding protein SsuB 3	1.06e-04	NA	1.29e-09	NA
7. B	Q1CFP9	Molybdenum import ATP-binding protein ModC	1.26e-03	NA	7.46e-09	NA
7. B	Q8CPA1	Phosphate import ATP-binding protein PstB	2.66e-06	NA	5.62e-09	NA
7. B	Q8KCE8	Lipoprotein-releasing system ATP-binding protein LolD 2	3.06e-05	NA	1.35e-09	NA
7. B	Q38VW6	Spermidine/putrescine import ATP-binding protein PotA	1.89e-04	NA	5.22e-14	NA
7. B	Q2YL70	Nickel import ATP-binding protein NikD	3.05e-06	NA	1.06e-12	NA
7. B	Q2SJB5	Molybdenum import ATP-binding protein ModC	2.18e-03	NA	7.76e-12	NA
7. B	Q032D0	Phosphonates import ATP-binding protein PhnC	7.13e-06	NA	1.40e-08	NA
7. B	Q9PKX1	Probable metal transport system ATP-binding protein TC_0339	3.04e-04	NA	3.91e-05	NA
7. B	Q1C607	Fe(3+) ions import ATP-binding protein FbpC	1.09e-04	NA	2.02e-15	NA
7. B	Q9JVH1	Fe(3+) ions import ATP-binding protein FbpC	3.64e-04	NA	6.11e-16	NA
7. B	Q8VNL9	Energy-coupling factor transporter ATP-binding protein EcfA	8.38e-05	NA	5.33e-12	NA
7. B	O89016	Lysosomal cobalamin transporter ABCD4	1.67e-04	NA	0.044	NA
7. B	Q05067	Uncharacterized ABC transporter ATP-binding protein all4389	4.98e-05	NA	2.79e-08	NA
7. B	Q2A1U9	ATP-dependent lipid A-core flippase	2.76e-06	NA	6.96e-07	NA
7. B	P9WQJ6	Mycobactin import ATP-binding/permease protein IrtB	8.07e-06	NA	0.004	NA
7. B	Q3Z3K7	ATP-dependent lipid A-core flippase	4.12e-04	NA	7.42e-08	NA
7. B	Q0RT43	Aliphatic sulfonates import ATP-binding protein SsuB 1	3.89e-05	NA	5.81e-09	NA
7. B	Q0TAY4	Phosphate import ATP-binding protein PstB	1.10e-03	NA	1.02e-11	NA
7. B	Q5UW69	Phosphonates import ATP-binding protein PhnC 2	1.05e-05	NA	1.61e-15	NA
7. B	Q2K551	Hemin import ATP-binding protein HmuV	3.52e-04	NA	4.67e-08	NA
7. B	Q1MHS1	Ribose import ATP-binding protein RbsA 1	4.99e-04	NA	8.60e-04	NA
7. B	Q8K442	ABC-type organic anion transporter ABCA8A	3.51e-02	NA	0.012	NA
7. B	Q84EY8	Hemin import ATP-binding protein HmuV	4.38e-04	NA	3.30e-11	NA
7. B	P10091	Sulfate/thiosulfate import ATP-binding protein CysA	2.51e-04	NA	3.25e-12	NA
7. B	P0CL93	Iron-sulfur clusters transporter ATM1, mitochondrial	2.05e-05	NA	1.20e-05	NA
7. B	P38045	Nitrate import ATP-binding protein NrtC	9.33e-02	NA	3.12e-13	NA
7. B	Q8D653	Sulfate/thiosulfate import ATP-binding protein CysA	2.62e-04	NA	1.08e-15	NA
7. B	Q28K97	Taurine import ATP-binding protein TauB	1.64e-04	NA	2.62e-08	NA
7. B	Q8T6J5	ABC transporter A family member 2	8.58e-03	NA	0.030	NA
7. B	Q7WMC3	Phosphate import ATP-binding protein PstB	2.99e-05	NA	5.14e-11	NA
7. B	Q89ER4	Aliphatic sulfonates import ATP-binding protein SsuB	2.56e-04	NA	2.23e-11	NA
7. B	Q58418	Phosphate import ATP-binding protein PstB	1.58e-06	NA	4.64e-10	NA
7. B	Q9C8H0	ABC transporter C family member 12	6.41e-02	NA	0.029	NA
7. B	Q1GCR8	Thiamine import ATP-binding protein ThiQ	1.35e-05	NA	1.48e-10	NA
7. B	Q98K23	Sulfate/thiosulfate import ATP-binding protein CysA	1.20e-04	NA	1.52e-13	NA
7. B	Q81A96	Phosphonates import ATP-binding protein PhnC	5.87e-06	NA	1.22e-11	NA
7. B	Q8XDM1	Xylose import ATP-binding protein XylG	2.23e-04	NA	5.23e-05	NA
7. B	Q8ENB3	Ribose import ATP-binding protein RbsA	8.99e-05	NA	3.20e-06	NA
7. B	Q1BXC3	Phosphate import ATP-binding protein PstB	2.77e-05	NA	2.21e-11	NA
7. B	P26760	Toxin RTX-I translocation ATP-binding protein	5.84e-04	NA	5.02e-10	NA
7. B	Q81TH8	Spermidine/putrescine import ATP-binding protein PotA	7.16e-05	NA	2.13e-15	NA
7. B	Q6LQ00	Putative ABC transporter ATP-binding protein PBPRA2240	8.61e-05	NA	5.64e-11	NA
7. B	Q9KGD6	Energy-coupling factor transporter ATP-binding protein EcfA2	1.21e-06	NA	1.50e-12	NA
7. B	P0CE70	ABC transporter NFT1	4.69e-02	NA	0.003	NA
7. B	Q8R420	Phospholipid-transporting ATPase ABCA3	8.68e-03	NA	1.53e-04	NA
7. B	Q0HTE5	Phosphate import ATP-binding protein PstB	2.57e-06	NA	3.42e-11	NA
7. B	P0A9R8	Cell division ATP-binding protein FtsE	2.19e-05	NA	4.99e-10	NA
7. B	Q18H36	Phosphonates import ATP-binding protein PhnC 2	3.83e-05	NA	9.93e-13	NA
7. B	Q9KFN9	Phosphonates import ATP-binding protein PhnC 1	6.41e-06	NA	8.97e-09	NA
7. B	Q7YR37	ATP-binding cassette sub-family F member 1	3.66e-04	NA	4.52e-07	NA
7. B	Q8IZY2	Phospholipid-transporting ATPase ABCA7	2.71e-02	NA	7.84e-05	NA
7. B	P08183	ATP-dependent translocase ABCB1	1.35e-02	NA	6.44e-09	NA
7. B	Q2YUY7	Phosphonates import ATP-binding protein PhnC	4.13e-06	NA	3.46e-09	NA
7. B	Q6RCE0	Phosphonates import ATP-binding protein PhnC	7.81e-07	NA	5.78e-08	NA
7. B	Q9P5N0	Vacuolar heme ABC transmembrane exporter abc3	3.75e-02	NA	0.010	NA
7. B	Q5WCL2	Teichoic acids export ATP-binding protein TagH	2.48e-02	NA	1.07e-04	NA
7. B	Q2T3B8	Hemin import ATP-binding protein HmuV	5.63e-04	NA	3.85e-04	NA
7. B	O34641	ABC transporter ATP-binding protein YtrB	6.26e-03	NA	4.34e-04	NA
7. B	Q8U648	Aliphatic sulfonates import ATP-binding protein SsuB 2	7.52e-05	NA	4.57e-16	NA
7. B	Q11B53	Zinc import ATP-binding protein ZnuC	3.05e-05	NA	3.77e-04	NA
7. B	Q8NE71	ATP-binding cassette sub-family F member 1	4.74e-04	NA	4.96e-07	NA
7. B	Q3JTS8	Phosphate import ATP-binding protein PstB	4.07e-05	NA	1.05e-11	NA
7. B	Q8X4L6	Nickel import ATP-binding protein NikE	9.89e-08	NA	1.55e-23	NA
7. B	G4N2B5	ABC transporter 7	7.09e-03	NA	3.96e-05	NA
7. B	Q1IEK7	Phosphonates import ATP-binding protein PhnC	2.33e-04	NA	6.09e-08	NA
7. B	Q891M1	Ribose import ATP-binding protein RbsA	4.70e-05	NA	1.88e-04	NA
7. B	Q1R5D8	Nickel import ATP-binding protein NikE	8.74e-08	NA	2.82e-23	NA
7. B	Q3YSY7	Lipoprotein-releasing system ATP-binding protein LolD	1.44e-05	NA	2.84e-07	NA
7. B	Q9SZR9	ABC transporter G family member 9	1.05e-02	NA	0.015	NA
7. B	Q6LTB1	Zinc import ATP-binding protein ZnuC	4.23e-07	NA	2.66e-10	NA
7. B	Q7CN92	Spermidine/putrescine import ATP-binding protein PotA	1.97e-04	NA	3.82e-16	NA
7. B	Q03AH0	Spermidine/putrescine import ATP-binding protein PotA	2.24e-04	NA	2.40e-13	NA
7. B	P59653	Transport/processing ATP-binding protein ComA	2.32e-04	NA	6.73e-09	NA
7. B	Q5HBR8	Zinc import ATP-binding protein ZnuC	2.31e-04	NA	3.78e-07	NA
7. B	P42954	Teichoic acids export ATP-binding protein TagH	3.72e-02	NA	1.88e-05	NA
7. B	P10089	Alpha-hemolysin translocation ATP-binding protein HlyB	5.74e-04	NA	8.54e-11	NA
7. B	Q0K9I2	Aliphatic sulfonates import ATP-binding protein SsuB	1.54e-04	NA	1.18e-12	NA
7. B	Q325N3	Taurine import ATP-binding protein TauB	2.13e-04	NA	7.79e-12	NA
7. B	Q1BPL3	Ribose import ATP-binding protein RbsA 2	1.74e-04	NA	0.004	NA
7. B	P0A2U6	Zinc transport system ATP-binding protein AdcC	4.03e-06	NA	1.23e-04	NA
7. B	Q04JW0	Spermidine/putrescine import ATP-binding protein PotA	1.37e-04	NA	4.62e-16	NA
7. B	Q9G4F5	Sulfate/thiosulfate import ATP-binding protein cysA	4.92e-04	NA	5.31e-16	NA
7. B	Q5M397	Spermidine/putrescine import ATP-binding protein PotA	1.99e-04	NA	1.42e-16	NA
7. B	Q51546	Phosphate import ATP-binding protein PstB	1.32e-03	NA	5.09e-10	NA
7. B	Q8U4K3	Molybdate/tungstate import ATP-binding protein WtpC	4.27e-05	NA	1.24e-15	NA
7. B	Q63E84	Spermidine/putrescine import ATP-binding protein PotA	6.16e-05	NA	1.98e-15	NA
7. B	Q9X2W0	Microcin-J25 export ATP-binding/permease protein McjD	4.45e-05	NA	3.29e-06	NA
7. B	Q28M30	Lipoprotein-releasing system ATP-binding protein LolD	4.86e-05	NA	8.39e-05	NA
7. B	Q9STT6	ABC transporter A family member 6	1.14e-03	NA	2.39e-05	NA
7. B	Q8YCN8	Nickel import ATP-binding protein NikD	2.03e-06	NA	1.06e-12	NA
7. B	Q5HKQ8	Phosphonates import ATP-binding protein PhnC	3.49e-06	NA	2.09e-10	NA
7. B	Q31KE8	Phosphate import ATP-binding protein PstB	4.32e-06	NA	3.79e-06	NA
7. B	Q6GAB5	Spermidine/putrescine import ATP-binding protein PotA	1.25e-04	NA	1.05e-12	NA
7. B	Q4KG27	Cytochrome c biogenesis ATP-binding export protein CcmA	9.19e-04	NA	0.003	NA
7. B	Q23868	Serine protease/ABC transporter B family protein tagC	3.86e-02	NA	4.51e-04	NA
7. B	Q5LX21	sn-glycerol-3-phosphate import ATP-binding protein UgpC	6.75e-04	NA	3.35e-13	NA
7. B	Q83L12	Autoinducer 2 import ATP-binding protein LsrA	9.81e-04	NA	7.29e-07	NA
7. B	Q4UT63	Phosphate import ATP-binding protein PstB	8.79e-04	NA	8.53e-10	NA
7. B	Q3SJQ8	Phosphate import ATP-binding protein PstB	2.13e-06	NA	1.61e-10	NA
7. B	Q08972	[NU+] prion formation protein 1	1.85e-02	NA	0.002	NA
7. B	Q8XZP8	Sulfate/thiosulfate import ATP-binding protein CysA	1.66e-03	NA	5.56e-15	NA
7. B	Q48J74	Xylose import ATP-binding protein XylG	2.41e-04	NA	9.98e-05	NA
7. B	Q02151	Uncharacterized ABC transporter ATP-binding protein YmeB	3.81e-04	NA	0.021	NA
7. B	Q0TAW0	Ribose import ATP-binding protein RbsA	1.31e-04	NA	3.23e-07	NA
