Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54654.1
JCVISYN3A_0196

Spermidine/putrescine ABC transporter permease.
M. mycoides homolog: Q6MU18.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 80
Unique PROST Go: 38
Unique BLAST Go: 1
Unique Foldseek Go: 8

Total Homologs: 500
Unique PROST Homologs: 172
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 83

Literature

Danchin and Fang [1]: spermidine /putrescine ABC transporter - permease subunit|permease domain; conserved residues (W100 and L110) for interaction with PotC
Yang and Tsui [2]: Spermidine/putrescine transport system permease protein PotB
Antczak et al. [3]: potB; Spermidine/putrescine ABC transporter, permease subunit
Zhang et al. [4]: GO:0006820|anion transport
Bianchi et al. [5]: "Spermidine/Putrescine transport, permease"

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q83RR7 (Spermidine/putrescine transport system permease protein PotC) with a FATCAT P-Value: 0 and RMSD of 3.10 angstrom. The sequence alignment identity is 22.5%.
Structural alignment shown in left. Query protein AVX54654.1 colored as red in alignment, homolog Q83RR7 colored as blue. Query protein AVX54654.1 is also shown in right top, homolog Q83RR7 showed in right bottom. They are colored based on secondary structures.

  AVX54654.1 METKNLKDNNVIENKIINQDELEHVIETIEKQKKRESARLKVKDINHYLSKTKLFHFTKDKVWPIL-APFILVMVILVILPLVSILIYAFIQPADGITLF 99
      Q83RR7 ------------------------------------------------------------MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGIN-W 39

  AVX54654.1 KISF-EKFVKLFTSN-GILYSLFLSILYAIVAGMLCVLIGY--PIALMMAQMKSKILARNMWVIVTM-P---MWISMLL--KVLGLQTL-FY-LLADFAI 187
      Q83RR7 Q-GFTTKWYSLLMNNDSLLQAAQHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFMLLGIQ-LGFWSLL--F-- 133

  AVX54654.1 GTPIAIIIGMTYMFLPFAIAPIYDSLESRQTDLE--EAALDLGASKFRTFWSITLRSSMP----G-VLTAFSLVLVQAATSLIVVHYMGGGRIY-LVSAA 279
      Q83RR7 -SHI------TFC-LPFVVVTVYSRL--KGFDVRMLEAAKDLGASEFTILRKIILPLAMPAVAAGWVLS-FTL----SMDDVVVSSFVTGPS-YEILPLK 217

  AVX54654.1 IESYFFQGNDFGYGAAVSVVLAILVFGLMLVM----KLIS-NKFEMKGN----KRKWKNS 330
      Q83RR7 IYSMV----KVGVSPEVNALATILLV-LSLVMVIASQLIARDK--TKGNGGDVK------ 264

