Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54653.1
JCVISYN3A_0195
Spermidine/putrescine ABC transporter permease.
M. mycoides homolog: Q6MU17.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 56
Unique PROST Go: 0
Unique BLAST Go: 28
Unique Foldseek Go: 4
Total Homologs: 261
Unique PROST Homologs: 0
Unique BLAST Homologs: 34
Unique Foldseek Homologs: 155
Literature
Danchin and Fang [1]: spermidine /putrescine transporter permease and binding domains|polyamine transporter permease and binding domain; highly conserved essential residues in the PotC domain for spermidine uptake, PotD domain and an internal domain ending with a transmembrane helix;
Yang and Tsui [2]: Spermidine/putrescine transport system permease protein PotCD
Antczak et al. [3]: potCD; Spermidine/putrescine ABC transporter, permease and binding domains
Zhang et al. [4]: GO:0022891|substrate-specific transmembrane transporter activity
Bianchi et al. [5]: "Spermidine/Putrescine transport, permease"
Structures and Sequence Alignment
The best structural homolog that predicted by 3. BF was
P0AFS0
(Inner membrane ABC transporter permease protein YdcV) with a FATCAT P-Value: 1.91e-11 and RMSD of 2.73 angstrom. The sequence alignment identity is 7.3%.
Structural alignment shown in left. Query protein AVX54653.1 colored as red in alignment, homolog P0AFS0 colored as blue.
Query protein AVX54653.1 is also shown in right top, homolog P0AFS0 showed in right bottom. They are colored based on secondary structures.
AVX54653.1 MKKLLKRSYFAFV-------LLFIYAPILAMVVFSFNNGDTTIKWTH--ASFSWYESFFKNSPFIKSIITSLFVAVISTIVSLVIGTLAAIGLSRVSRVT 91 P0AFS0 MHS--ERAPF-FLKLAAWGGVVFLHFPILIIAAYAFNTEDAAFSFPPQGLTLRWFSVAAQRSDILDAVTLSLKVAALATLIALVLGTLAAAALWRRDFFG 97 AVX54653.1 RNKWVS-VANIPLINADVITAVSLMIVFLIMGLKFGLLTLIMAHISFNVPYVLV--TIMPRLKKIDPSLIDASYDLGAKNHQVMFK-VILPILKPAIITA 187 P0AFS0 KNA-ISLLLLLPIALPGIVTGLALLTAFKTINLEPGFFTIVVGHATFCV--VVVFNNVIARFRRTSWSLVEASMDLGANGWQT-FRYVVLPNLSSALLAG 193 AVX54653.1 AAIAFAMSFDDFIISYFTGGMQTNVSTFIYT-AKKTR--PFIFVFGTCLVLVIALSII-TWNAINLIKQSRLETKQKLINNNYKLKTISKLNKQLDELNQ 283 P0AFS0 GMLAFALSFDEIIVTTFTAGHERTLPLWLLNQLGRPRDVPVTNVVALLVMLVTTLPILGAW---WLTREG--DNGQ------------------------ 264 AVX54653.1 ILKTKTIIKKSHNLSLWIKYFILKTKLYFYKLKSLDKKISKLQWKQYKLKSKIQKEERYYSRLKKSEKKLKQLIKQFSSEKDVKKAAKLSLQIETLQEKV 383 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 EFLKDQIEVIKEREQTANLKVKKLQNKIKLLKQDLSEEVNPSKKTINWYNKKIKYFEEWIIELEEGKDYYKLKLVVEKLKDLKNIKNNKISDLTDQLNEL 483 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 INRIYVPVLITKDIDLKIQNTTDIESLNNLNHKREVIIDKFTKLYNRKIDKTTLLIQKVNQKTDKLKTRLLPSSNENASHFKSFISRSWKAILITFIGIG 583 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 AFSGLTAAYVLNNIYDLVVANWGEYIDPSLIGEFEQQASQKHNRRIRINYQIYNSNEILYNKLHTVDYDIMIPSDYMVQRLASENYLQKIDYSKLNIWGE 683 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 FNEKNFNKDIKSKDFEKLQVNKSLLELMAKSPIHLEDETKEVITKNPNGTYLSTNSILDYSIPYLWGDLVIVVNPTQENIKFLEDNQIKFKNQKDDENNN 783 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 ENKVEIDNSSLSWDILWKAAAAGKKVALNNDPKNVFMLGSQKLYQKVNLTKKSEIDEVGKELSQLLSNSGVSLHSDDLISLVVREKFDFAVMYNGDAAYA 883 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 NYVHNEGDDDYEKAGNSINFIYGRPNKKNKKNNRHESTNVFSDNIVLYKDAQNLDLAYEFINFLYENSTKISDYVGVTSPLDSAIEEMTAAPKEGNKEDE 983 P0AFS0 ---------------------------------------------------------------------------------------------------- 264 AVX54653.1 GGTYQDFKNIYDPITHQNNGSKYETNNEQLSFTYNGKIDEYLVNSFNNLLANK 1036 P0AFS0 ----------------------------------------------------- 264
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 3. BF | GO:0015419 | ABC-type sulfate transporter activity |
| 3. BF | GO:0031969 | chloroplast membrane |
| 3. BF | GO:0055052 | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
| 3. BF | GO:0005315 | inorganic phosphate transmembrane transporter activity |
| 3. BF | GO:0031460 | glycine betaine transport |
| 3. BF | GO:0055085 | transmembrane transport |
| 3. BF | GO:0005887 | integral component of plasma membrane |
| 3. BF | GO:0016021 | integral component of membrane |
| 3. BF | GO:0048473 | D-methionine transport |
| 3. BF | GO:0033223 | 2-aminoethylphosphonate transport |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:1990060 | maltose transport complex |
| 3. BF | GO:0015098 | molybdate ion transmembrane transporter activity |