7. B	Q4ZSS5	Molybdenum import ATP-binding protein ModC	1.08e-03	NA	2.02e-13	NA
7. B	P21449	Multidrug resistance protein 2	3.28e-03	NA	1.24e-08	NA
7. B	Q09429	ATP-binding cassette sub-family C member 8	4.82e-02	NA	0.002	NA
7. B	P9WQL3	Molybdenum import ATP-binding protein ModC	3.72e-03	NA	6.20e-11	NA
7. B	Q2RS21	Nickel import ATP-binding protein NikD	1.83e-06	NA	9.15e-16	NA
7. B	Q57TF5	Thiamine import ATP-binding protein ThiQ	1.46e-05	NA	1.17e-11	NA
7. B	Q5QVB0	Phosphate import ATP-binding protein PstB	2.94e-06	NA	5.43e-10	NA
7. B	Q9M0M2	ABC transporter B family member 9	1.39e-02	NA	6.27e-10	NA
7. B	Q6MSQ2	Energy-coupling factor transporter ATP-binding protein EcfA2	4.62e-05	NA	6.11e-11	NA
7. B	Q1BWN5	Ribose import ATP-binding protein RbsA 1	1.11e-03	NA	0.003	NA
7. B	Q9A7X1	Sulfate/thiosulfate import ATP-binding protein CysA	2.90e-04	NA	8.09e-14	NA
7. B	A1TAI4	Spermidine/putrescine import ATP-binding protein PotA	3.20e-04	NA	8.60e-16	NA
7. B	Q2YQT8	Phosphate import ATP-binding protein PstB	8.85e-06	NA	7.68e-11	NA
7. B	Q32E34	ATP-dependent lipid A-core flippase	7.95e-04	NA	7.62e-08	NA
7. B	O05519	Putative ATP-binding protein YdiF	1.21e-04	NA	1.06e-04	NA
7. B	P0A9X1	Zinc import ATP-binding protein ZnuC	1.15e-03	NA	2.78e-09	NA
7. B	Q21TR5	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.56e-04	NA	5.66e-07	NA
7. B	Q8T674	ABC transporter G family member 20	2.91e-02	NA	1.36e-04	NA
7. B	P0AAH8	Putrescine export system ATP-binding protein SapF	1.35e-06	NA	2.98e-33	NA
7. B	Q8NWT5	Nickel import system ATP-binding protein NikD	4.54e-04	NA	1.96e-14	NA
7. B	Q89UT8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.67e-04	NA	1.25e-05	NA
7. B	Q9STT7	ABC transporter A family member 5	6.76e-04	NA	4.59e-04	NA
7. B	Q97IE0	Phosphate import ATP-binding protein PstB	1.14e-06	NA	3.04e-08	NA
7. B	Q2K3Y7	Arabinose import ATP-binding protein AraG	8.12e-05	NA	0.023	NA
7. B	P77622	Probable D,D-dipeptide transport ATP-binding protein DdpF	2.93e-07	NA	3.62e-49	NA
7. B	Q1BRZ8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.79e-04	NA	1.26e-09	NA
7. B	Q7W025	Hemin import ATP-binding protein HmuV	1.64e-04	NA	6.24e-04	NA
7. B	Q66A01	Vitamin B12 import ATP-binding protein BtuD	6.11e-04	NA	0.033	NA
7. B	Q02QT6	Aliphatic sulfonates import ATP-binding protein SsuB 1	3.36e-05	NA	1.21e-08	NA
7. B	Q2G1L8	Phosphonates import ATP-binding protein PhnC	3.65e-06	NA	4.20e-09	NA
7. B	Q1CDR0	Aliphatic sulfonates import ATP-binding protein SsuB	2.07e-03	NA	2.73e-16	NA
7. B	P13568	Multidrug resistance protein	1.64e-02	NA	6.83e-07	NA
7. B	P57445	ATP-binding protein Uup	3.97e-04	NA	0.001	NA
7. B	A2RH11	Energy-coupling factor transporter ATP-binding protein EcfA1	7.58e-05	NA	8.90e-13	NA
7. B	Q9GTN7	Serine protease/ABC transporter B family protein tagA	3.04e-03	NA	2.16e-05	NA
7. B	P41234	ATP-binding cassette sub-family A member 2	2.24e-02	NA	0.005	NA
7. B	Q9KL34	Hemin import ATP-binding protein HmuV	1.47e-04	NA	5.10e-06	NA
7. B	Q92V71	Phosphonates import ATP-binding protein PhnC	3.54e-05	NA	7.81e-08	NA
7. B	Q2YXZ0	Nickel import system ATP-binding protein NikE	7.83e-07	NA	3.36e-16	NA
7. B	Q92MP8	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.73e-04	NA	0.002	NA
7. B	Q7GB25	ABC transporter C family member 5	4.53e-03	NA	0.014	NA
7. B	Q2FVF0	Metal-staphylopine import system ATP-binding protein CntD	2.26e-06	NA	1.89e-20	NA
7. B	P0CE68	ABC transporter NFT1	8.39e-04	NA	0.003	NA
7. B	Q3ZA58	Phosphate import ATP-binding protein PstB	7.90e-07	NA	3.34e-10	NA
7. B	Q9RYZ3	Phosphate import ATP-binding protein PstB	2.46e-06	NA	1.73e-10	NA
7. B	Q6BXD7	Iron-sulfur clusters transporter ATM1, mitochondrial	1.86e-03	NA	1.52e-04	NA
7. B	P45289	Peptide transport system ATP-binding protein SapF	1.19e-06	NA	4.48e-16	NA
7. B	Q8CG09	Multidrug resistance-associated protein 1	5.25e-02	NA	4.22e-04	NA
7. B	O88563	ATP-binding cassette sub-family C member 3	4.98e-03	NA	0.001	NA
7. B	Q0SSJ0	Ribose import ATP-binding protein RbsA	7.17e-05	NA	2.25e-05	NA
7. B	A0K718	Ribose import ATP-binding protein RbsA 1	1.05e-03	NA	0.003	NA
7. B	Q04G50	Spermidine/putrescine import ATP-binding protein PotA	2.26e-04	NA	6.74e-15	NA
7. B	Q4ZSF3	Xylose import ATP-binding protein XylG	1.86e-04	NA	2.77e-08	NA
7. B	Q1WSB8	Energy-coupling factor transporter ATP-binding protein EcfA1	2.62e-05	NA	1.99e-10	NA
7. B	Q9JXR3	ATP-dependent lipid A-core flippase	9.43e-05	NA	1.30e-04	NA
7. B	Q65HB9	Phosphate import ATP-binding protein PstB 2	4.20e-06	NA	6.63e-10	NA
7. B	Q2J220	Phosphate import ATP-binding protein PstB	2.12e-06	NA	3.80e-09	NA
7. B	P9WQK1	Uncharacterized ABC transporter ATP-binding protein Rv0986	6.85e-05	NA	4.34e-09	NA
7. B	O70014	Hemin import ATP-binding protein HmuV	5.29e-04	NA	5.14e-07	NA
7. B	Q6G098	Hemin import ATP-binding protein HmuV	4.60e-04	NA	2.22e-06	NA
7. B	P0A2V2	Octopine permease ATP-binding protein P	1.02e-05	NA	1.27e-14	NA
7. B	Q9TKX3	Sulfate/thiosulfate import ATP-binding protein CysA	2.86e-04	NA	1.08e-16	NA
7. B	Q6RH47	Taurine import ATP-binding protein TauB	2.84e-05	NA	3.02e-10	NA
7. B	O34338	Manganese transport system ATP-binding protein MntB	4.96e-04	NA	1.38e-04	NA
7. B	Q1JBJ5	Phosphate import ATP-binding protein PstB 1	1.68e-06	NA	1.63e-07	NA
7. B	P33527	Multidrug resistance-associated protein 1	1.48e-02	NA	0.001	NA
7. B	Q5PB72	Zinc import ATP-binding protein ZnuC	1.15e-04	NA	1.41e-09	NA
7. B	P0A9V3	Lipopolysaccharide export system ATP-binding protein LptB	8.06e-06	NA	0.001	NA
7. B	Q8WWZ7	Cholesterol transporter ABCA5	2.30e-02	NA	3.11e-04	NA
7. B	Q2SUW7	Phosphate import ATP-binding protein PstB	3.75e-05	NA	1.05e-11	NA
7. B	Q21UI2	Molybdenum import ATP-binding protein ModC	1.80e-03	NA	5.76e-16	NA
7. B	Q0SZJ4	Nickel import ATP-binding protein NikD	2.45e-06	NA	9.31e-19	NA
7. B	Q98FL5	Phosphate import ATP-binding protein PstB	1.91e-06	NA	5.63e-10	NA
7. B	Q39S52	Phosphate import ATP-binding protein PstB	1.31e-06	NA	1.07e-09	NA
7. B	O34992	Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA	7.24e-05	NA	1.37e-20	NA
7. B	O34946	High-affinity zinc uptake system ATP-binding protein ZnuC	8.77e-07	NA	1.22e-05	NA
7. B	Q98PL2	UvrABC system protein A	1.06e-01	NA	0.043	NA
7. B	Q6NDA6	Cytochrome c biogenesis ATP-binding export protein CcmA	1.42e-03	NA	0.020	NA
7. B	Q7NN36	Hemin import ATP-binding protein HmuV	4.28e-04	NA	0.028	NA
7. B	Q9ZCM8	Putative export ATP-binding/permease protein RP696	2.97e-04	NA	1.24e-07	NA
7. B	Q18C09	Methionine import ATP-binding protein MetN	3.58e-05	NA	9.18e-20	NA
7. B	A0RFA4	Aliphatic sulfonates import ATP-binding protein SsuB	1.27e-04	NA	5.45e-12	NA
7. B	Q8F6Z1	Sulfate/thiosulfate import ATP-binding protein CysA	3.94e-04	NA	2.09e-18	NA
7. B	Q6FFZ1	Aliphatic sulfonates import ATP-binding protein SsuB	5.22e-04	NA	3.66e-15	NA
7. B	Q2FKB7	Phosphonates import ATP-binding protein PhnC	3.56e-06	NA	4.20e-09	NA
7. B	Q8YDN0	Xylose import ATP-binding protein XylG	2.99e-04	NA	5.89e-05	NA
7. B	Q3KKA1	Zinc import ATP-binding protein ZnuC	1.83e-04	NA	6.92e-10	NA
7. B	A3CRB9	Energy-coupling factor transporter ATP-binding protein EcfA1	7.29e-05	NA	4.39e-11	NA
7. B	Q8D3V0	Maltose/maltodextrin import ATP-binding protein MalK	6.95e-04	NA	1.70e-15	NA
7. B	Q5HAV5	Phosphate import ATP-binding protein PstB	8.34e-12	NA	2.04e-14	NA
7. B	Q5N1G5	Phosphate import ATP-binding protein PstB	3.87e-06	NA	3.83e-06	NA
7. B	O57896	Molybdate/tungstate import ATP-binding protein WtpC	1.68e-04	NA	8.42e-16	NA
7. B	Q57213	Uncharacterized ABC transporter ATP-binding protein HI_1474	2.64e-05	NA	2.91e-13	NA
7. B	Q9SYI2	ABC transporter B family member 3	1.47e-02	NA	6.00e-10	NA
7. B	Q7NIW1	Sulfate/thiosulfate import ATP-binding protein CysA	5.44e-05	NA	3.74e-16	NA
7. B	Q30PC0	Phosphate import ATP-binding protein PstB	2.83e-05	NA	6.86e-10	NA
7. B	Q81N53	Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118	1.75e-04	NA	1.17e-09	NA
7. B	Q9CPN2	Cytochrome c biogenesis ATP-binding export protein CcmA	9.27e-04	NA	0.022	NA
7. B	Q0WML0	ABC transporter B family member 27	6.79e-05	NA	2.31e-08	NA
7. B	Q48QM2	Energy-coupling factor transporter ATP-binding protein EcfA1	7.45e-05	NA	8.49e-13	NA
7. B	Q02DK9	Zinc import ATP-binding protein ZnuC	1.63e-04	NA	1.91e-11	NA
7. B	Q65SC9	Thiamine import ATP-binding protein ThiQ	1.22e-04	NA	5.12e-13	NA
7. B	Q9LSJ8	ABC transporter B family member 16	1.26e-02	NA	9.87e-09	NA
7. B	Q8XZQ4	Aliphatic sulfonates import ATP-binding protein SsuB	2.26e-04	NA	9.14e-14	NA
7. B	Q9AML4	Phosphate import ATP-binding protein PstB	4.99e-06	NA	6.65e-12	NA
7. B	Q6FFL0	Zinc import ATP-binding protein ZnuC	1.02e-03	NA	7.22e-09	NA
