Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54652.1
JCVISYN3A_0169

Oligopeptide ABC transporter substrate-binding protein.
M. mycoides homolog: Q6MU57.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 24
Unique PROST Go: 1
Unique BLAST Go: 5
Unique Foldseek Go: 12

Total Homologs: 85
Unique PROST Homologs: 0
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 76

Literature

Danchin and Fang [1]: external peptide binding lipoprotein|lipoprotein signal; extracellular protein associated to the membrane
Yang and Tsui [2]: Oligopeptide transport system permease protein OppA
Antczak et al. [3]: oppA; Oligopeptide binding protein
Zhang et al. [4]: GO:0006857|oligopeptide transport
Bianchi et al. [5]: "Oligopeptide transport system, substrate binding"

Structures and Sequence Alignment

The best structural homolog that predicted by 3. BF was P0A4G0 (Oligopeptide-binding protein AliB) with a FATCAT P-Value: 7.08e-12 and RMSD of 2.87 angstrom. The sequence alignment identity is 25.1%.
Structural alignment shown in left. Query protein AVX54652.1 colored as red in alignment, homolog P0A4G0 colored as blue. Query protein AVX54652.1 is also shown in right top, homolog P0A4G0 showed in right bottom. They are colored based on secondary structures. 

  AVX54652.1 MKKVLG--MTLLGSIIATAV-ASAVSCSVGIS--LDKILN-RKNSNTRVLRELTNYSLANLNSATNNTSNDADIIANLQDVLLAVNNHDHYEG----ALA 90
      P0A4G0 MKKSKSKYLTLAGLVLGTGVLLSA--C--GNSSTASKTYNYVYSSDPSSL----NY-LAE-NRAA--TS---DIVANLVDGLLE-N--DQY-GNIIPSLA 81

  AVX54652.1 EYWDHNKDSDYWKFRLRKNAYW-TKIENSKQVKGD---LITGQDLFNT-FRYVLNKNNLALTTEHFLTNFKYVPQLMDFI-DKLSDPKYDKSNGQAKPDK 184
      P0A4G0 EDWTVSQDGLTYTYKLRKDAKWFTS-------EGEEYAPVTAQD-FVTGLQYAADKKSEAL----YLVQ-DSVAGLDDYITGKTSD--FS-TVG-VK--A 162

  AVX54652.1 LYDSRFNKDL--PGDLRTNELRSSYWIDRAILAFNIEPTNEEKAKNLALDLSMSTKQLAKKSFEEGKIVDNGKSKEKNDNSNGLDSSIFDIG-FHLSKKI 281
      P0A4G0 LDDQTVQYTLVKP------EL---YWNSKT-LATILFPVNA--------DF------L--KS--KGD--DFGKA----DPS----SILYN-GPF-LMK-- 220

  AVX54652.1 SYFESVISYLAFAPIPEVALLYAEDSGQKSNIYAGTNYGKPLARKSGYNGLWYSGPYVIQDYFPGSNLNLTKNEFYYNKENVHIEKILYSYVNKADAAT- 380
      P0A4G0 ----ALVS--------KSAIEY------KKN----PNY-------------W--------D---------AKNVFV---DDV---KLTY-Y-DGSDQESL 260

  AVX54652.1 -RRFLFET-GDVSSTRI--NANDLAGYK-KYVGSDESNPVFEGTNVL-KQKPTTTWAFGFNFNTKETSIYDDIKLDQEGSLVPTKRRVRTPEEDSILNRA 474
      P0A4G0 ERNF---TAGAYTTARLFPNSSSYEGIKEKY-----KN------NIIYSMQNSTSY-F-FNFN-----------LD---------R-------------- 310

  AVX54652.1 IALKSLRIMTRFVLNRSLYAKFFSEAKDGNNHPVSSQLRNTFTSKYVSTYNDKEHKVLDKKSQNTVADYADFLAKDYYDITKYDDNNKKLNNTNSVSSTP 574
      P0A4G0 ---KS-------------Y----------N-----------YTSK---T-SD-----IEKKS--T---QEAVL-------------NK--NFRQAINFAF 344