| 3. BF | GO:0008643 | carbohydrate transport |
| 3. BF | GO:0006865 | amino acid transport |
| 3. BF | GO:0042170 | plastid membrane |
| 3. BF | GO:0035435 | phosphate ion transmembrane transport |
| 3. BF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 3. BF | GO:0015423 | ABC-type maltose transporter activity |
| 3. BF | GO:0015774 | polysaccharide transport |
| 3. BF | GO:0006811 | ion transport |
| 3. BF | GO:0042956 | maltodextrin transport |
| 3. BF | GO:0015768 | maltose transport |
| 3. BF | GO:0055072 | iron ion homeostasis |
| 6. F | GO:0022857 | transmembrane transporter activity |
| 6. F | GO:0006817 | phosphate ion transport |
| 6. F | GO:0015794 | glycerol-3-phosphate transmembrane transport |
| 6. F | GO:0001407 | glycerophosphodiester transmembrane transport |
| 7. B | GO:0009888 | tissue development |
| 7. B | GO:0040017 | positive regulation of locomotion |
| 7. B | GO:0007414 | axonal defasciculation |
| 7. B | GO:0019809 | spermidine binding |
| 7. B | GO:1902603 | carnitine transmembrane transport |
| 7. B | GO:0009290 | DNA import into cell involved in transformation |
| 7. B | GO:0015871 | choline transport |
| 7. B | GO:0000003 | reproduction |
| 7. B | GO:0015879 | carnitine transport |
| 7. B | GO:0015191 | L-methionine transmembrane transporter activity |
| 7. B | GO:0015847 | putrescine transport |
| 7. B | GO:0010950 | positive regulation of endopeptidase activity |
| 7. B | GO:0042597 | periplasmic space |
| 7. B | GO:0030288 | outer membrane-bounded periplasmic space |
| 7. B | GO:0015199 | amino-acid betaine transmembrane transporter activity |
| 7. B | GO:0051701 | biological process involved in interaction with host |
| 7. B | GO:0015226 | carnitine transmembrane transporter activity |
| 7. B | GO:0005275 | amine transmembrane transporter activity |
| 7. B | GO:0051788 | response to misfolded protein |
| 7. B | GO:0008272 | sulfate transport |
| 7. B | GO:0071711 | basement membrane organization |
| 7. B | GO:0005737 | cytoplasm |
| 7. B | GO:0030420 | establishment of competence for transformation |
| 7. B | GO:0015846 | polyamine transport |
| 7. B | GO:0015848 | spermidine transport |
| 7. B | GO:1903711 | spermidine transmembrane transport |
| 7. B | GO:0019810 | putrescine binding |
| 7. B | GO:0019808 | polyamine binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0055085 | transmembrane transport |
| GO:0016021 | integral component of membrane |
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
| GO:0015846 | polyamine transport |
| GO:0042597 | periplasmic space |
| GO:0019808 | polyamine binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 3. BF | P0A2J8 | Spermidine/putrescine transport system permease protein PotB | 7.08e-08 | NA | 4.04e-07 | 0.7388 |
| 3. BF | O57893 | Molybdate/tungstate transport system permease protein WtpB | 1.90e-09 | NA | 1.04e-05 | 0.7843 |
| 3. BF | Q57341 | Putative ferric transport system permease protein FbpB 1 | 1.40e-05 | NA | 6.97e-06 | 0.7508 |
| 3. BF | P0AFL2 | Putrescine transport system permease protein PotI | 5.31e-11 | NA | 1.33e-29 | 0.8623 |
| 3. BF | P0CL49 | Spermidine/putrescine transport system permease protein PotB | 6.15e-08 | NA | 4.04e-07 | 0.74 |
| 3. BF | Q8ZRN0 | D-methionine transport system permease protein MetI | 8.61e-05 | NA | 0.044 | 0.5812 |
| 3. BF | P96064 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 9.82e-10 | NA | 8.55e-05 | 0.6888 |
| 3. BF | Q7A937 | Maltose/maltodextrin transport system permease protein MalF | 8.67e-02 | NA | 0.027 | 0.6413 |
| 3. BF | Q9V2C1 | Molybdate/tungstate transport system permease protein WtpB | 1.78e-09 | NA | 2.63e-05 | 0.8013 |
| 3. BF | O58967 | Probable ABC transporter permease protein PH1216 | 1.61e-06 | NA | 1.71e-05 | 0.6814 |
| 3. BF | Q9K490 | Diacetylchitobiose uptake system permease protein DasB | 2.82e-09 | NA | 0.026 | 0.7143 |
| 3. BF | P45169 | Spermidine/putrescine transport system permease protein PotC | 2.97e-11 | NA | 2.68e-35 | 0.8473 |
| 3. BF | O06991 | Maltodextrin transport system permease protein MdxG | 3.71e-09 | NA | 7.49e-04 | 0.7884 |
| 3. BF | D4GQ17 | Probable molybdenum ABC transporter permease protein HVO_B0370 | 8.07e-09 | NA | 4.22e-05 | 0.7853 |