7. B	Q07LY2	Phosphonates import ATP-binding protein PhnC 2	8.61e-06	NA	7.07e-11	NA
7. B	Q8YE15	Molybdenum import ATP-binding protein ModC	1.71e-03	NA	1.10e-05	NA
7. B	P42360	Manganese import ATP-binding protein ScaC	4.55e-05	NA	1.51e-05	NA
7. B	Q08234	Uncharacterized ABC transporter ATP-binding protein/permease YOL075C	5.30e-02	NA	3.38e-04	NA
7. B	P10640	ATP-binding protein BexA	1.37e-03	NA	0.007	NA
7. B	Q6LY93	Phosphate import ATP-binding protein PstB	1.49e-06	NA	1.81e-11	NA
7. B	E9PX95	ATP-binding cassette sub-family A member 17	2.46e-02	NA	6.86e-05	NA
7. B	Q1JLH7	Phosphate import ATP-binding protein PstB 1	1.29e-03	NA	1.63e-07	NA
7. B	P10090	Protein white	5.09e-02	NA	0.030	NA
7. B	Q03195	Translation initiation factor RLI1	3.42e-02	NA	1.72e-04	NA
7. B	P55453	Uncharacterized ABC transporter ATP-binding protein y4fO	5.09e-04	NA	2.58e-13	NA
7. B	Q97Q34	Phosphate import ATP-binding protein PstB 2	2.82e-06	NA	3.58e-10	NA
7. B	O35600	Retinal-specific phospholipid-transporting ATPase ABCA4	5.00e-02	NA	1.83e-04	NA
7. B	Q8T664	ABC transporter H family member 2	1.33e-02	NA	6.83e-11	NA
7. B	P21441	Multidrug resistance protein	1.25e-02	NA	0.012	NA
7. B	Q87UH7	Taurine import ATP-binding protein TauB	1.80e-04	NA	5.24e-09	NA
7. B	Q471U2	Taurine import ATP-binding protein TauB	2.29e-04	NA	1.58e-08	NA
7. B	Q14JW6	ATP-dependent lipid A-core flippase	5.10e-05	NA	5.66e-07	NA
7. B	P34713	Multidrug resistance protein pgp-3	4.51e-04	NA	5.54e-07	NA
7. B	Q8YH20	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.90e-06	NA	1.01e-05	NA
7. B	Q87J32	Hemin import ATP-binding protein HmuV	2.47e-04	NA	5.37e-05	NA
7. B	Q8RCU0	Phosphate import ATP-binding protein PstB 1	4.54e-07	NA	2.12e-11	NA
7. B	Q10V16	Phosphonates import ATP-binding protein PhnC 2	1.91e-06	NA	1.51e-10	NA
7. B	Q6F9X0	ATP-dependent lipid A-core flippase	1.49e-05	NA	1.04e-06	NA
7. B	Q82VR4	Phosphate import ATP-binding protein PstB	4.21e-05	NA	1.44e-09	NA
7. B	Q8ZLF4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.21e-04	NA	9.71e-11	NA
7. B	P43245	ATP-dependent translocase ABCB1	3.72e-03	NA	1.12e-08	NA
7. B	Q89C51	Phosphonates import ATP-binding protein PhnC	6.85e-06	NA	1.14e-11	NA
7. B	Q48TP4	Spermidine/putrescine import ATP-binding protein PotA	2.82e-04	NA	2.38e-16	NA
7. B	Q9FHF1	ABC transporter B family member 7	7.98e-03	NA	6.67e-10	NA
7. B	Q10YP7	Phosphate import ATP-binding protein PstB	3.39e-06	NA	2.67e-05	NA
7. B	P9WQJ1	Uncharacterized ABC transporter ATP-binding protein Rv1273c	9.94e-06	NA	4.70e-05	NA
7. B	Q3YVK8	Ribose import ATP-binding protein RbsA	1.31e-04	NA	3.04e-07	NA
7. B	A8A066	Autoinducer 2 import ATP-binding protein LsrA	4.21e-04	NA	1.82e-07	NA
7. B	Q8Z1U0	Maltose/maltodextrin import ATP-binding protein MalK	3.24e-03	NA	7.00e-14	NA
7. B	Q39KB9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.80e-04	NA	1.26e-09	NA
7. B	Q9PDN2	Sulfate/thiosulfate import ATP-binding protein CysA	3.80e-04	NA	1.96e-17	NA
7. B	Q11ID5	Hemin import ATP-binding protein HmuV	6.28e-04	NA	0.008	NA
7. B	O68106	Cobalt import ATP-binding protein CbiO	1.02e-04	NA	3.72e-09	NA
7. B	Q82VK1	Macrolide export ATP-binding/permease protein MacB	6.85e-02	NA	2.67e-07	NA
7. B	Q5FT15	Phosphate import ATP-binding protein PstB	1.92e-06	NA	9.83e-08	NA
7. B	Q6G4T6	Phosphate import ATP-binding protein PstB	8.05e-07	NA	5.70e-10	NA
7. B	Q9SYI3	ABC transporter B family member 5	1.33e-02	NA	6.76e-10	NA
7. B	Q9PQU3	Phosphate import ATP-binding protein PstB	7.29e-06	NA	1.12e-11	NA
7. B	O35379	Multidrug resistance-associated protein 1	1.85e-02	NA	2.64e-04	NA
7. B	Q47538	Taurine import ATP-binding protein TauB	2.07e-04	NA	5.17e-12	NA
7. B	O59672	Uncharacterized ABC transporter ATP-binding protein C29A3.09c	1.14e-04	NA	1.42e-04	NA
7. B	Q98QH4	Energy-coupling factor transporter ATP-binding protein EcfA2	1.04e-05	NA	1.02e-09	NA
7. B	P0AAF5	Arabinose import ATP-binding protein AraG	3.31e-04	NA	0.004	NA
7. B	Q8YDH0	Putative peptide import ATP-binding protein BMEII0206	2.83e-12	NA	1.22e-32	NA
7. B	Q39LW7	Aliphatic sulfonates import ATP-binding protein SsuB 2	4.02e-04	NA	6.26e-07	NA
7. B	Q889G0	Phosphonates import ATP-binding protein PhnC 1	2.02e-05	NA	1.03e-07	NA
7. B	Q55791	Probable ATP-dependent transporter slr0075	7.44e-05	NA	0.002	NA
7. B	Q51719	Putative ABC transporter ATP-binding protein in cobA 5'region	2.35e-05	NA	3.16e-06	NA
7. B	Q0T7M2	Taurine import ATP-binding protein TauB	2.64e-04	NA	6.14e-10	NA
7. B	Q2KJA2	ATP-binding cassette sub-family F member 2	1.26e-04	NA	0.001	NA
7. B	F2Q5G0	ABC multidrug transporter MDR2	8.91e-03	NA	1.55e-10	NA
7. B	Q7CG00	Ribose import ATP-binding protein RbsA	5.96e-05	NA	2.45e-05	NA
7. B	P94374	Uncharacterized ABC transporter ATP-binding protein YxlF	5.37e-04	NA	3.74e-12	NA
7. B	Q20WP4	Phosphate import ATP-binding protein PstB	8.45e-11	NA	6.42e-11	NA
7. B	Q6D201	Sulfate/thiosulfate import ATP-binding protein CysA	3.66e-04	NA	1.14e-17	NA
7. B	Q48NM1	Phosphonates import ATP-binding protein PhnC 1	2.38e-04	NA	2.59e-07	NA
7. B	Q7N6C6	ATP-dependent lipid A-core flippase	3.75e-04	NA	8.27e-07	NA
7. B	Q8HXQ5	Multidrug resistance-associated protein 1	3.64e-02	NA	4.88e-04	NA
7. B	Q2J3T0	Hemin import ATP-binding protein HmuV	5.28e-04	NA	1.07e-04	NA
7. B	C8ZCR2	ABC transporter NFT1	6.87e-02	NA	0.005	NA
7. B	Q00748	Multidrug resistance protein homolog 65	1.10e-02	NA	5.59e-10	NA
7. B	Q81XB3	Petrobactin import ATP-binding protein FatE	2.41e-04	NA	5.40e-10	NA
7. B	Q58429	Uncharacterized ABC transporter ATP-binding protein MJ1023	6.20e-04	NA	0.002	NA
7. B	P37624	Ribosome-associated ATPase	6.32e-04	NA	3.36e-05	NA
7. B	Q30V33	Spermidine/putrescine import ATP-binding protein PotA	1.82e-04	NA	7.10e-15	NA
7. B	Q146E7	Taurine import ATP-binding protein TauB 1	2.27e-04	NA	1.81e-08	NA
7. B	Q65QT6	Maltose/maltodextrin import ATP-binding protein MalK	2.47e-04	NA	1.95e-16	NA
7. B	Q82TL6	Spermidine/putrescine import ATP-binding protein PotA	3.71e-04	NA	2.11e-16	NA
7. B	Q6HFB5	Phosphonates import ATP-binding protein PhnC	8.14e-06	NA	5.89e-11	NA
7. B	P63367	Phosphate import ATP-binding protein PstB 1	1.22e-03	NA	7.74e-10	NA
7. B	Q6LHL2	Molybdenum import ATP-binding protein ModC	2.01e-03	NA	9.37e-13	NA
7. B	Q2W4W1	Zinc import ATP-binding protein ZnuC	1.03e-03	NA	1.12e-10	NA
7. B	Q8UF79	Zinc import ATP-binding protein ZnuC	1.50e-03	NA	5.38e-07	NA
7. B	O07549	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH	4.57e-05	NA	1.55e-05	NA
7. B	P54933	ATP-binding transport protein SmoK	7.75e-05	NA	9.96e-12	NA
7. B	Q9P7V2	ATP-binding cassette transporter abc4	2.64e-02	NA	0.018	NA
7. B	Q6LK87	Maltose/maltodextrin import ATP-binding protein MalK	2.17e-04	NA	1.37e-13	NA
7. B	Q6MUF4	Phosphonates import ATP-binding protein PhnC	8.54e-06	NA	2.91e-08	NA
7. B	Q5M4F3	Phosphate import ATP-binding protein PstB 1	1.94e-10	NA	3.43e-11	NA
7. B	Q1C7J0	Arabinose import ATP-binding protein AraG	4.85e-05	NA	0.004	NA
7. B	Q8DU23	Phosphate import ATP-binding protein PstB 2	3.42e-06	NA	4.84e-11	NA
7. B	Q5WET7	Phosphate import ATP-binding protein PstB 2	2.64e-06	NA	1.53e-12	NA
7. B	P0C0E2	Lantibiotic transport ATP-binding protein SrtF	7.20e-05	NA	1.64e-07	NA
7. B	P47425	Energy-coupling factor transporter ATP-binding protein EcfA1	2.19e-04	NA	1.67e-08	NA
7. B	A0A0H3JT74	Metal-staphylopine import system ATP-binding protein CntF	2.40e-05	NA	1.62e-20	NA
7. B	P0A9V4	Lipopolysaccharide export system ATP-binding protein LptB	7.17e-06	NA	0.001	NA
7. B	Q7A169	Spermidine/putrescine import ATP-binding protein PotA	1.23e-04	NA	1.05e-12	NA
7. B	Q0BQ80	Molybdenum import ATP-binding protein ModC	2.53e-03	NA	9.75e-08	NA
7. B	Q88ZH4	Teichoic acids export ATP-binding protein TagH	3.11e-02	NA	7.61e-09	NA
7. B	P69881	Phosphate import ATP-binding protein PstB	2.26e-06	NA	1.73e-10	NA
7. B	Q7MFA1	Hemin import ATP-binding protein HmuV	2.11e-04	NA	3.84e-07	NA
7. B	Q3KDW2	Xylose import ATP-binding protein XylG	1.85e-04	NA	3.52e-04	NA
7. B	Q4A8A1	Energy-coupling factor transporter ATP-binding protein EcfA2	1.01e-05	NA	9.83e-09	NA
7. B	Q9JJ59	ABC-type oligopeptide transporter ABCB9	2.91e-04	NA	2.17e-04	NA
7. B	Q926D8	Zinc uptake system ATP-binding protein ZurA	1.34e-04	NA	2.77e-09	NA
7. B	Q85A69	Sulfate/thiosulfate import ATP-binding protein CysA	2.34e-04	NA	8.75e-13	NA
7. B	Q1R5H8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.60e-04	NA	6.78e-11	NA
7. B	S0ELQ3	ABC transporter GPY2	3.49e-02	NA	0.019	NA
7. B	Q28P50	Ribose import ATP-binding protein RbsA	5.61e-05	NA	6.50e-04	NA
7. B	Q9JZW0	Sulfate/thiosulfate import ATP-binding protein CysA	4.25e-04	NA	1.44e-15	NA