  AVX54652.1 VRTRRATPSGT-SESSSASTEQQSWSDWMIKVLQKHSLYDESRLTSWANRFGKVKDKKDLKNTEKVSVYSEGNDAFLENDLLAFTAFLKEDQLQSK--NG 671
      P0A4G0 DRTS----YGAQSEGKEGAT----------KIL--RNL-----VVP-PN-F--------------VSI--KGKD-F--GEVVA-----------SKMVNY 391

  AVX54652.1 GQD--G-TF-DLKRDPNKVEFKNPELAKEFGKLIGVYDKDFDPKKDYQNQDSKLSTLYKKINLLKQQVKEDLKNTSGITSNKPITIPFLLDPTGADDFKI 767
      P0A4G0 GKEWQGINFAD-GQDP----YYNPEKAKA---------KFAEAKKEL---EAK--GVQFPIHL-------D-K-TVEVT-DK-VGI------QGVSSIKQ 455

  AVX54652.1 KIQRLFGAFNYLVRNKGNGDIDSPFVFDIDKPIDQSAYLKQ---RRDSKFGL--GAFGWSPDYDDPTNYLATLKYGGVYEHIQGWKKLFNGSELKTTNGS 862
      P0A4G0 SIESVLGSDNVVI------DIQQ--LTS-DE-FDSSGYFAQTAAQKD--YDLYHG--GWGPDYQDPSTYL----------------DIFN-----TNSG- 519

  AVX54652.1 NKKGI--KLTLKKSDG-TSEKAFKELKDALQFFTNELTEIDEN-EVDIYKRYTRLAQLENFYTLSSAIIIPTHTHQADTLPIISYLDEFSKPTWPTGSHA 958
      P0A4G0 ---GFLQNLGLE--PGEANDKA-KAV--GLDVYTQML-E-EANKEQDPAKRYEKYADI-QAWLIDSSLVLPS-VSRGGT-P--S-L----RRTVPFAA-A 598

  AVX54652.1 RRLVGVRMFDKIVTK--EQFKKQKENFDKETLNGYRSVYPKTFDSKSNKNIYFDQFKGNWREEWKKEYESKNKK----LNK--- 1033
      P0A4G0 YGLTG--------TKGVESYKYLKVQ-DK--I-----V---TTD---------EYAKA--REKWLKEKEESNKKAQEELAKHVK 652

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
3. BF GO:0043190 ATP-binding cassette (ABC) transporter complex
3. BF GO:0015833 peptide transport
3. BF GO:0055085 transmembrane transport
3. BF GO:0015031 protein transport
3. BF GO:1904680 peptide transmembrane transporter activity
3. BF GO:0030288 outer membrane-bounded periplasmic space
5. P GO:0005886 plasma membrane
6. F GO:0003677 DNA binding
6. F GO:0015675 nickel cation transport
6. F GO:0046488 phosphatidylinositol metabolic process
6. F GO:0045892 negative regulation of transcription, DNA-templated
6. F GO:0009247 glycolipid biosynthetic process
6. F GO:0045893 positive regulation of transcription, DNA-templated
6. F GO:0042597 periplasmic space
6. F GO:0042938 dipeptide transport
6. F GO:0006825 copper ion transport
6. F GO:0030435 sporulation resulting in formation of a cellular spore
6. F GO:0030420 establishment of competence for transformation
6. F GO:0006824 cobalt ion transport
7. B GO:0006857 oligopeptide transport
7. B GO:0042939 tripeptide transport
7. B GO:1900750 oligopeptide binding
7. B GO:0009408 response to heat
7. B GO:0061077 chaperone-mediated protein folding