| 3. BF | O30143 | Molybdate/tungstate transport system permease protein WtpB | 6.75e-09 | NA | 3.39e-08 | 0.7526 |
| 3. BF | Q8Z8W9 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 8.82e-10 | NA | 6.48e-05 | 0.6886 |
| 3. BF | O34518 | Melibiose/raffinose/stachyose import permease protein MelC | 3.01e-09 | NA | 0.007 | 0.6781 |
| 3. BF | Q2EEX6 | Probable sulfate transport system permease protein cysT | 4.28e-09 | NA | 3.61e-05 | 0.6968 |
| 3. BF | Q7LYX6 | Trehalose/maltose transport system permease protein MalG | 7.39e-07 | NA | 0.002 | 0.7301 |
| 3. BF | P0AFK7 | Spermidine/putrescine transport system permease protein PotC | 3.69e-11 | NA | 7.03e-31 | 0.8936 |
| 3. BF | O32154 | Probable ABC transporter permease protein YurM | 6.79e-09 | NA | 2.51e-10 | 0.7831 |
| 3. BF | P75057 | Spermidine/putrescine transport system permease protein PotC homolog | 1.57e-10 | NA | 2.17e-29 | 0.7731 |
| 3. BF | O31520 | Probable ABC transporter permease protein YesQ | 3.69e-06 | NA | 0.003 | 0.6962 |
| 3. BF | Q8FB38 | Maltose/maltodextrin transport system permease protein MalF | 5.54e-02 | NA | 0.028 | 0.63 |
| 3. BF | Q8U4K4 | Molybdate/tungstate transport system permease protein WtpB | 1.60e-09 | NA | 3.58e-04 | 0.7881 |
| 3. BF | D4GP37 | Xylose/arabinose import permease protein XacI | 6.19e-06 | NA | 0.002 | 0.6631 |
| 3. BF | Q83P81 | Maltose/maltodextrin transport system permease protein MalF | 5.74e-02 | NA | 0.046 | 0.6305 |
| 3. BF | P55603 | Probable ABC transporter permease protein y4oR | 1.48e-06 | NA | 1.66e-06 | 0.7772 |
| 3. BF | P46340 | Probable ABC transporter permease protein YqgI | 3.31e-07 | NA | 0.003 | 0.6314 |
| 3. BF | P0A625 | Molybdenum transport system permease protein ModB | 2.67e-08 | NA | 4.40e-04 | 0.7242 |
| 3. BF | P45170 | Spermidine/putrescine transport system permease protein PotB | 9.50e-10 | NA | 1.30e-08 | 0.7399 |
| 3. BF | P74547 | Sulfate transport system permease protein CysW | 5.34e-10 | NA | 6.88e-07 | 0.7249 |
| 3. BF | Q5JEB3 | Molybdate/tungstate transport system permease protein WtpB | 1.68e-09 | NA | 0.004 | 0.8127 |
| 3. BF | Q83RR7 | Spermidine/putrescine transport system permease protein PotC | 5.34e-11 | NA | 4.98e-31 | 0.8966 |
| 3. BF | P37731 | Molybdenum transport system permease protein ModB | 1.62e-07 | NA | 5.68e-08 | 0.684 |
| 3. BF | O07011 | Galactooligosaccharides transport system permease protein GanQ | 3.58e-09 | NA | 3.48e-04 | 0.7743 |
| 3. BF | Q01895 | Sulfate transport system permease protein CysT | 1.01e-08 | NA | 3.38e-04 | 0.6946 |
| 3. BF | Q9TKU8 | Probable sulfate transport system permease protein cysT | 5.30e-09 | NA | 1.59e-06 | 0.727 |
| 3. BF | P26246 | Probable sulfate transport system permease protein cysT | 4.05e-09 | NA | 3.33e-06 | 0.7067 |
| 3. BF | Q57SD7 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 9.38e-10 | NA | 8.55e-05 | 0.6892 |
| 3. BF | P45322 | Molybdenum transport system permease protein ModB | 1.62e-06 | NA | 2.69e-06 | 0.6773 |
| 3. BF | O32209 | Putative molybdenum transport system permease protein YvgM | 3.75e-07 | NA | 2.90e-04 | 0.7077 |
| 3. BF | P29824 | Lactose transport system permease protein LacG | 2.33e-06 | NA | 1.69e-04 | 0.7336 |
| 3. BF | Q97UY9 | Glucose import system permease protein GlcU | 1.45e-06 | NA | 3.31e-04 | 0.7289 |
| 3. BF | P0AF02 | Molybdenum transport system permease protein ModB | 3.12e-07 | NA | 0.013 | 0.7584 |
| 3. BF | Q9CNJ5 | Phosphate transport system permease protein PstC | 1.50e-06 | NA | 0.007 | 0.6003 |
| 3. BF | Q6QJE2 | Sulfate permease 2, chloroplastic | 1.35e-08 | NA | 4.35e-05 | 0.747 |
| 3. BF | P0AFS0 | Inner membrane ABC transporter permease protein YdcV | 1.91e-11 | NA | 3.31e-25 | 0.869 |
| 3. BF | Q9TJR4 | Probable sulfate transport system permease protein cysT | 1.03e-08 | NA | 4.05e-07 | 0.7558 |
| 3. BF | Q9K489 | Diacetylchitobiose uptake system permease protein DasC | 5.88e-07 | NA | 0.002 | 0.7768 |
| 3. BF | E1WF94 | Spermidine/putrescine transport system permease protein PotB | 7.92e-08 | NA | 4.04e-07 | 0.7379 |
| 3. BF | P9WG00 | Trehalose transport system permease protein SugB | 5.92e-07 | NA | 3.03e-10 | 0.7786 |
| 3. BF | P27370 | Sulfate transport system permease protein CysW | 1.00e-08 | NA | 2.11e-05 | 0.7393 |