7. B	Q6LUY1	Xylose import ATP-binding protein XylG	2.02e-04	NA	7.74e-05	NA
7. B	Q74LQ3	Phosphonates import ATP-binding protein PhnC	7.98e-06	NA	5.48e-10	NA
7. B	Q97KD5	Methionine import ATP-binding protein MetN	7.18e-05	NA	1.96e-16	NA
7. B	P94440	Linearmycin resistance ATP-binding protein LnrL	2.32e-05	NA	3.18e-09	NA
7. B	Q9H222	ATP-binding cassette sub-family G member 5	1.85e-02	NA	5.49e-04	NA
7. B	P61221	ATP-binding cassette sub-family E member 1	2.62e-02	NA	0.013	NA
7. B	Q5LZU3	Phosphate import ATP-binding protein PstB 1	2.89e-06	NA	3.43e-11	NA
7. B	Q47A37	Phosphate import ATP-binding protein PstB	3.70e-05	NA	2.51e-10	NA
7. B	P06795	ATP-dependent translocase ABCB1	3.33e-03	NA	5.66e-09	NA
7. B	Q62GY9	Arabinose import ATP-binding protein AraG	5.20e-05	NA	0.005	NA
7. B	P0C560	Phosphate import ATP-binding protein PstB	1.13e-03	NA	0.009	NA
7. B	Q0BFQ0	Aliphatic sulfonates import ATP-binding protein SsuB	1.17e-03	NA	5.24e-13	NA
7. B	Q82B58	Putative ABC transporter ATP-binding protein SAV_5847	1.98e-03	NA	2.17e-06	NA
7. B	Q56903	O-antigen export system ATP-binding protein RfbE	3.88e-03	NA	0.006	NA
7. B	Q6YUU5	Putative multidrug resistance protein	1.45e-03	NA	4.24e-08	NA
7. B	O69063	Hypophosphite import ATP-binding protein HtxD	2.76e-04	NA	5.81e-09	NA
7. B	Q1GBJ0	Energy-coupling factor transporter ATP-binding protein EcfA1	4.92e-05	NA	1.95e-11	NA
7. B	Q0TJT5	Molybdenum import ATP-binding protein ModC	1.57e-03	NA	3.70e-05	NA
7. B	Q7N2D9	Autoinducer 2 import ATP-binding protein LsrA	1.38e-03	NA	1.11e-06	NA
7. B	Q8FFU7	Galactose/methyl galactoside import ATP-binding protein MglA	1.59e-04	NA	1.45e-04	NA
7. B	Q3SJC6	Molybdenum import ATP-binding protein ModC	5.81e-03	NA	9.14e-11	NA
7. B	Q8U8D6	Aliphatic sulfonates import ATP-binding protein SsuB 1	2.43e-04	NA	2.04e-13	NA
7. B	Q47258	Alpha-hemolysin translocation ATP-binding protein HlyB	5.41e-04	NA	1.13e-10	NA
7. B	Q39B28	Hemin import ATP-binding protein HmuV	4.21e-04	NA	0.003	NA
7. B	Q2FH58	Nickel import system ATP-binding protein NikE	7.57e-07	NA	8.91e-18	NA
7. B	Q8DE95	Thiamine import ATP-binding protein ThiQ	2.95e-06	NA	5.91e-10	NA
7. B	Q1IGL4	Aliphatic sulfonates import ATP-binding protein SsuB	3.26e-04	NA	1.23e-13	NA
7. B	Q8K9M6	Zinc import ATP-binding protein ZnuC	1.60e-03	NA	0.012	NA
7. B	Q28433	Antigen peptide transporter 1	2.01e-05	NA	2.25e-06	NA
7. B	Q9Z8Q8	Methionine import ATP-binding protein MetN	1.55e-05	NA	5.70e-13	NA
7. B	Q9HUG8	ATP-dependent lipid A-core flippase	1.78e-04	NA	4.47e-06	NA
7. B	P70970	Energy-coupling factor transporter ATP-binding protein EcfA2	2.56e-05	NA	2.70e-14	NA
7. B	Q2KUC0	Hemin import ATP-binding protein HmuV	1.36e-04	NA	8.97e-05	NA
7. B	Q3JSQ0	Nod factor export ATP-binding protein I	1.19e-03	NA	0.006	NA
7. B	Q2NVW9	Thiamine import ATP-binding protein ThiQ	1.20e-05	NA	3.73e-10	NA
7. B	Q8ELT4	Phosphate import ATP-binding protein PstB	2.43e-06	NA	6.86e-11	NA
7. B	Q9Z3R9	Alpha-glucoside transport ATP-binding protein AglK	7.64e-04	NA	1.44e-12	NA
7. B	Q7WNT8	Phosphonates import ATP-binding protein PhnC	1.57e-05	NA	1.91e-14	NA
7. B	Q92CV8	Teichoic acids export ATP-binding protein TagH	1.87e-03	NA	1.11e-06	NA
7. B	Q09428	ATP-binding cassette sub-family C member 8	2.03e-02	NA	4.81e-04	NA
7. B	Q0TTG6	Phosphate import ATP-binding protein PstB	1.17e-06	NA	2.24e-11	NA
7. B	Q3Z445	Molybdenum import ATP-binding protein ModC	1.56e-03	NA	5.40e-05	NA
7. B	P0CAT6	Phosphate import ATP-binding protein PstB	2.24e-06	NA	1.05e-09	NA
7. B	Q8EUJ1	Phosphate import ATP-binding protein PstB	6.87e-05	NA	1.47e-10	NA
7. B	Q07QX6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.00e-05	NA	4.90e-07	NA
7. B	Q1GKZ0	Phosphonates import ATP-binding protein PhnC 2	1.99e-04	NA	7.88e-11	NA
7. B	Q2JGF5	Aliphatic sulfonates import ATP-binding protein SsuB	1.12e-04	NA	1.79e-09	NA
7. B	Q8T6H3	ABC transporter C family member 6	1.78e-04	NA	7.15e-05	NA
7. B	Q9CIS9	Energy-coupling factor transporter ATP-binding protein EcfA1	1.22e-04	NA	4.44e-13	NA
7. B	Q8K440	ABC-type organic anion transporter ABCA8B	4.73e-02	NA	0.002	NA
7. B	P9WQJ5	Uncharacterized ABC transporter ATP-binding protein Rv1281c	4.07e-05	NA	4.12e-44	NA
7. B	P75444	Putative ABC transporter ATP-binding protein MPN_334	1.36e-04	NA	3.34e-06	NA
7. B	Q9R1S7	ATP-binding cassette sub-family C member 6	2.01e-03	NA	9.15e-05	NA
7. B	Q80W57	Broad substrate specificity ATP-binding cassette transporter ABCG2	7.28e-02	NA	0.009	NA
7. B	O32487	Phosphate import ATP-binding protein PstB	1.08e-03	NA	1.12e-11	NA
7. B	Q3KCC5	Fe(3+) ions import ATP-binding protein FbpC	9.64e-05	NA	8.46e-17	NA
7. B	Q2KVN7	Phosphate import ATP-binding protein PstB	4.65e-06	NA	3.32e-11	NA
7. B	Q98QH5	Energy-coupling factor transporter ATP-binding protein EcfA1	2.94e-04	NA	9.04e-08	NA
7. B	Q6MU19	Spermidine/putrescine import ATP-binding protein PotA	1.49e-04	NA	1.83e-18	NA
7. B	B2GUP8	Mitochondrial potassium channel ATP-binding subunit	6.97e-05	NA	4.63e-06	NA
7. B	Q6AAX3	Phosphate import ATP-binding protein PstB	1.15e-03	NA	1.35e-07	NA
7. B	Q8ZNV7	Zinc import ATP-binding protein ZnuC	3.70e-06	NA	3.99e-09	NA
7. B	F2RPA4	ABC multidrug transporter MDR2	1.83e-02	NA	1.60e-11	NA
7. B	Q7VKP7	Molybdenum import ATP-binding protein ModC	1.10e-03	NA	2.28e-14	NA
7. B	Q1CBH2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-04	NA	1.16e-10	NA
7. B	Q2YIN5	Molybdenum import ATP-binding protein ModC	1.53e-03	NA	1.09e-05	NA
7. B	P0C086	Leukotoxin translocation ATP-binding protein LktB	8.05e-04	NA	1.51e-10	NA
7. B	Q1J3P2	Ribose import ATP-binding protein RbsA	8.22e-05	NA	1.71e-04	NA
7. B	Q8PP41	Aliphatic sulfonates import ATP-binding protein SsuB 1	4.48e-04	NA	5.18e-12	NA
7. B	Q8DWR3	Energy-coupling factor transporter ATP-binding protein EcfA1	6.71e-05	NA	3.08e-13	NA
7. B	P9WQI3	Trehalose import ATP-binding protein SugC	5.25e-04	NA	4.84e-15	NA
7. B	Q8EBC3	Sulfate/thiosulfate import ATP-binding protein CysA 1	8.44e-04	NA	3.79e-15	NA
7. B	Q9KD30	Manganese transport system ATP-binding protein MntB	5.85e-04	NA	1.15e-06	NA
7. B	Q9LVM1	ABC transporter B family member 25, mitochondrial	9.33e-05	NA	1.03e-08	NA
7. B	Q7NAQ6	Energy-coupling factor transporter ATP-binding protein EcfA1	1.17e-04	NA	2.81e-10	NA
7. B	Q5V225	Phosphate import ATP-binding protein PstB 1	5.18e-06	NA	3.11e-10	NA
7. B	Q8RD43	Ribose import ATP-binding protein RbsA	2.11e-05	NA	1.63e-07	NA
7. B	Q6NLC1	ABC transporter D family member 2, chloroplastic	5.25e-04	NA	0.039	NA
7. B	A1VZQ5	Probable ABC transporter ATP-binding protein PEB1C	2.39e-06	NA	6.29e-14	NA
7. B	Q4KGX6	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.59e-04	NA	7.28e-11	NA
7. B	Q58206	Uncharacterized ABC transporter ATP-binding protein MJ0796	2.17e-05	NA	2.26e-13	NA
7. B	P52218	Cytochrome c biogenesis ATP-binding export protein CcmA	1.71e-02	NA	1.92e-05	NA
7. B	Q664G2	Ribose import ATP-binding protein RbsA	3.80e-05	NA	2.24e-05	NA
7. B	Q6KIP2	Spermidine/putrescine import ATP-binding protein PotA	3.64e-04	NA	1.81e-17	NA
7. B	Q83J78	Nickel import ATP-binding protein NikD	2.39e-06	NA	8.31e-19	NA
7. B	P63371	Phosphate import ATP-binding protein PstB 3	1.74e-05	NA	1.42e-11	NA
7. B	Q9KQB8	Zinc import ATP-binding protein ZnuC	8.24e-04	NA	9.60e-10	NA
7. B	P74981	Hemin import ATP-binding protein HmuV	2.29e-04	NA	1.43e-04	NA
7. B	Q3ISC1	Phosphonates import ATP-binding protein PhnC 1	3.50e-05	NA	8.03e-08	NA
7. B	Q10RX7	ABC transporter C family member 13	7.30e-03	NA	0.029	NA
7. B	Q609Z8	Phosphate import ATP-binding protein PstB	1.71e-06	NA	1.46e-10	NA
7. B	Q32AQ1	Nickel import ATP-binding protein NikE	1.10e-07	NA	1.50e-23	NA
7. B	Q98L75	Hemin import ATP-binding protein HmuV	3.16e-04	NA	2.71e-08	NA
7. B	Q7N6R3	Molybdenum import ATP-binding protein ModC	1.44e-03	NA	6.49e-10	NA
7. B	Q4KKK4	Zinc import ATP-binding protein ZnuC	1.83e-04	NA	8.41e-10	NA
7. B	Q70YG7	Hemin import ATP-binding protein HmuV	1.90e-04	NA	1.65e-04	NA
7. B	P17328	Glycine betaine/proline betaine transport system ATP-binding protein ProV	4.10e-04	NA	1.57e-18	NA
7. B	Q99UA3	Nickel import system ATP-binding protein NikE	6.73e-07	NA	1.10e-17	NA
7. B	Q0ST95	Galactose/methyl galactoside import ATP-binding protein MglA	6.39e-03	NA	2.65e-05	NA
7. B	A0K3S5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.82e-04	NA	1.26e-09	NA
7. B	Q8U3E0	Putative ABC transporter ATP-binding protein PF0528	4.83e-04	NA	2.60e-05	NA
7. B	O70595	ATP-binding cassette sub-family B member 6	8.84e-04	NA	6.88e-06	NA
7. B	Q9CJB8	Lactococcin transport/processing ATP-binding protein LcnC-like	2.80e-04	NA	1.26e-09	NA