Uniprot GO Annotations

GO Description

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF P75327 Uncharacterized lipoprotein MG321 homolog 7.10e-03 5.71e-06 NA 0.2905
2. PF P47563 Uncharacterized lipoprotein MG321 6.88e-03 1.83e-04 NA 0.3805
3. BF P35592 Oligopeptide-binding protein AliA 1.04e-08 NA 0.002 0.7339
3. BF P0A4G1 Oligopeptide-binding protein AliB 3.17e-10 NA 2.80e-04 0.7446
3. BF P18791 Oligopeptide-binding protein AmiA 6.43e-09 NA 0.003 0.7646
3. BF P31306 Oligopeptide-binding protein SarA 7.56e-11 NA 1.82e-07 0.7273
3. BF P0A4G0 Oligopeptide-binding protein AliB 7.08e-12 NA 2.80e-04 0.7545
6. F Q8X6V9 Glutathione-binding protein GsiB 2.34e-04 NA NA 0.6197
6. F Q8ZQM3 Glutathione-binding protein GsiB 2.33e-04 NA NA 0.6252
6. F A4TQA7 HTH-type transcriptional regulator SgrR 3.84e-02 NA NA 0.3986
6. F P75324 Uncharacterized lipoprotein MPN_459 3.36e-02 NA NA 0.362
6. F Q8CW88 Glutathione-binding protein GsiB 1.32e-04 NA NA 0.6491
6. F Q9CEK0 Oligopeptide-binding protein OppA 2.64e-03 NA NA 0.5963
6. F Q323W4 Glutathione-binding protein GsiB 1.12e-04 NA NA 0.655
6. F Q326G6 HTH-type transcriptional regulator SgrR 2.65e-02 NA NA 0.39
6. F Q66EM6 HTH-type transcriptional regulator SgrR 1.76e-02 NA NA 0.3981
6. F A2RI74 Dipeptide-binding protein 3.36e-06 NA NA 0.7094
6. F Q577J8 Putative ABC transporter peptide-binding protein BruAb2_0792 1.35e-03 NA NA 0.6445
6. F Q5PGP4 Glutathione-binding protein GsiB 2.16e-04 NA NA 0.6414
6. F Q8XA02 HTH-type transcriptional regulator SgrR 4.50e-02 NA NA 0.3902
6. F Q2YKJ5 Putative binding protein BAB2_0664 2.21e-04 NA NA 0.5286
6. F P06202 Periplasmic oligopeptide-binding protein 1.52e-06 NA NA 0.6705
6. F P26906 Dipeptide-binding protein DppE 1.10e-06 NA NA 0.6913
6. F Q2YJK2 Putative peptide-binding periplasmic protein BAB2_1049 2.74e-04 NA NA 0.6319
6. F Q1RGC7 HTH-type transcriptional regulator SgrR 2.81e-02 NA NA 0.3964
6. F A1A7B8 HTH-type transcriptional regulator SgrR 2.34e-02 NA NA 0.3869
6. F Q74Q56 HTH-type transcriptional regulator SgrR 1.37e-03 NA NA 0.3882
6. F Q0TLR9 HTH-type transcriptional regulator SgrR 4.76e-02 NA NA 0.3898
6. F Q7N125 HTH-type transcriptional regulator SgrR 6.58e-02 NA NA 0.3937
6. F A0A0H2ZGV2 Di/tripeptide-binding protein 1 1.07e-04 NA NA 0.6237
6. F Q07741 Oligopeptide-binding protein OppA 1.55e-03 NA NA 0.6178
6. F P24141 Oligopeptide-binding protein OppA 1.37e-05 NA NA 0.6674
6. F P59984 Uncharacterized lipoprotein Mb2616c 3.89e-03 NA NA 0.5218
6. F Q6D3B0 Glutathione-binding protein GsiB 2.03e-04 NA NA 0.6309
6. F P45285 Peptide transport periplasmic protein SapA 1.57e-04 NA NA 0.591
6. F Q8FL80 HTH-type transcriptional regulator SgrR 4.06e-02 NA NA 0.3908
6. F P9WGU4 Uncharacterized protein MT1317 1.75e-03 NA NA 0.5097
6. F Q8Z863 Glutathione-binding protein GsiB 2.48e-04 NA NA 0.6221
6. F A0A0H2ZGW2 Di/tripeptide-binding protein 2 1.53e-04 NA NA 0.662
6. F Q1RE95 Glutathione-binding protein GsiB 1.27e-04 NA NA 0.648
6. F P9WL76 Uncharacterized lipoprotein MT2662 8.57e-03 NA NA 0.4517
6. F Q57RB1 Glutathione-binding protein GsiB 2.30e-04 NA NA 0.6573
6. F Q8ZRV0 HTH-type transcriptional regulator SgrR 3.61e-02 NA NA 0.3844