| 3. BF | P53561 | Polygalacturonan/rhamnogalacturonan transport system permease protein YtcP | 1.01e-06 | NA | 6.87e-06 | 0.6425 |
| 3. BF | P41032 | Sulfate transport system permease protein CysT | 4.87e-09 | NA | 5.81e-10 | 0.6815 |
| 3. BF | Q44123 | Ferric transport system permease protein FbpB | 1.31e-05 | NA | 0.002 | 0.7555 |
| 3. BF | P56343 | Probable sulfate transport system permease protein cysT | 3.67e-09 | NA | 4.40e-07 | 0.7722 |
| 3. BF | Q53683 | Putative ABC transporter permease protein ORF1 (Fragment) | 6.92e-06 | NA | 7.29e-06 | 0.7424 |
| 3. BF | Q08382 | Molybdenum transport system permease protein ModB | 1.54e-07 | NA | 5.47e-05 | 0.7145 |
| 3. BF | A2CI71 | Probable sulfate transport system permease protein cysT | 1.10e-08 | NA | 1.35e-08 | 0.723 |
| 3. BF | P47290 | Spermidine/putrescine transport system permease protein PotC homolog | 2.56e-10 | NA | 5.04e-32 | 0.8014 |
| 3. BF | P0AFK8 | Spermidine/putrescine transport system permease protein PotC | 2.91e-11 | NA | 7.03e-31 | 0.8954 |
| 3. BF | O58760 | Probable ABC transporter permease protein PH1036 | 5.79e-09 | NA | 9.80e-07 | 0.7415 |
| 3. BF | P0AEB1 | Sulfate transport system permease protein CysW | 4.10e-09 | NA | 0.027 | 0.6993 |
| 3. BF | Q55473 | Osmoprotective compounds uptake permease protein GgtD | 3.97e-07 | NA | 1.13e-06 | 0.7582 |
| 3. BF | P0AFK5 | Spermidine/putrescine transport system permease protein PotB | 1.19e-07 | NA | 1.25e-07 | 0.7363 |
| 3. BF | Q8Z991 | D-methionine transport system permease protein MetI | 8.47e-05 | NA | 0.045 | 0.5805 |
| 3. BF | P9WG12 | Molybdenum transport system permease protein ModB | 2.43e-08 | NA | 4.40e-04 | 0.7291 |
| 3. BF | Q9MUL9 | Probable sulfate transport system permease protein cysT | 7.06e-09 | NA | 2.38e-04 | 0.7336 |
| 3. BF | Q32RF7 | Probable sulfate transport system permease protein cysT | 2.85e-09 | NA | 1.60e-04 | 0.7401 |
| 3. BF | Q5PFQ6 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 9.39e-10 | NA | 8.70e-05 | 0.7016 |
| 3. BF | O50501 | Diacetylchitobiose uptake system permease protein NgcG | 8.92e-09 | NA | 4.92e-05 | 0.6881 |
| 6. F | Q8ZLF2 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.44e-09 | NA | NA | 0.6998 |
| 6. F | Q8FW08 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.19e-06 | NA | NA | 0.6478 |
| 6. F | P40980 | Putative ABC transporter permease protein ORF2 | 1.80e-06 | NA | NA | 0.7315 |
| 6. F | P29823 | Lactose transport system permease protein LacF | 3.88e-09 | NA | NA | 0.6647 |
| 6. F | Q2YKR7 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.95e-06 | NA | NA | 0.6462 |
| 6. F | Q98FL4 | Phosphate transport system permease protein PstA | 2.52e-06 | NA | NA | 0.6304 |
| 6. F | P68184 | Maltose/maltodextrin transport system permease protein MalG | 9.20e-09 | NA | NA | 0.7177 |
| 6. F | P37729 | Probable starch degradation products transport system permease protein AmyC | 1.19e-06 | NA | NA | 0.7156 |
| 6. F | Q8X800 | D-methionine transport system permease protein MetI | 8.42e-05 | NA | NA | 0.6502 |
| 6. F | O34878 | Glycine betaine/carnitine/choline transport system permease protein OpuCB | 4.97e-05 | NA | NA | 0.6236 |
| 6. F | Q74RF9 | Maltose/maltodextrin transport system permease protein MalF | 6.42e-02 | NA | NA | 0.6461 |
| 6. F | P0A631 | Phosphate transport system permease protein PstC 2 | 1.51e-04 | NA | NA | 0.5075 |
| 6. F | P94529 | Arabinooligosaccharides transport system permease protein AraP | 3.00e-08 | NA | NA | 0.7014 |
| 6. F | Q8RVC7 | Sulfate permease 1, chloroplastic | 2.18e-08 | NA | NA | 0.7143 |
| 6. F | Q7AA80 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.01e-09 | NA | NA | 0.7082 |
| 6. F | A1AGY2 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.60e-06 | NA | NA | 0.6657 |
| 6. F | P18795 | Probable transport system permease protein NifC | 2.96e-09 | NA | NA | 0.6967 |
| 6. F | P45191 | Phosphate transport system permease protein PstC | 2.05e-06 | NA | NA | 0.6051 |
| 6. F | P9WG02 | Trehalose transport system permease protein SugA | 1.06e-08 | NA | NA | 0.6532 |
| 6. F | P9WG06 | Phosphate transport system permease protein PstC 1 | 5.06e-08 | NA | NA | 0.5402 |
| 6. F | Q45461 | Choline transport system permease protein OpuBB | 4.81e-05 | NA | NA | 0.5969 |
| 6. F | Q9K9G6 | Formylaminopyrimidine transport permease protein ThiX | 2.16e-04 | NA | NA | 0.5329 |