7. B	P57551	Multidrug resistance-like ATP-binding protein MdlA	1.03e-04	NA	1.66e-04	NA
7. B	Q39CJ6	Taurine import ATP-binding protein TauB	2.74e-04	NA	2.60e-10	NA
7. B	Q7WEH6	Hemin import ATP-binding protein HmuV	1.67e-04	NA	5.25e-04	NA
7. B	P0A193	High-affinity branched-chain amino acid transport ATP-binding protein LivG	4.79e-05	NA	2.61e-08	NA
7. B	Q65WJ1	Arabinose import ATP-binding protein AraG	9.80e-05	NA	0.006	NA
7. B	O57872	Putative ABC transporter ATP-binding protein PH0132	7.27e-05	NA	3.82e-12	NA
7. B	Q39GT7	Nod factor export ATP-binding protein I	1.09e-03	NA	0.001	NA
7. B	F2T1C4	ABC multidrug transporter MDR2	7.55e-03	NA	3.45e-08	NA
7. B	Q9CP06	Spermidine/putrescine import ATP-binding protein PotA	4.32e-05	NA	1.57e-16	NA
7. B	Q8GEH7	Methionine import ATP-binding protein MetN	1.30e-05	NA	6.04e-19	NA
7. B	Q0TBU8	Hemin import ATP-binding protein HmuV	5.84e-04	NA	9.50e-07	NA
7. B	A1JRI2	Zinc import ATP-binding protein ZnuC	1.28e-03	NA	6.06e-08	NA
7. B	Q8Z0H0	Sulfate/thiosulfate import ATP-binding protein CysA	5.25e-05	NA	2.13e-16	NA
7. B	Q74E68	Phosphate import ATP-binding protein PstB	3.41e-05	NA	2.03e-13	NA
7. B	Q8FXI7	Molybdenum import ATP-binding protein ModC	1.48e-03	NA	1.10e-05	NA
7. B	Q7M816	Methionine import ATP-binding protein MetN	2.08e-05	NA	2.04e-14	NA
7. B	Q8PUE7	Putative ABC transporter ATP-binding protein MM_2387	3.25e-04	NA	1.75e-08	NA
7. B	Q8LPQ6	ABC transporter B family member 28	1.29e-03	NA	3.79e-08	NA
7. B	Q92XW1	Sulfate/thiosulfate import ATP-binding protein CysA 1	3.17e-04	NA	5.24e-16	NA
7. B	Q1CK45	Phosphate import ATP-binding protein PstB 1	1.29e-10	NA	2.13e-08	NA
7. B	Q084V3	Phosphate import ATP-binding protein PstB	2.38e-06	NA	6.94e-12	NA
7. B	Q8FCJ1	Hemin import ATP-binding protein HmuV	5.30e-04	NA	9.50e-07	NA
7. B	Q48HL2	Phosphonates import ATP-binding protein PhnC 2	1.03e-06	NA	1.68e-06	NA
7. B	Q8IUA7	ATP-binding cassette sub-family A member 9	9.31e-03	NA	4.37e-05	NA
7. B	Q3SGJ8	Phosphonates import ATP-binding protein PhnC	6.21e-06	NA	1.81e-10	NA
7. B	Q2YAD6	Spermidine/putrescine import ATP-binding protein PotA	3.69e-04	NA	4.16e-19	NA
7. B	Q0TA26	Maltose/maltodextrin import ATP-binding protein MalK	2.67e-03	NA	1.96e-13	NA
7. B	Q2FVF1	Metal-staphylopine import system ATP-binding protein CntF	6.50e-08	NA	1.51e-20	NA
7. B	Q6G1D9	Putative ABC transporter ATP-binding protein BQ02700	1.20e-05	NA	2.71e-06	NA
7. B	Q9C8H1	ABC transporter C family member 11	4.48e-02	NA	0.008	NA
7. B	Q0S0Z3	Fe(3+) ions import ATP-binding protein FbpC 2	1.92e-04	NA	9.11e-17	NA
7. B	Q743D1	Phosphate import ATP-binding protein PstB	1.30e-03	NA	0.041	NA
7. B	Q1BUV6	ATP-dependent lipid A-core flippase	4.13e-04	NA	1.11e-05	NA
7. B	A0A0G2K1Q8	Phospholipid-transporting ATPase ABCA3	1.02e-02	NA	8.34e-06	NA
7. B	Q7NU46	Taurine import ATP-binding protein TauB	2.48e-04	NA	2.01e-06	NA
7. B	Q81V36	Ribose import ATP-binding protein RbsA	7.23e-05	NA	6.73e-06	NA
7. B	Q7UBD0	Maltose/maltodextrin import ATP-binding protein MalK	2.67e-03	NA	1.79e-13	NA
7. B	Q5WVN2	ATP-dependent lipid A-core flippase	7.64e-07	NA	7.25e-07	NA
7. B	Q8ST87	ABC transporter C family member 10	1.50e-02	NA	1.66e-05	NA
7. B	Q88G95	Molybdenum import ATP-binding protein ModC	2.29e-03	NA	5.37e-10	NA
7. B	Q9Z411	Phosphate import ATP-binding protein PstB	1.34e-03	NA	2.06e-09	NA
7. B	Q47Y12	Phosphate import ATP-binding protein PstB	1.36e-03	NA	1.18e-13	NA
7. B	P54718	Uncharacterized ABC transporter ATP-binding protein YfiB	1.35e-06	NA	5.78e-06	NA
7. B	D3GE74	ABC transporter G family member STR	1.62e-01	NA	0.010	NA
7. B	Q9HT73	Zinc import ATP-binding protein ZnuC	9.78e-04	NA	1.91e-11	NA
7. B	Q54EK2	ABC transporter C family member 7	1.30e-02	NA	2.30e-04	NA
7. B	Q9JI39	ATP-binding cassette sub-family B member 10, mitochondrial	1.27e-04	NA	5.03e-06	NA
7. B	Q21GS5	Molybdenum import ATP-binding protein ModC	1.28e-03	NA	4.61e-12	NA
7. B	Q6GH21	Phosphate import ATP-binding protein PstB	2.11e-06	NA	1.66e-10	NA
7. B	Q8XDV7	Phosphonates import ATP-binding protein PhnC	9.57e-06	NA	9.16e-07	NA
7. B	Q1GJU0	Hemin import ATP-binding protein HmuV	4.02e-04	NA	8.83e-04	NA
7. B	Q4KB64	Molybdenum import ATP-binding protein ModC	1.77e-03	NA	2.56e-13	NA
7. B	Q92SA1	Phosphate import ATP-binding protein PstB	1.12e-05	NA	7.08e-10	NA
7. B	Q1QQH1	Phosphate import ATP-binding protein PstB	2.27e-06	NA	2.52e-10	NA
7. B	Q3M4H6	Phosphate import ATP-binding protein PstB 4	1.79e-06	NA	5.91e-09	NA
7. B	Q8TI16	Energy-coupling factor transporter ATP-binding protein EcfA	6.94e-05	NA	4.23e-07	NA
7. B	Q329G7	Ribose import ATP-binding protein RbsA	5.08e-05	NA	6.58e-04	NA
7. B	P37388	Xylose import ATP-binding protein XylG	2.11e-04	NA	5.37e-05	NA
7. B	Q1R4I3	Ribose import ATP-binding protein RbsA	1.25e-04	NA	3.12e-07	NA
7. B	Q3ICT8	Hemin import ATP-binding protein HmuV	4.37e-04	NA	0.004	NA
7. B	Q1RJ91	Putative export ATP-binding/permease protein RBE_0492	1.28e-06	NA	4.84e-04	NA
7. B	Q2YQ73	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.76e-06	NA	4.34e-06	NA
7. B	Q57NA5	Zinc import ATP-binding protein ZnuC	2.51e-04	NA	4.10e-09	NA
7. B	B2KWH4	ABC transporter 1	6.24e-03	NA	4.30e-08	NA
7. B	Q12BB2	Phosphate import ATP-binding protein PstB	2.20e-06	NA	1.43e-12	NA
7. B	Q6LPK6	ATP-dependent lipid A-core flippase	1.33e-04	NA	1.19e-08	NA
7. B	Q6BEX0	Galactofuranose transporter ATP-binding protein YtfR	5.74e-05	NA	7.60e-04	NA
7. B	Q8T6J2	ABC transporter A family member 5	2.34e-02	NA	0.014	NA
7. B	Q96J65	ATP-binding cassette sub-family C member 12	7.51e-03	NA	0.007	NA
7. B	Q2W7J9	Phosphate import ATP-binding protein PstB 2	2.53e-07	NA	5.19e-13	NA
7. B	Q8P0V3	Phosphate import ATP-binding protein PstB 2	3.00e-06	NA	8.45e-10	NA
7. B	Q82G23	Phosphate import ATP-binding protein PstB	1.28e-03	NA	8.58e-09	NA
7. B	Q2YA30	Phosphate import ATP-binding protein PstB	3.51e-05	NA	4.74e-10	NA
7. B	P21440	Phosphatidylcholine translocator ABCB4	2.02e-03	NA	5.47e-09	NA
7. B	O14678	Lysosomal cobalamin transporter ABCD4	1.46e-04	NA	0.035	NA
7. B	P9WQJ7	Mycobactin import ATP-binding/permease protein IrtB	8.11e-06	NA	0.004	NA
7. B	Q2YJH4	Zinc import ATP-binding protein ZnuC	2.25e-03	NA	3.91e-10	NA
7. B	P0CU83	ABC multidrug transporter MDR2	6.28e-03	NA	1.45e-10	NA
7. B	A1AC19	Zinc import ATP-binding protein ZnuC	1.09e-03	NA	2.78e-09	NA
7. B	Q6D437	ATP-dependent lipid A-core flippase	1.44e-04	NA	2.65e-07	NA
7. B	Q8A853	Phosphate import ATP-binding protein PstB	8.62e-07	NA	3.24e-11	NA
7. B	Q03727	Transport/processing ATP-binding protein ComA	2.05e-04	NA	6.67e-09	NA
7. B	Q1R3F6	Phosphonates import ATP-binding protein PhnC	4.01e-09	NA	1.16e-06	NA
7. B	Q5WKG4	Aliphatic sulfonates import ATP-binding protein SsuB 1	3.66e-04	NA	2.24e-11	NA
7. B	P0AAG8	Galactose/methyl galactoside import ATP-binding protein MglA	9.78e-05	NA	1.45e-04	NA
7. B	Q1C0D5	Xylose import ATP-binding protein XylG	1.87e-04	NA	1.65e-04	NA
7. B	Q8PM59	Phosphate import ATP-binding protein PstB	8.76e-04	NA	8.00e-10	NA
7. B	Q0SXQ1	Maltose/maltodextrin import ATP-binding protein MalK	3.27e-03	NA	9.08e-14	NA
7. B	G0SEV9	Translation initiation factor RLI1	2.37e-02	NA	0.001	NA
7. B	P42332	Bacitracin transport ATP-binding protein BcrA	3.07e-04	NA	3.60e-09	NA
7. B	Q6N0I5	Phosphate import ATP-binding protein PstB	2.25e-06	NA	3.56e-10	NA
7. B	Q2FH51	Phosphate import ATP-binding protein PstB	2.29e-06	NA	1.73e-10	NA
7. B	Q668Q3	Fe(3+) ions import ATP-binding protein FbpC	9.85e-05	NA	1.99e-15	NA
7. B	Q3AAA4	Phosphate import ATP-binding protein PstB	1.50e-06	NA	2.22e-10	NA
7. B	Q1B677	Methionine import ATP-binding protein MetN	2.81e-05	NA	6.68e-17	NA
7. B	Q73R11	Putative ABC transporter ATP-binding protein TDE_0282	2.46e-04	NA	9.71e-06	NA
7. B	S0EGU4	ABC transporter BEA3	4.03e-03	NA	5.37e-05	NA
7. B	Q31VE6	Nickel import ATP-binding protein NikE	4.90e-08	NA	1.57e-23	NA
7. B	Q13CI6	Molybdenum import ATP-binding protein ModC	7.05e-03	NA	9.34e-13	NA
7. B	Q6MG08	ATP-binding cassette sub-family F member 1	4.26e-04	NA	4.17e-07	NA
7. B	P39109	Metal resistance protein YCF1	5.83e-03	NA	0.004	NA
7. B	Q1QXH6	Phosphate import ATP-binding protein PstB 1	2.18e-06	NA	1.22e-10	NA
7. B	Q3AJS9	Phosphate import ATP-binding protein PstB	3.90e-06	NA	3.15e-06	NA
7. B	P0A9U1	Probable multidrug ABC transporter ATP-binding protein YbhF	5.88e-05	NA	0.022	NA
7. B	P33360	Glycine betaine uptake system ATP-binding protein YehX	2.75e-05	NA	1.89e-13	NA
7. B	Q8YK28	Phosphonates import ATP-binding protein PhnC 3	8.84e-06	NA	1.90e-12	NA
7. B	Q5E882	Thiamine import ATP-binding protein ThiQ	1.46e-05	NA	1.20e-10	NA