6. F A0A0H2ZI72 Probable di/tripeptide-binding protein 5 1.85e-05 NA NA 0.6556
6. F Q1C1Y8 HTH-type transcriptional regulator SgrR 1.77e-02 NA NA 0.4031
6. F Q02VA9 Oligopeptide-binding protein OppA 2.41e-03 NA NA 0.5826
6. F Q2YK66 Putative ABC transporter peptide-binding protein BAB2_0812 1.72e-03 NA NA 0.6346
6. F A0A0H2ZGN2 Di/tripeptide-binding protein 3 4.43e-05 NA NA 0.645
6. F P9WGU6 Probable monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 8.72e-03 NA NA 0.4679
6. F Q8YDG6 Putative peptide-binding periplasmic protein BMEII0210 3.07e-04 NA NA 0.6361
6. F Q9RU24 Probable ABC transporter-binding protein DR_1571 3.36e-04 NA NA 0.5754
6. F P06109 Protein XP55 2.12e-03 NA NA 0.5979
6. F Q57TF2 HTH-type transcriptional regulator SgrR 3.62e-02 NA NA 0.4012
6. F P44572 Putative binding protein HI_0213 1.41e-03 NA NA 0.5589
6. F Q8YBP0 Putative ABC transporter peptide-binding protein BMEII0859 1.39e-03 NA NA 0.6486
6. F Q0TJL8 Glutathione-binding protein GsiB 1.32e-04 NA NA 0.6417
6. F A0A0H3JTL0 Metal-staphylopine-binding protein CntA 4.68e-04 NA NA 0.6216
6. F A0R2I8 Probable monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 1.19e-02 NA NA 0.4733
6. F P33950 Heme-binding protein A 7.44e-05 NA NA 0.6001
6. F Q0T6D2 Glutathione-binding protein GsiB 2.25e-04 NA NA 0.6349
6. F Q0T8C8 HTH-type transcriptional regulator SgrR 4.37e-02 NA NA 0.3868
6. F Q3Z5U2 HTH-type transcriptional regulator SgrR 2.41e-02 NA NA 0.3989
6. F P55669 Probable peptide ABC transporter periplasmic-binding protein y4tO 4.06e-04 NA NA 0.5949
6. F Q32IB6 Glutathione-binding protein GsiB 1.34e-04 NA NA 0.6495
6. F Q1CMQ0 HTH-type transcriptional regulator SgrR 3.53e-02 NA NA 0.3912
6. F P36634 Peptide transport periplasmic protein SapA 4.90e-05 NA NA 0.6367
6. F A5VU91 Putative ABC transporter peptide-binding protein BOV_A0352 1.94e-03 NA NA 0.6031
6. F A1JJG7 HTH-type transcriptional regulator SgrR 3.16e-02 NA NA 0.408
6. F O07570 Uncharacterized protein YhjP 1.22e-03 NA NA 0.5019
6. F Q8FWN7 Putative ABC transporter peptide-binding protein BRA0409/BS1330_II0406 2.42e-03 NA NA 0.6366
6. F Q8Z9I4 HTH-type transcriptional regulator SgrR 2.40e-02 NA NA 0.3806
6. F P42061 Oligopeptide-binding protein AppA 6.51e-04 NA NA 0.626
6. F Q49646 Uncharacterized lipoprotein ML0489 1.87e-02 NA NA 0.5279
6. F Q5PDG5 HTH-type transcriptional regulator SgrR 4.75e-02 NA NA 0.3955
6. F Q83SP3 HTH-type transcriptional regulator SgrR 2.59e-02 NA NA 0.3828
6. F A1A968 Glutathione-binding protein GsiB 1.31e-04 NA NA 0.6397
6. F Q8VQK3 Putative peptide-binding periplasmic protein BruAb2_1030 2.81e-04 NA NA 0.6546
6. F Q821B3 Glutathione-binding protein GsiB 1.30e-04 NA NA 0.6317
6. F P66772 Uncharacterized protein Mb1311c 2.14e-03 NA NA 0.5374
6. F Q3Z3V3 Glutathione-binding protein GsiB 1.32e-04 NA NA 0.6586
6. F Q8FUX2 Putative peptide-binding periplasmic protein BRA1090/BS1330_II1082 2.78e-04 NA NA 0.644
6. F A0A0H2ZGV7 Di/tripeptide-binding protein 4 6.62e-07 NA NA 0.6356
6. F Q32K24 HTH-type transcriptional regulator SgrR 2.44e-02 NA NA 0.4
7. B P77348 Periplasmic murein peptide-binding protein 9.02e-06 NA 0.004 NA
7. B P23843 Periplasmic oligopeptide-binding protein 1.23e-06 NA 0.006 NA