| 6. F | D4GSY8 | Probable anion ABC transporter permease protein HVO_1887 | 6.16e-07 | NA | NA | 0.7615 |
| 6. F | P26467 | Maltose/maltodextrin transport system permease protein MalF | 1.50e-01 | NA | NA | 0.6409 |
| 6. F | Q8Z246 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.13e-06 | NA | NA | 0.6589 |
| 6. F | O32261 | Galactooligosaccharides transport system permease protein GanP | 1.41e-02 | NA | NA | 0.6514 |
| 6. F | P47651 | Phosphate transport system permease protein PstA homolog | 6.16e-06 | NA | NA | 0.5753 |
| 6. F | P9WG04 | Phosphate transport system permease protein PstC 2 | 1.67e-04 | NA | NA | 0.4876 |
| 6. F | Q83PU6 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.24e-09 | NA | NA | 0.7038 |
| 6. F | P39775 | Choline transport system permease protein OpuBD | 7.59e-04 | NA | NA | 0.6073 |
| 6. F | P96065 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 7.44e-10 | NA | NA | 0.8331 |
| 6. F | Q8Z8X0 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 7.79e-10 | NA | NA | 0.8086 |
| 6. F | Q8ZPK1 | Osmoprotectant import permease protein OsmY | 7.28e-05 | NA | NA | 0.656 |
| 6. F | Q32AT5 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.53e-06 | NA | NA | 0.6461 |
| 6. F | Q8D3U8 | Maltose/maltodextrin transport system permease protein MalF | 4.33e-02 | NA | NA | 0.6286 |
| 6. F | A1AGY3 | sn-glycerol-3-phosphate transport system permease protein UgpA | 3.16e-09 | NA | NA | 0.7047 |
| 6. F | Q8ZH39 | D-methionine transport system permease protein MetI | 8.60e-05 | NA | NA | 0.6071 |
| 6. F | P18812 | Maltose/maltodextrin transport system permease protein MalF | 1.46e-01 | NA | NA | 0.6504 |
| 6. F | Q0TC09 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.97e-06 | NA | NA | 0.646 |
| 6. F | P71338 | Fe(3+)-transport system permease protein FbpB 2 | 3.50e-06 | NA | NA | 0.7044 |
| 6. F | Q8Z1U2 | Maltose/maltodextrin transport system permease protein MalF | 7.82e-02 | NA | NA | 0.655 |
| 6. F | Q8X4P0 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.87e-06 | NA | NA | 0.6698 |
| 6. F | P0A4N4 | Maltodextrin transport system permease protein MalD | 8.31e-09 | NA | NA | 0.7777 |
| 6. F | Q97UZ0 | Glucose import system permease protein GlcT | 1.21e-09 | NA | NA | 0.7182 |
| 6. F | P45190 | Phosphate transport system permease protein PstA | 5.58e-06 | NA | NA | 0.6406 |
| 6. F | O06990 | Maltodextrin transport system permease protein MdxF | 3.32e-02 | NA | NA | 0.6406 |
| 6. F | Q8FW09 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.05e-09 | NA | NA | 0.7468 |
| 6. F | P58655 | Phosphate transport system permease protein PstA | 5.38e-06 | NA | NA | 0.6523 |
| 6. F | O31519 | Probable ABC transporter permease protein YesP | 1.10e-08 | NA | NA | 0.671 |
| 6. F | Q66FU6 | sn-glycerol-3-phosphate transport system permease protein UgpA | 2.33e-09 | NA | NA | 0.7039 |
| 6. F | Q92WD7 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.07e-06 | NA | NA | 0.6422 |
| 6. F | Q87GB7 | Maltose/maltodextrin transport system permease protein MalF | 8.28e-02 | NA | NA | 0.6531 |
| 6. F | Q92WD8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 7.11e-09 | NA | NA | 0.7359 |
| 6. F | Q7N983 | Maltose/maltodextrin transport system permease protein MalG | 1.15e-05 | NA | NA | 0.7036 |
| 6. F | Q6CZ33 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.24e-06 | NA | NA | 0.6638 |
| 6. F | Q50097 | Phosphate transport system permease protein PstA | 2.68e-06 | NA | NA | 0.587 |
| 6. F | Q9CNJ6 | Phosphate transport system permease protein PstA | 3.52e-06 | NA | NA | 0.6594 |
| 6. F | O32155 | Probable ABC transporter permease protein YurN | 3.64e-09 | NA | NA | 0.7534 |
| 6. F | Q9PBK2 | Phosphate transport system permease protein PstC | 4.82e-06 | NA | NA | 0.5854 |
| 6. F | P46339 | Probable ABC transporter permease protein YqgH | 7.91e-06 | NA | NA | 0.5713 |
| 6. F | Q6CZ32 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.05e-09 | NA | NA | 0.6731 |
| 6. F | P18814 | Maltose/maltodextrin transport system permease protein MalG | 1.03e-05 | NA | NA | 0.6914 |
| 6. F | Q66FU5 | sn-glycerol-3-phosphate transport system permease protein UgpE | 8.29e-06 | NA | NA | 0.6377 |