7. B	Q8Y651	Manganese transport system ATP-binding protein MntB	5.09e-05	NA	3.70e-04	NA
7. B	Q663R5	Phosphate import ATP-binding protein PstB 2	7.65e-11	NA	7.33e-12	NA
7. B	Q2SW38	Xylose import ATP-binding protein XylG	6.55e-05	NA	2.08e-04	NA
7. B	Q72PE5	Sulfate/thiosulfate import ATP-binding protein CysA	3.44e-04	NA	2.09e-18	NA
7. B	P36371	Antigen peptide transporter 2	1.46e-03	NA	7.40e-07	NA
7. B	Q8NWT6	Nickel import system ATP-binding protein NikE	1.06e-06	NA	6.03e-18	NA
7. B	Q2RFS8	Energy-coupling factor transporter ATP-binding protein EcfA	6.88e-05	NA	7.98e-10	NA
7. B	Q87G59	Phosphate import ATP-binding protein PstB 2	1.27e-06	NA	2.88e-10	NA
7. B	Q8PNN4	Sulfate/thiosulfate import ATP-binding protein CysA	3.33e-04	NA	7.70e-18	NA
7. B	P45073	Lipopolysaccharide export system ATP-binding protein LptB	8.86e-06	NA	0.001	NA
7. B	Q6G9I0	Nickel import system ATP-binding protein NikD	4.37e-04	NA	2.91e-14	NA
7. B	Q2FFM9	Putative multidrug export ATP-binding/permease protein SAUSA300_1847	9.30e-06	NA	2.24e-07	NA
7. B	Q2KDV1	Phosphonates import ATP-binding protein PhnC	9.17e-06	NA	4.43e-08	NA
7. B	Q5KX47	Phosphate import ATP-binding protein PstB	2.10e-06	NA	5.54e-11	NA
7. B	Q64SM5	Phosphate import ATP-binding protein PstB	1.75e-06	NA	1.20e-10	NA
7. B	Q3M5J9	Aliphatic sulfonates import ATP-binding protein SsuB	9.10e-05	NA	5.70e-14	NA
7. B	P9WQI6	Uncharacterized ABC transporter ATP-binding protein MT2388	2.58e-03	NA	0.002	NA
7. B	Q767L0	ATP-binding cassette sub-family F member 1	3.62e-04	NA	5.60e-07	NA
7. B	Q5PG54	Molybdenum import ATP-binding protein ModC	1.52e-03	NA	1.16e-04	NA
7. B	Q9I6L0	Sulfate/thiosulfate import ATP-binding protein CysA	1.50e-04	NA	2.66e-18	NA
7. B	Q81Y10	Phosphonates import ATP-binding protein PhnC	6.08e-06	NA	9.82e-11	NA
7. B	Q0HTS8	ATP-dependent lipid A-core flippase	5.54e-06	NA	4.89e-07	NA
7. B	Q9EUS2	Phosphate import ATP-binding protein PstB	1.15e-03	NA	2.69e-08	NA
7. B	O31708	Uncharacterized ABC transporter ATP-binding protein YknV	9.08e-06	NA	3.30e-05	NA
7. B	Q48479	O-antigen export system ATP-binding protein RfbB	2.59e-04	NA	0.015	NA
7. B	P63370	Phosphate import ATP-binding protein PstB 2	2.91e-10	NA	2.93e-11	NA
7. B	Q8Y4E9	Phosphate import ATP-binding protein PstB 2	2.32e-06	NA	1.90e-12	NA
7. B	A0A0H2VBH0	Probable ATP-binding protein YheS	1.27e-04	NA	3.09e-06	NA
7. B	Q1J0N0	Phosphate import ATP-binding protein PstB	9.84e-04	NA	7.53e-10	NA
7. B	Q31UX2	Phosphate import ATP-binding protein PstB	1.10e-03	NA	1.02e-11	NA
7. B	Q1QH37	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.26e-05	NA	6.86e-07	NA
7. B	P08720	Nod factor export ATP-binding protein I	3.42e-03	NA	0.010	NA
7. B	Q5DZC6	Maltose/maltodextrin import ATP-binding protein MalK	2.49e-04	NA	7.28e-13	NA
7. B	Q9CF44	Ribose import ATP-binding protein RbsA	1.91e-05	NA	1.76e-06	NA
7. B	Q9FLX5	ABC transporter G family member 8	4.86e-03	NA	0.003	NA
7. B	Q03CA4	Ribose import ATP-binding protein RbsA	4.44e-05	NA	7.55e-05	NA
7. B	P0C886	Autoinducer 2 import ATP-binding protein LsrA	1.22e-03	NA	2.42e-07	NA
7. B	Q9KN92	Phosphate import ATP-binding protein PstB 2	1.33e-06	NA	9.96e-11	NA
7. B	Q92LU2	Molybdenum import ATP-binding protein ModC	1.49e-03	NA	1.10e-11	NA
7. B	Q55DW4	ABC transporter G family member 1	2.03e-01	NA	0.008	NA
7. B	Q2SVP3	Nod factor export ATP-binding protein I	1.22e-03	NA	0.006	NA
7. B	P73788	Phosphate import ATP-binding protein PstB 3	2.56e-06	NA	3.76e-06	NA
7. B	Q5P2S7	ATP-dependent lipid A-core flippase	1.05e-04	NA	1.23e-05	NA
7. B	P72297	Octopine permease ATP-binding protein P	1.36e-05	NA	4.85e-13	NA
7. B	Q9KU04	Phosphate import ATP-binding protein PstB 1	2.92e-06	NA	9.82e-10	NA
7. B	Q58762	Molybdate/tungstate import ATP-binding protein WtpC	1.17e-03	NA	5.73e-10	NA
7. B	P55662	Probable amino-acid ABC transporter ATP-binding protein y4tH	1.62e-06	NA	2.79e-23	NA
7. B	Q9A502	Methionine import ATP-binding protein MetN	1.50e-05	NA	2.21e-20	NA
7. B	Q4ZV10	Macrolide export ATP-binding/permease protein MacB 1	1.05e-02	NA	7.42e-09	NA
7. B	Q1REG5	Molybdenum import ATP-binding protein ModC	1.34e-03	NA	3.70e-05	NA
7. B	Q73KK2	Galactose/methyl galactoside import ATP-binding protein MglA	9.29e-05	NA	7.99e-05	NA
7. B	Q7MU65	Lipoprotein-releasing system ATP-binding protein LolD	3.53e-03	NA	7.42e-10	NA
7. B	Q890R2	Energy-coupling factor transporter ATP-binding protein EcfA1	3.53e-05	NA	6.00e-12	NA
7. B	Q67RE7	Phosphate import ATP-binding protein PstB 2	1.22e-03	NA	1.32e-08	NA
7. B	Q2G0V2	Methionine import ATP-binding protein MetN 1	2.63e-05	NA	1.42e-21	NA
7. B	Q8FCQ2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.70e-04	NA	7.35e-11	NA
7. B	Q637E2	Phosphonates import ATP-binding protein PhnC	8.35e-06	NA	5.83e-11	NA
7. B	Q1AS06	Spermidine/putrescine import ATP-binding protein PotA	2.21e-04	NA	4.31e-16	NA
7. B	Q1JJC9	Energy-coupling factor transporter ATP-binding protein EcfA1	7.48e-05	NA	8.49e-13	NA
7. B	Q6D2D5	Phosphate import ATP-binding protein PstB 1	3.72e-06	NA	1.10e-07	NA
7. B	Q88AS5	Sulfate/thiosulfate import ATP-binding protein CysA	2.06e-04	NA	5.33e-18	NA
7. B	P44986	Thiamine import ATP-binding protein ThiQ	3.91e-05	NA	1.36e-14	NA
7. B	Q9RRL9	Putative ABC transporter ATP-binding protein DR_2469	9.30e-05	NA	5.59e-07	NA
7. B	Q8REG7	Phosphonates import ATP-binding protein PhnC	2.56e-06	NA	3.17e-08	NA
7. B	P36619	Leptomycin B resistance protein pmd1	2.40e-02	NA	3.65e-10	NA
7. B	Q92P76	Zinc import ATP-binding protein ZnuC	8.84e-06	NA	2.64e-06	NA
7. B	Q5LVM5	Taurine import ATP-binding protein TauB	1.69e-04	NA	6.63e-08	NA
7. B	Q1CE65	Hemin import ATP-binding protein HmuV	3.62e-04	NA	3.65e-08	NA
7. B	Q3A6U0	Phosphate import ATP-binding protein PstB	1.17e-10	NA	4.85e-11	NA
7. B	Q6NBT1	Sulfate/thiosulfate import ATP-binding protein CysA	9.62e-05	NA	1.31e-15	NA
7. B	Q3MGT2	Phosphonates import ATP-binding protein PhnC	1.41e-05	NA	3.05e-12	NA
7. B	Q8ZCX5	Phosphate import ATP-binding protein PstB 1	1.32e-10	NA	2.13e-08	NA
7. B	Q0TLS2	Thiamine import ATP-binding protein ThiQ	3.63e-05	NA	3.07e-12	NA
7. B	A0A1U8QTJ9	ABC-type transporter cicA	4.59e-02	NA	1.92e-04	NA
7. B	Q7N0N3	Putative ABC transporter ATP-binding protein plu3849	1.35e-05	NA	2.51e-05	NA
7. B	Q8K441	ATP-binding cassette sub-family A member 6	3.76e-02	NA	0.013	NA
7. B	Q2K353	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	5.29e-05	NA	1.76e-05	NA
7. B	P0C087	Leukotoxin translocation ATP-binding protein LktB	5.36e-04	NA	1.51e-10	NA
7. B	Q0B775	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	6.30e-05	NA	3.89e-04	NA
7. B	Q54P13	ABC transporter C family member 8	6.81e-02	NA	4.51e-05	NA
7. B	Q92CK1	Putative ABC transporter ATP-binding protein lin1170	5.12e-05	NA	9.03e-06	NA
7. B	Q5MZ54	Bicarbonate transport ATP-binding protein CmpC	7.25e-02	NA	1.04e-09	NA
7. B	Q98EA4	Cytochrome c biogenesis ATP-binding export protein CcmA	1.25e-03	NA	0.026	NA
7. B	B8GYG4	Phosphate import ATP-binding protein PstB	5.61e-07	NA	1.05e-09	NA
7. B	Q2VYP7	Phosphate import ATP-binding protein PstB 3	9.87e-04	NA	1.59e-11	NA
7. B	Q9STT5	ABC transporter A family member 7	3.63e-04	NA	5.65e-05	NA
7. B	P0A9R9	Cell division ATP-binding protein FtsE	2.15e-05	NA	4.99e-10	NA
7. B	P75957	Lipoprotein-releasing system ATP-binding protein LolD	7.31e-06	NA	8.29e-11	NA
7. B	Q9CAF5	ABC transporter I family member 6, chloroplastic	1.66e-04	NA	0.002	NA
7. B	Q6NA00	Phosphonates import ATP-binding protein PhnC 2	1.19e-03	NA	1.54e-12	NA
7. B	Q8PHQ3	Aliphatic sulfonates import ATP-binding protein SsuB 2	3.27e-04	NA	2.11e-14	NA
7. B	Q3IGX5	ATP-dependent lipid A-core flippase	1.36e-04	NA	3.65e-08	NA
7. B	Q5ZUH9	ATP-dependent lipid A-core flippase	1.58e-06	NA	2.05e-07	NA
7. B	Q9WYC4	Uncharacterized ABC transporter ATP-binding protein TM_0288	3.30e-04	NA	2.72e-05	NA
7. B	Q8RHL0	Energy-coupling factor transporter ATP-binding protein EcfA1	2.26e-04	NA	1.13e-08	NA
7. B	Q720Z5	Teichoic acids export ATP-binding protein TagH	1.30e-03	NA	1.78e-05	NA
7. B	Q84TH5	ABC transporter G family member 25	4.31e-02	NA	0.004	NA
7. B	A0K6Q0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.20e-04	NA	1.60e-04	NA
7. B	Q2K8C8	Fe(3+) ions import ATP-binding protein FbpC	4.31e-04	NA	8.35e-16	NA
7. B	Q5FM63	Energy-coupling factor transporter ATP-binding protein EcfA1	1.52e-04	NA	4.12e-11	NA
7. B	Q1WUX2	Phosphate import ATP-binding protein PstB 1	1.97e-06	NA	3.12e-10	NA
7. B	Q03024	Alkaline protease secretion ATP-binding protein AprD	1.21e-04	NA	0.002	NA
7. B	Q042G7	Spermidine/putrescine import ATP-binding protein PotA	1.94e-04	NA	8.89e-13	NA
7. B	Q1RDS4	Aliphatic sulfonates import ATP-binding protein SsuB	1.79e-04	NA	1.97e-13	NA
7. B	E9Q876	Glucosylceramide transporter ABCA12	4.22e-02	NA	0.004	NA
7. B	Q5X498	ATP-dependent lipid A-core flippase	8.17e-07	NA	1.63e-07	NA
7. B	Q8R9L8	Putative ABC transporter ATP-binding protein TTE1589	1.28e-04	NA	1.67e-06	NA
7. B	P9WQJ8	Mycobactin import ATP-binding/permease protein IrtA	2.10e-04	NA	0.019	NA
7. B	O78474	Probable ATP-dependent transporter ycf16	7.34e-05	NA	0.047	NA
7. B	Q326G9	Thiamine import ATP-binding protein ThiQ	1.53e-05	NA	4.91e-12	NA
7. B	Q87H79	Ribose import ATP-binding protein RbsA	2.05e-02	NA	1.04e-07	NA
7. B	Q2K164	Taurine import ATP-binding protein TauB	2.22e-04	NA	5.77e-10	NA
7. B	Q4UJW5	Zinc import ATP-binding protein ZnuC	1.95e-04	NA	9.06e-08	NA
7. B	A0A059JK44	ABC multidrug transporter MDR2	4.90e-03	NA	1.50e-10	NA
7. B	Q7NAQ7	Energy-coupling factor transporter ATP-binding protein EcfA2	3.32e-04	NA	1.31e-07	NA
7. B	Q2RWI9	Molybdenum import ATP-binding protein ModC	1.46e-03	NA	5.48e-10	NA
7. B	Q7N9U4	Phosphate import ATP-binding protein PstB	1.13e-03	NA	5.54e-12	NA
7. B	Q6W2B1	Taurine import ATP-binding protein TauB	3.59e-04	NA	6.67e-14	NA
7. B	Q02QT1	Aliphatic sulfonates import ATP-binding protein SsuB 2	2.79e-04	NA	1.66e-14	NA
7. B	Q0T9T7	Phosphonates import ATP-binding protein PhnC	3.59e-09	NA	5.34e-07	NA
7. B	Q1MCZ1	Hemin import ATP-binding protein HmuV	1.81e-04	NA	1.70e-07	NA
7. B	Q05596	Cobalt import ATP-binding protein CbiO	4.15e-05	NA	3.93e-06	NA
7. B	Q9CP24	Zinc import ATP-binding protein ZnuC	1.32e-03	NA	1.87e-06	NA
7. B	Q2JMJ0	Phosphate import ATP-binding protein PstB 1	1.47e-03	NA	1.67e-06	NA
7. B	Q1R3Q1	Maltose/maltodextrin import ATP-binding protein MalK	1.91e-04	NA	1.84e-13	NA
7. B	P63372	Phosphate import ATP-binding protein PstB 3	1.42e-05	NA	1.42e-11	NA
7. B	Q8P2M5	Probable ABC transporter ATP-binding protein spyM18_0273	4.54e-04	NA	0.008	NA
7. B	P39456	L-cystine import ATP-binding protein TcyC	8.84e-07	NA	2.13e-15	NA
7. B	Q74K65	Spermidine/putrescine import ATP-binding protein PotA	2.09e-04	NA	7.83e-13	NA
7. B	Q5PKZ8	Maltose/maltodextrin import ATP-binding protein MalK	3.07e-03	NA	6.69e-14	NA
7. B	Q8UA86	Ribose import ATP-binding protein RbsA 1	2.06e-03	NA	8.59e-04	NA
7. B	Q663Y5	Xylose import ATP-binding protein XylG	1.65e-04	NA	1.65e-04	NA
7. B	Q3K199	Phosphate import ATP-binding protein PstB 1	1.18e-03	NA	7.74e-10	NA
7. B	Q15QL7	Phosphate import ATP-binding protein PstB	1.37e-03	NA	1.47e-10	NA
7. B	P0A9S9	High-affinity branched-chain amino acid transport ATP-binding protein LivG	4.90e-05	NA	2.13e-08	NA
7. B	Q4ZU82	Phosphonates import ATP-binding protein PhnC 2	2.70e-06	NA	3.36e-07	NA
7. B	P69879	Phosphate import ATP-binding protein PstB	2.30e-06	NA	1.73e-10	NA
7. B	P36497	Pediocin PA-1 transport/processing ATP-binding protein PedD	1.60e-04	NA	1.21e-06	NA
7. B	Q6D2F6	Fe(3+) ions import ATP-binding protein FbpC 2	7.84e-05	NA	6.05e-14	NA
7. B	Q9RKC6	Putative ABC transporter ATP-binding protein SCO3161	4.19e-06	NA	2.93e-08	NA
7. B	P0CZ36	Phosphate import ATP-binding protein PstB 1	1.58e-06	NA	1.58e-07	NA
7. B	P21958	Antigen peptide transporter 1	7.93e-05	NA	1.04e-04	NA
7. B	Q1BWL4	Aliphatic sulfonates import ATP-binding protein SsuB 1	7.44e-04	NA	3.60e-13	NA
7. B	Q6ADG4	Phosphate import ATP-binding protein PstB	1.14e-03	NA	1.90e-06	NA
7. B	Q0TGX4	Zinc import ATP-binding protein ZnuC	8.39e-04	NA	2.78e-09	NA
7. B	A0KAV6	Taurine import ATP-binding protein TauB	2.72e-04	NA	1.84e-10	NA
7. B	Q3SP57	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.51e-04	NA	1.04e-06	NA
7. B	Q3KFY6	Cytochrome c biogenesis ATP-binding export protein CcmA	8.18e-04	NA	7.53e-04	NA
7. B	Q03ZL6	Energy-coupling factor transporter ATP-binding protein EcfA1	2.79e-04	NA	1.03e-14	NA
7. B	Q8Z8W8	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	1.18e-04	NA	3.32e-18	NA
7. B	Q7W8Q6	Phosphate import ATP-binding protein PstB	5.54e-06	NA	5.14e-11	NA
7. B	Q8DG84	Putative ABC transporter ATP-binding protein tll2439	1.51e-05	NA	4.91e-05	NA
7. B	Q2FYQ7	Nickel import system ATP-binding protein NikD	3.94e-04	NA	2.91e-14	NA
7. B	Q5PBX2	Lipoprotein-releasing system ATP-binding protein LolD	1.81e-04	NA	5.22e-09	NA
7. B	P94366	ATP-binding/permease protein CydC	3.18e-05	NA	0.018	NA
7. B	Q48PV0	Zinc import ATP-binding protein ZnuC	8.94e-04	NA	2.41e-10	NA
7. B	Q86UQ4	ATP-binding cassette sub-family A member 13	NA	NA	2.43e-05	NA
7. B	Q8YDR7	Putative ATP-binding protein BMEII0108	5.87e-03	NA	0.007	NA
7. B	P40024	ABC transporter ATP-binding protein ARB1	2.13e-04	NA	0.001	NA
7. B	P55604	Uncharacterized ABC transporter ATP-binding protein y4oS	1.76e-04	NA	4.71e-13	NA
7. B	Q87S48	Phosphate import ATP-binding protein PstB 1	1.32e-03	NA	1.25e-09	NA
7. B	Q1M5X4	Ribose import ATP-binding protein RbsA 2	4.70e-05	NA	0.002	NA
7. B	Q8EDF0	ATP-dependent lipid A-core flippase	8.11e-06	NA	1.60e-06	NA
7. B	Q93KD4	Tungstate uptake system ATP-binding protein TupC	3.11e-05	NA	9.21e-09	NA
7. B	Q59R09	Iron-sulfur clusters transporter ATM1, mitochondrial	7.17e-05	NA	7.76e-04	NA
7. B	Q64Z80	Lipoprotein-releasing system ATP-binding protein LolD	3.03e-05	NA	1.25e-11	NA
7. B	O07016	Uncharacterized ABC transporter ATP-binding protein YvfR	6.79e-05	NA	2.75e-04	NA
7. B	Q398W2	Ribose import ATP-binding protein RbsA 2	7.26e-05	NA	0.004	NA
7. B	A7ZLX1	Putative autoinducer 2 import ATP-binding protein LsrA homolog	8.82e-04	NA	0.040	NA
7. B	Q321G6	Vitamin B12 import ATP-binding protein BtuD	6.00e-04	NA	0.014	NA
7. B	Q6D734	Fe(3+) ions import ATP-binding protein FbpC 1	1.29e-04	NA	1.02e-16	NA
7. B	O34362	Putative HMP/thiamine import ATP-binding protein YkoD	1.03e-04	NA	3.91e-04	NA
7. B	Q0TJC1	Aliphatic sulfonates import ATP-binding protein SsuB	1.82e-04	NA	1.66e-13	NA
7. B	Q9UZU7	Phosphate import ATP-binding protein PstB	1.23e-06	NA	4.67e-14	NA
7. B	O53645	Multidrug efflux ATP-binding/permease protein Rv0194	2.02e-03	NA	1.31e-08	NA
7. B	P75831	Macrolide export ATP-binding/permease protein MacB	2.36e-02	NA	6.77e-08	NA
7. B	Q1CC21	Maltose/maltodextrin import ATP-binding protein MalK	2.50e-03	NA	6.75e-14	NA
7. B	Q1H0W2	Hemin import ATP-binding protein HmuV	3.89e-04	NA	2.57e-04	NA
7. B	Q88ZZ2	Putative ABC transporter ATP-binding protein lp_0149	7.17e-05	NA	1.96e-10	NA
7. B	C0SPB4	Uncharacterized ABC transporter ATP-binding protein YhaQ	5.05e-05	NA	2.48e-05	NA
7. B	P9WQI7	Uncharacterized ABC transporter ATP-binding protein Rv2326c	2.88e-03	NA	0.002	NA
7. B	P44871	Cell division ATP-binding protein FtsE	2.79e-05	NA	3.98e-08	NA
7. B	Q71WT3	Phosphate import ATP-binding protein PstB 1	2.21e-06	NA	3.80e-12	NA
7. B	Q8TK65	Putative ABC transporter ATP-binding protein MA_3551	1.01e-04	NA	6.34e-09	NA
7. B	Q1Q889	Zinc import ATP-binding protein ZnuC	5.35e-04	NA	1.06e-06	NA
7. B	Q8DPB4	Phosphate import ATP-binding protein PstB 2	2.93e-06	NA	3.61e-10	NA
7. B	Q13RB6	Xylose import ATP-binding protein XylG	4.92e-05	NA	7.48e-04	NA
7. B	Q1C2S1	Taurine import ATP-binding protein TauB	2.09e-04	NA	4.94e-09	NA
7. B	Q1CGT1	Galactose/methyl galactoside import ATP-binding protein MglA	1.61e-04	NA	2.28e-05	NA
7. B	Q0A9E2	Zinc import ATP-binding protein ZnuC	2.01e-04	NA	5.58e-08	NA
7. B	Q1MFL8	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.18e-04	NA	8.38e-14	NA
7. B	Q9M1Q9	ABC transporter B family member 21	4.22e-04	NA	4.28e-10	NA
7. B	P48334	Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region	7.28e-05	NA	0.005	NA
7. B	Q5QZP7	Cytochrome c biogenesis ATP-binding export protein CcmA	1.34e-03	NA	0.007	NA
7. B	P70170	ATP-binding cassette sub-family C member 9	1.49e-01	NA	2.98e-04	NA
7. B	Q2FER8	Energy-coupling factor transporter ATP-binding protein EcfA2	9.44e-05	NA	5.13e-13	NA
7. B	P0A9X2	Zinc import ATP-binding protein ZnuC	1.50e-03	NA	2.78e-09	NA
7. B	Q5NNN6	Phosphate import ATP-binding protein PstB	9.43e-05	NA	4.30e-10	NA
7. B	Q5PDF8	Thiamine import ATP-binding protein ThiQ	1.33e-05	NA	1.33e-11	NA
7. B	Q7VZE5	Sulfate/thiosulfate import ATP-binding protein CysA	5.76e-04	NA	1.14e-15	NA
7. B	O34631	Uncharacterized ABC transporter ATP-binding protein YvrA	2.37e-03	NA	1.01e-05	NA
7. B	Q8K9I3	ATP-binding protein Uup	7.43e-04	NA	7.60e-07	NA
7. B	Q6C6N0	Iron-sulfur clusters transporter ATM1, mitochondrial	1.50e-02	NA	0.001	NA
7. B	Q1MEG2	Zinc import ATP-binding protein ZnuC	3.59e-03	NA	1.75e-05	NA
7. B	Q2LTG0	Phosphate import ATP-binding protein PstB	9.78e-04	NA	1.81e-09	NA
7. B	Q0VQP5	ATP-dependent lipid A-core flippase	8.74e-06	NA	1.64e-06	NA