| 6. F | Q00751 | Multiple sugar-binding transport system permease protein MsmG | 7.13e-07 | NA | NA | 0.7146 |
| 6. F | P0A4N1 | Maltodextrin transport system permease protein MalC | 1.13e-02 | NA | NA | 0.6531 |
| 6. F | Q1CNC7 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.55e-06 | NA | NA | 0.6497 |
| 6. F | Q578E7 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.13e-09 | NA | NA | 0.7324 |
| 6. F | Q7MFC2 | Maltose/maltodextrin transport system permease protein MalF | 1.14e-01 | NA | NA | 0.6322 |
| 6. F | D4GP36 | Xylose/arabinose import permease protein XacH | 4.10e-09 | NA | NA | 0.7256 |
| 6. F | P9WG08 | Phosphate transport system permease protein PstA 2 | 1.59e-06 | NA | NA | 0.5955 |
| 6. F | G2JZ41 | Carnitine transport permease protein OpuCD | 6.31e-04 | NA | NA | 0.5751 |
| 6. F | P75263 | Probable ABC transporter permease protein MG188 homolog | 2.37e-08 | NA | NA | 0.6895 |
| 6. F | Q5PJL0 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.81e-06 | NA | NA | 0.637 |
| 6. F | Q8YCB0 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.63e-06 | NA | NA | 0.6465 |
| 6. F | P9WG10 | Phosphate transport system permease protein PstA 1 | 3.36e-06 | NA | NA | 0.6244 |
| 6. F | Q1R5H6 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.34e-09 | NA | NA | 0.7027 |
| 6. F | O50500 | Diacetylchitobiose uptake system permease protein NgcF | 8.39e-07 | NA | NA | 0.6854 |
| 6. F | Q5PFQ5 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 8.35e-10 | NA | NA | 0.8293 |
| 6. F | Q98FL3 | Phosphate transport system permease protein PstC | 2.76e-08 | NA | NA | 0.5724 |
| 6. F | Q9KHT6 | Carnitine transport permease protein OpuCD | 6.35e-04 | NA | NA | 0.5752 |
| 6. F | P68185 | Maltose/maltodextrin transport system permease protein MalG | 9.39e-09 | NA | NA | 0.7114 |
| 6. F | P27367 | Sulfate transport system permease protein CysT | 7.82e-09 | NA | NA | 0.7092 |
| 6. F | Q8UB30 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.71e-06 | NA | NA | 0.6489 |
| 6. F | Q9KL06 | Maltose/maltodextrin transport system permease protein MalF | 7.61e-02 | NA | NA | 0.6237 |
| 6. F | Q0P886 | Tungstate uptake system permease protein TupB | 3.65e-05 | NA | NA | 0.694 |
| 6. F | Q2YL00 | Probable ABC transporter permease protein BAB2_0490 | 6.19e-10 | NA | NA | 0.7086 |
| 6. F | Q0SZM0 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.55e-09 | NA | NA | 0.7041 |
| 6. F | Q93KD5 | Tungstate uptake system permease protein TupB | 2.90e-04 | NA | NA | 0.6489 |
| 6. F | P0A4N3 | Maltodextrin transport system permease protein MalD | 8.06e-09 | NA | NA | 0.791 |
| 6. F | P0AGI0 | Phosphate transport system permease protein PstC | 3.92e-07 | NA | NA | 0.6052 |
| 6. F | Q8D3U7 | Maltose/maltodextrin transport system permease protein MalG | 1.05e-05 | NA | NA | 0.7024 |
| 6. F | Q7CKV5 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.70e-06 | NA | NA | 0.6519 |
| 6. F | P94530 | Arabinooligosaccharides transport system permease protein AraQ | 1.89e-06 | NA | NA | 0.6688 |
| 6. F | A1JID9 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.89e-06 | NA | NA | 0.6358 |
| 6. F | Q50098 | Phosphate transport system permease protein PstC | 1.55e-04 | NA | NA | 0.5134 |
| 6. F | Q87C89 | Phosphate transport system permease protein PstA | 1.59e-06 | NA | NA | 0.6185 |
| 6. F | O34649 | Uncharacterized ABC transporter permease protein YtlD | 1.69e-04 | NA | NA | 0.546 |
| 6. F | P75262 | Probable ABC transporter permease protein MG189 homolog | 4.27e-06 | NA | NA | 0.6366 |
| 6. F | Q8Z1U3 | Maltose/maltodextrin transport system permease protein MalG | 9.90e-06 | NA | NA | 0.6734 |
| 6. F | A1JID8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 3.37e-09 | NA | NA | 0.6718 |
| 6. F | P47289 | Spermidine/putrescine transport system permease protein PotB homolog | 3.87e-10 | NA | NA | 0.7553 |
| 6. F | Q8ZLF3 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.93e-06 | NA | NA | 0.6481 |
| 6. F | Q578M9 | Probable ABC transporter permease protein BruAb2_0483 | 6.37e-10 | NA | NA | 0.7029 |
| 6. F | Q9KL07 | Maltose/maltodextrin transport system permease protein MalG | 1.06e-05 | NA | NA | 0.7105 |
| 6. F | Q9Z3R7 | Alpha-glucoside transport system permease protein AglG | 9.05e-06 | NA | NA | 0.7296 |
| 6. F | Q74RF8 | Maltose/maltodextrin transport system permease protein MalG | 1.27e-05 | NA | NA | 0.7052 |
| 6. F | Q7CRU3 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.57e-09 | NA | NA | 0.7389 |
| 6. F | O34706 | Melibiose/raffinose/stachyose import permease protein MelD | 9.69e-09 | NA | NA | 0.716 |
| 6. F | Q8FCQ1 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.79e-06 | NA | NA | 0.6486 |
| 6. F | Q85AI0 | Probable sulfate transport system permease protein cysT | 2.96e-09 | NA | NA | 0.7378 |
| 6. F | P37730 | Probable starch degradation products transport system permease protein AmyD | 3.73e-09 | NA | NA | 0.6803 |
| 6. F | Q0SZM1 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.89e-06 | NA | NA | 0.6343 |
| 6. F | Q57IS1 | sn-glycerol-3-phosphate transport system permease protein UgpA | 3.48e-09 | NA | NA | 0.712 |
| 6. F | Q00750 | Multiple sugar-binding transport system permease protein MsmF | 3.01e-09 | NA | NA | 0.6701 |
| 6. F | Q5PJK9 | sn-glycerol-3-phosphate transport system permease protein UgpA | 6.08e-09 | NA | NA | 0.7072 |
| 6. F | P55452 | Probable ABC transporter permease protein y4fN | 7.11e-06 | NA | NA | 0.7146 |
| 6. F | P0AGH9 | Phosphate transport system permease protein PstC | 4.63e-07 | NA | NA | 0.608 |
| 6. F | Q2YKR6 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.06e-09 | NA | NA | 0.7463 |
| 6. F | Q8FVS6 | Probable ABC transporter permease protein BRA0749/BS1330_II0742 | 6.17e-10 | NA | NA | 0.6849 |
| 6. F | Q2YJB4 | Probable ABC transporter permease protein BAB2_1148 | 2.23e-04 | NA | NA | 0.5249 |
| 6. F | P68186 | Maltose/maltodextrin transport system permease protein MalG | 9.92e-09 | NA | NA | 0.69 |
| 6. F | P0A627 | Phosphate transport system permease protein PstA 2 | 2.33e-06 | NA | NA | 0.5941 |
| 6. F | P75058 | Spermidine/putrescine transport system permease protein PotB homolog | 8.82e-08 | NA | NA | 0.7535 |
| 6. F | Q1CBH3 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.54e-06 | NA | NA | 0.6329 |
| 6. F | P0A4N2 | Maltodextrin transport system permease protein MalC | 9.13e-02 | NA | NA | 0.644 |
| 6. F | P26468 | Maltose/maltodextrin transport system permease protein MalG | 9.93e-06 | NA | NA | 0.7038 |
| 6. F | Q0TC08 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.14e-09 | NA | NA | 0.7084 |
| 6. F | O51924 | Trehalose/maltose transport system permease protein MalF | 6.81e-09 | NA | NA | 0.7081 |
| 6. F | Q1CBH4 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.07e-09 | NA | NA | 0.7045 |
| 6. F | Q9Z3R6 | Alpha-glucoside transport system permease protein AglF | 7.24e-09 | NA | NA | 0.6759 |
| 6. F | Q7MFC1 | Maltose/maltodextrin transport system permease protein MalG | 1.02e-05 | NA | NA | 0.703 |
| 6. F | Q7CKV6 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.32e-09 | NA | NA | 0.7214 |
| 6. F | O34742 | Glycine betaine/carnitine/choline transport system permease protein OpuCD | 8.66e-04 | NA | NA | 0.5932 |
| 6. F | Q9PBK1 | Phosphate transport system permease protein PstA | 1.24e-06 | NA | NA | 0.6207 |
| 6. F | O58968 | Probable ABC transporter permease protein PH1215 | 9.10e-10 | NA | NA | 0.7149 |
| 6. F | Q1R5H7 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.98e-06 | NA | NA | 0.6435 |
| 6. F | P47435 | Probable ABC transporter permease protein MG189 | 1.80e-06 | NA | NA | 0.6803 |
| 6. F | Q57IS2 | sn-glycerol-3-phosphate transport system permease protein UgpE | 6.78e-06 | NA | NA | 0.6501 |
| 6. F | Q83PU7 | sn-glycerol-3-phosphate transport system permease protein UgpE | 5.16e-06 | NA | NA | 0.6746 |
| 6. F | Q1CNC8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 5.76e-09 | NA | NA | 0.7229 |
| 6. F | Q57SD8 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 7.13e-10 | NA | NA | 0.8258 |
| 6. F | Q55472 | Osmoprotective compounds uptake permease protein GgtC | 8.08e-09 | NA | NA | 0.665 |
| 6. F | P0A629 | Phosphate transport system permease protein PstC 1 | 3.12e-06 | NA | NA | 0.537 |
| 6. F | Q7N984 | Maltose/maltodextrin transport system permease protein MalF | 2.65e-02 | NA | NA | 0.6569 |
| 6. F | Q9KEE9 | Arabinooligosaccharides transport system permease protein AraQ | 3.16e-09 | NA | NA | 0.7387 |
| 6. F | O32168 | Methionine import system permease protein MetP | 8.40e-05 | NA | NA | 0.6808 |