7. B	O28437	Putative ABC transporter ATP-binding protein AF_1841	5.17e-06	NA	3.96e-05	NA
7. B	Q2NTI7	Zinc import ATP-binding protein ZnuC	1.37e-03	NA	2.01e-05	NA
7. B	A0A095C325	ABC multidrug transporter MDR1	1.33e-02	NA	7.81e-10	NA
7. B	P37732	Molybdenum import ATP-binding protein ModC 1	1.30e-03	NA	1.75e-11	NA
7. B	Q2SS06	Phosphate import ATP-binding protein PstB	1.24e-06	NA	1.22e-10	NA
7. B	Q3ABN1	Energy-coupling factor transporter ATP-binding protein EcfA	1.40e-04	NA	2.04e-07	NA
7. B	Q8NR42	Aliphatic sulfonates import ATP-binding protein SsuB	1.81e-05	NA	1.31e-10	NA
7. B	Q4PH16	Iron-sulfur clusters transporter ATM1, mitochondrial	5.80e-05	NA	3.83e-04	NA
7. B	E7F6F7	Iron-sulfur clusters transporter ABCB7, mitochondrial	1.11e-04	NA	1.35e-08	NA
7. B	P21410	Fe(3+) ions import ATP-binding protein FbpC	1.16e-04	NA	2.99e-15	NA
7. B	Q8N139	ATP-binding cassette sub-family A member 6	4.88e-02	NA	3.18e-04	NA
7. B	Q1RGL1	Zinc import ATP-binding protein ZnuC	2.60e-04	NA	3.92e-09	NA
7. B	Q54JR2	ABC transporter C family member 3	2.55e-03	NA	0.030	NA
7. B	Q0K2U3	Taurine import ATP-binding protein TauB	2.26e-04	NA	1.61e-08	NA
7. B	Q2P2Y5	Phosphate import ATP-binding protein PstB	1.76e-06	NA	6.41e-10	NA
7. B	P47532	Probable ABC transporter ATP-binding protein p29	4.90e-06	NA	3.81e-09	NA
7. B	Q4QND5	Zinc import ATP-binding protein ZnuC	1.58e-04	NA	2.96e-08	NA
7. B	D3ZHR2	ATP-binding cassette sub-family D member 1	2.51e-03	NA	0.011	NA
7. B	P16678	Putative phosphonates utilization ATP-binding protein PhnK	1.67e-08	NA	1.64e-22	NA
7. B	Q8XIZ5	Spermidine/putrescine import ATP-binding protein PotA	1.29e-04	NA	1.36e-14	NA
7. B	Q1GID1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	6.27e-04	NA	3.84e-13	NA
7. B	Q5WBL0	Aliphatic sulfonates import ATP-binding protein SsuB 3	4.21e-04	NA	3.10e-12	NA
7. B	P63365	Phosphate import ATP-binding protein PstB	1.21e-03	NA	1.08e-11	NA
7. B	Q2RS22	Nickel import ATP-binding protein NikE	6.10e-08	NA	1.06e-23	NA
7. B	Q8X4V7	Molybdenum import ATP-binding protein ModC	1.62e-03	NA	5.30e-05	NA
7. B	Q88JJ0	Phosphate import ATP-binding protein PstB 1	1.79e-03	NA	5.83e-06	NA
7. B	Q864R9	Multidrug resistance-associated protein 1	5.35e-03	NA	0.001	NA
7. B	Q8ZKQ4	Autoinducer 2 import ATP-binding protein LsrA	2.10e-03	NA	2.34e-07	NA
7. B	Q8RY46	ABC transporter B family member 26, chloroplastic	2.62e-05	NA	1.31e-07	NA
7. B	Q9LSJ5	ABC transporter B family member 18	1.21e-02	NA	8.82e-08	NA
7. B	Q2K4V4	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	1.71e-04	NA	2.89e-12	NA
7. B	Q6CZ34	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.48e-04	NA	2.15e-10	NA
7. B	Q733D6	Phosphonates import ATP-binding protein PhnC	6.54e-06	NA	7.16e-11	NA
7. B	Q3KC21	Molybdenum import ATP-binding protein ModC	1.86e-03	NA	1.88e-12	NA
7. B	Q03JH1	Spermidine/putrescine import ATP-binding protein PotA	2.09e-04	NA	1.20e-16	NA
7. B	Q2NK31	Spermidine/putrescine import ATP-binding protein PotA	1.15e-05	NA	1.21e-13	NA
7. B	Q24739	Protein brown	NA	NA	0.005	NA
7. B	Q164Y5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.81e-04	NA	1.00e-16	NA
7. B	Q13CR0	Phosphate import ATP-binding protein PstB	1.93e-06	NA	1.08e-09	NA
7. B	Q82WC8	Cytochrome c biogenesis ATP-binding export protein CcmA	1.25e-03	NA	0.018	NA
7. B	Q63V79	Phosphate import ATP-binding protein PstB	3.78e-05	NA	1.05e-11	NA
7. B	Q13KX9	Taurine import ATP-binding protein TauB 2	2.26e-04	NA	1.76e-08	NA
7. B	P32016	Capsule polysaccharide export ATP-binding protein CtrD	1.03e-03	NA	0.032	NA
7. B	Q0P9C4	Protein glycosylation K	2.10e-04	NA	1.33e-08	NA
7. B	A0LCH8	Zinc import ATP-binding protein ZnuC	9.91e-04	NA	1.20e-08	NA
7. B	P46920	Glycine betaine transport ATP-binding protein OpuAA	8.15e-05	NA	2.38e-13	NA
7. B	Q31VE7	Nickel import ATP-binding protein NikD	2.33e-06	NA	5.42e-19	NA
7. B	Q13LX0	Ribose import ATP-binding protein RbsA	1.52e-04	NA	1.69e-04	NA
7. B	P45031	Intermembrane phospholipid transport system ATP-binding protein MlaF	5.39e-06	NA	0.014	NA
7. B	Q9CEW7	Phosphate import ATP-binding protein PstB 2	1.41e-03	NA	3.03e-12	NA
7. B	Q8T685	ABC transporter G family member 12	3.70e-03	NA	6.99e-04	NA
7. B	Q82CD3	Aliphatic sulfonates import ATP-binding protein SsuB 2	6.34e-05	NA	7.78e-11	NA
7. B	Q46L27	Phosphate import ATP-binding protein PstB	2.44e-06	NA	2.01e-07	NA
7. B	Q88C57	Phosphate import ATP-binding protein PstB 2	1.30e-03	NA	1.58e-09	NA
7. B	P68187	Maltose/maltodextrin import ATP-binding protein MalK	1.92e-04	NA	1.84e-13	NA
7. B	P75186	Phosphate import ATP-binding protein PstB	5.37e-07	NA	1.96e-10	NA
7. B	Q72GX5	Phosphate import ATP-binding protein PstB	2.37e-06	NA	1.70e-11	NA
7. B	Q7TNJ2	ATP-binding cassette sub-family A member 7	3.52e-02	NA	1.79e-05	NA
7. B	Q5XCA4	Spermidine/putrescine import ATP-binding protein PotA	1.67e-04	NA	2.08e-16	NA
7. B	Q7NZI7	Phosphate import ATP-binding protein PstB	2.06e-06	NA	1.95e-10	NA
7. B	Q9HS13	Phosphate import ATP-binding protein PstB 1	4.11e-06	NA	6.50e-10	NA
7. B	O32151	Uncharacterized ABC transporter ATP-binding protein YurJ	6.36e-04	NA	1.95e-14	NA
7. B	Q3J376	Phosphate import ATP-binding protein PstB	2.12e-06	NA	8.22e-13	NA
7. B	Q4KK16	Taurine import ATP-binding protein TauB	2.03e-04	NA	3.26e-08	NA
7. B	P46342	Phosphate import ATP-binding protein PstB 1	1.11e-03	NA	1.08e-10	NA
7. B	J9VF33	ABC multidrug transporter MDR1	1.26e-02	NA	8.22e-09	NA
7. B	Q12L15	Phosphate import ATP-binding protein PstB	2.33e-06	NA	4.96e-11	NA
7. B	Q166X0	Phosphonates import ATP-binding protein PhnC 2	7.48e-05	NA	3.89e-09	NA
7. B	Q88J90	Ribose import ATP-binding protein RbsA	2.94e-05	NA	0.001	NA
7. B	B1LFA2	Autoinducer 2 import ATP-binding protein LsrA	5.09e-04	NA	2.04e-07	NA
7. B	Q48TC3	Phosphate import ATP-binding protein PstB 1	1.28e-03	NA	1.70e-07	NA
7. B	Q8FZV2	Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363	6.43e-05	NA	6.99e-06	NA
7. B	Q0AGF4	Spermidine/putrescine import ATP-binding protein PotA	4.79e-04	NA	6.77e-16	NA
7. B	Q21CA3	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.66e-04	NA	5.57e-12	NA
7. B	P69880	Phosphate import ATP-binding protein PstB	2.02e-06	NA	1.73e-10	NA
7. B	P33311	ATP-dependent permease MDL2, mitochondrial	2.28e-03	NA	1.22e-12	NA
7. B	Q8XBJ8	Sulfate/thiosulfate import ATP-binding protein CysA	7.93e-04	NA	5.67e-15	NA
7. B	Q5WXF0	Spermidine/putrescine import ATP-binding protein PotA	1.43e-04	NA	3.00e-14	NA
7. B	A8AHA1	Vitamin B12 import ATP-binding protein BtuD	3.23e-04	NA	0.007	NA
7. B	Q4ZZ16	ATP-dependent lipid A-core flippase	9.26e-05	NA	1.39e-05	NA
7. B	Q28Q03	Phosphate import ATP-binding protein PstB	1.48e-03	NA	2.82e-11	NA
7. B	Q1MMZ3	Phosphonates import ATP-binding protein PhnC	3.27e-05	NA	2.21e-08	NA
7. B	Q6FZF2	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.46e-06	NA	4.14e-06	NA
7. B	P04285	Oligopeptide transport ATP-binding protein OppD	1.08e-12	NA	3.20e-33	NA
7. B	P53756	ABC transporter ATP-binding protein/permease PDR18	7.01e-03	NA	0.017	NA
7. B	Q64343	ATP-binding cassette sub-family G member 1	1.38e-02	NA	1.37e-05	NA
7. B	P0CZ43	Probable ABC transporter ATP-binding protein SPs0214	4.82e-04	NA	0.009	NA
7. B	Q4ZLS1	Aliphatic sulfonates import ATP-binding protein SsuB 3	3.13e-04	NA	4.72e-16	NA
7. B	Q02592	Heavy metal tolerance protein	1.33e-04	NA	7.51e-07	NA
7. B	Q1C1Y5	Thiamine import ATP-binding protein ThiQ	2.24e-05	NA	1.85e-10	NA
7. B	G2JZ44	Carnitine transport ATP-binding protein OpuCA	8.49e-05	NA	1.53e-16	NA
7. B	Q080T2	ATP-dependent lipid A-core flippase	1.59e-04	NA	2.81e-07	NA
7. B	Q73P93	Putative ABC transporter ATP-binding protein TDE_0906	6.63e-05	NA	7.25e-06	NA
7. B	Q6MTC1	Phosphate import ATP-binding protein PstB	1.23e-06	NA	2.43e-10	NA
7. B	Q880Z2	Xylose import ATP-binding protein XylG	9.71e-05	NA	3.24e-04	NA
7. B	P04983	Ribose import ATP-binding protein RbsA	1.20e-04	NA	3.23e-07	NA
7. B	Q9K8N1	Phosphonates import ATP-binding protein PhnC 3	7.49e-06	NA	5.50e-10	NA
7. B	Q9WXX8	Probable metal transport system ATP-binding protein TM_0124	5.44e-04	NA	3.50e-07	NA
7. B	A2RI02	Energy-coupling factor transporter ATP-binding protein EcfA2	9.26e-05	NA	1.44e-11	NA
7. B	P45288	Peptide transport system ATP-binding protein SapD	2.87e-07	NA	2.16e-17	NA
7. B	P12428	Protein brown	6.70e-02	NA	0.017	NA
7. B	Q32HA3	Zinc import ATP-binding protein ZnuC	1.16e-03	NA	2.91e-09	NA
7. B	Q93FG6	Leukotoxin translocation ATP-binding protein LktB	6.91e-04	NA	1.46e-10	NA
7. B	Q87C88	Phosphate import ATP-binding protein PstB	8.99e-04	NA	6.32e-09	NA
7. B	Q39GY8	Ribose import ATP-binding protein RbsA 1	1.01e-03	NA	0.011	NA