| 6. F | Q578E8 | sn-glycerol-3-phosphate transport system permease protein UgpE | 3.34e-06 | NA | NA | 0.6355 |
| 6. F | Q8YCA8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 6.58e-09 | NA | NA | 0.7291 |
| 6. F | Q8FCQ0 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.70e-09 | NA | NA | 0.7019 |
| 6. F | Q9KEF0 | Arabinooligosaccharides transport system permease protein AraP | 3.04e-08 | NA | NA | 0.6331 |
| 6. F | Q32AT4 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.19e-09 | NA | NA | 0.7159 |
| 6. F | Q87GB8 | Maltose/maltodextrin transport system permease protein MalG | 1.04e-05 | NA | NA | 0.6596 |
| 6. F | P55602 | Probable ABC transporter permease protein y4oQ | 6.40e-09 | NA | NA | 0.7228 |
| 6. F | Q87C90 | Phosphate transport system permease protein PstC | 4.56e-06 | NA | NA | 0.5389 |
| 6. F | P39129 | Protein LplC | 1.09e-06 | NA | NA | 0.6921 |
| 7. B | P0AFK9 | Spermidine/putrescine-binding periplasmic protein | 2.83e-10 | NA | 1.25e-19 | NA |
| 7. B | P31133 | Putrescine-binding periplasmic protein PotF | 6.58e-10 | NA | 9.73e-10 | NA |
| 7. B | P9WG01 | Trehalose transport system permease protein SugB | 5.73e-07 | NA | 3.03e-10 | NA |
| 7. B | P0AFR9 | Inner membrane ABC transporter permease protein YdcV | 7.95e-11 | NA | 3.31e-25 | NA |
| 7. B | P0AFK4 | Spermidine/putrescine transport system permease protein PotB | 1.11e-07 | NA | 1.25e-07 | NA |
| 7. B | P0A2C8 | Spermidine/putrescine-binding periplasmic protein | 3.51e-10 | NA | 2.37e-17 | NA |
| 7. B | P31547 | D-methionine transport system permease protein MetI | 8.36e-05 | NA | 0.048 | NA |
| 7. B | P0AEB0 | Sulfate transport system permease protein CysW | 2.68e-08 | NA | 0.027 | NA |
| 7. B | P77156 | Inner membrane ABC transporter permease protein YdcU | 4.62e-09 | NA | 2.77e-07 | NA |
| 7. B | P0AF01 | Molybdenum transport system permease protein ModB | 3.83e-07 | NA | 0.013 | NA |
| 7. B | E0SCY2 | Glycine betaine/choline transport system permease protein OusW | 1.38e-01 | NA | 0.036 | NA |
| 7. B | P47291 | Uncharacterized lipoprotein MG045 | 1.04e-05 | NA | 0.023 | NA |
| 7. B | Q58763 | Molybdate/tungstate transport system permease protein WtpB | 3.32e-09 | NA | 1.70e-04 | NA |
| 7. B | P44731 | Spermidine/putrescine-binding periplasmic protein 2 | 2.82e-11 | NA | 1.20e-12 | NA |
| 7. B | Q9RR45 | Glycine betaine/carnitine transport permease protein GbuB | 3.77e-04 | NA | 0.026 | NA |
| 7. B | P02916 | Maltose/maltodextrin transport system permease protein MalF | 6.74e-02 | NA | 0.027 | NA |
| 7. B | P16701 | Sulfate transport system permease protein CysT | 4.26e-09 | NA | 5.81e-10 | NA |
| 7. B | P46921 | Glycine betaine transport system permease protein OpuAB | 4.57e-04 | NA | 0.002 | NA |
| 7. B | Q21313 | Laminin-like protein epi-1 | NA | NA | 0.047 | NA |
| 7. B | Q9I6J0 | Spermidine-binding periplasmic protein SpuE | 2.88e-10 | NA | 2.60e-08 | NA |
| 7. B | Q9I6J1 | Putrescine-binding periplasmic protein SpuD | 3.33e-10 | NA | 8.15e-12 | NA |
| 7. B | P33359 | Glycine betaine uptake system permease protein YehW | 1.56e-04 | NA | 0.021 | NA |
| 7. B | P9WG13 | Molybdenum transport system permease protein ModB | 2.39e-08 | NA | 4.40e-04 | NA |
| 7. B | P31135 | Putrescine transport system permease protein PotH | 1.98e-10 | NA | 1.19e-08 | NA |
| 7. B | P24139 | Oligopeptide transport system permease protein OppC | 5.36e-04 | NA | 0.040 | NA |
| 7. B | P0AFL0 | Spermidine/putrescine-binding periplasmic protein | 2.80e-10 | NA | 1.25e-19 | NA |
| 7. B | P0AFL1 | Putrescine transport system permease protein PotI | 4.12e-11 | NA | 1.33e-29 | NA |
| 7. B | P75056 | Uncharacterized lipoprotein MG045 homolog | 3.22e-08 | NA | 1.26e-04 | NA |
| 7. B | P0AFK6 | Spermidine/putrescine transport system permease protein PotC | 2.37e-11 | NA | 7.03e-31 | NA |
| 7. B | O34209 | Chaperone protein ClpB 2 | 2.84e-02 | NA | 0.004 | NA |
| 7. B | P21409 | Fe(3+)-transport system permease protein SfuB | 5.07e-05 | NA | 0.007 | NA |
| 7. B | Q02UB7 | Putrescine-binding periplasmic protein SpuD | 3.21e-10 | NA | 8.15e-12 | NA |
| 7. B | P0A2C7 | Spermidine/putrescine-binding periplasmic protein | 3.66e-10 | NA | 2.37e-17 | NA |
| 7. B | P45168 | Spermidine/putrescine-binding periplasmic protein 1 | 7.28e-10 | NA | 6.58e-06 | NA |