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0031969 chloroplast membrane
1. PBF GO:0015419 ABC-type sulfate transporter activity
1. PBF GO:0005315 inorganic phosphate transmembrane transporter activity
1. PBF GO:0055085 transmembrane transport
1. PBF GO:0016021 integral component of membrane
1. PBF GO:0005887 integral component of plasma membrane
1. PBF GO:0005886 plasma membrane
1. PBF GO:0015098 molybdate ion transmembrane transporter activity
1. PBF GO:0035435 phosphate ion transmembrane transport
1. PBF GO:0042170 plastid membrane
1. PBF GO:0043190 ATP-binding cassette (ABC) transporter complex
1. PBF GO:0008643 carbohydrate transport
1. PBF GO:0006817 phosphate ion transport
1. PBF GO:0015774 polysaccharide transport
2. PF GO:0022857 transmembrane transporter activity
2. PF GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
2. PF GO:0042918 alkanesulfonate transport
2. PF GO:0031460 glycine betaine transport
2. PF GO:0015112 nitrate transmembrane transporter activity
2. PF GO:0042128 nitrate assimilation
2. PF GO:0033223 2-aminoethylphosphonate transport
2. PF GO:0042956 maltodextrin transport
2. PF GO:0006865 amino acid transport
2. PF GO:0015416 ABC-type phosphonate transporter activity
2. PF GO:0015423 ABC-type maltose transporter activity
2. PF GO:0015833 peptide transport
2. PF GO:0015794 glycerol-3-phosphate transmembrane transport
2. PF GO:0001407 glycerophosphodiester transmembrane transport
2. PF GO:1990060 maltose transport complex
2. PF GO:0015768 maltose transport
2. PF GO:0042959 alkanesulfonate transmembrane transporter activity
4. PB GO:0015847 putrescine transport
4. PB GO:1903711 spermidine transmembrane transport
5. P GO:1902603 carnitine transmembrane transport
5. P GO:0009290 DNA import into cell involved in transformation
5. P GO:0015871 choline transport
5. P GO:0043953 protein transport by the Tat complex
5. P GO:0001406 glycerophosphodiester transmembrane transporter activity
5. P GO:0006825 copper ion transport
5. P GO:0006829 zinc ion transport
5. P GO:0032218 riboflavin transport
5. P GO:0015879 carnitine transport
5. P GO:0015786 UDP-glucose transmembrane transport
5. P GO:0015031 protein transport
5. P GO:0035672 oligopeptide transmembrane transport
5. P GO:0000099 sulfur amino acid transmembrane transporter activity
5. P GO:0015169 glycerol-3-phosphate transmembrane transporter activity
5. P GO:0071916 dipeptide transmembrane transporter activity
5. P GO:0051701 biological process involved in interaction with host
5. P GO:0015489 putrescine transmembrane transporter activity
5. P GO:0015226 carnitine transmembrane transporter activity
5. P GO:0006824 cobalt ion transport
5. P GO:0015199 amino-acid betaine transmembrane transporter activity
5. P GO:0005275 amine transmembrane transporter activity
5. P GO:0033281 TAT protein transport complex
5. P GO:0035444 nickel cation transmembrane transport
5. P GO:0015099 nickel cation transmembrane transporter activity
5. P GO:0042884 microcin transport
5. P GO:0000101 sulfur amino acid transport
5. P GO:0030435 sporulation resulting in formation of a cellular spore
5. P GO:0030420 establishment of competence for transformation
5. P GO:0009977 proton motive force dependent protein transmembrane transporter activity
5. P GO:0034634 glutathione transmembrane transporter activity
5. P GO:0032217 riboflavin transmembrane transporter activity
5. P GO:0033214 siderophore-dependent iron import into cell
5. P GO:0034775 glutathione transmembrane transport
5. P GO:0008320 protein transmembrane transporter activity
5. P GO:0015675 nickel cation transport
5. P GO:0005460 UDP-glucose transmembrane transporter activity
5. P GO:0010438 cellular response to sulfur starvation
5. P GO:0010921 regulation of phosphatase activity
6. F GO:0015184 L-cystine transmembrane transporter activity
6. F GO:0015888 thiamine transport
6. F GO:0048473 D-methionine transport
6. F GO:0015811 L-cystine transport
6. F GO:0071705 nitrogen compound transport
6. F GO:0006811 ion transport
6. F GO:0003333 amino acid transmembrane transport
6. F GO:0055072 iron ion homeostasis
7. B GO:0008272 sulfate transport

Uniprot GO Annotations

GO Description
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0055085 transmembrane transport
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P0A2J8 Spermidine/putrescine transport system permease protein PotB 0.00e+00 7.05e-13 6.77e-28 0.8467
1. PBF O57893 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 2.56e-12 6.65e-07 0.8506
1. PBF P0AFL2 Putrescine transport system permease protein PotI 0.00e+00 8.50e-18 0.041 0.7911
1. PBF P75058 Spermidine/putrescine transport system permease protein PotB homolog 0.00e+00 8.26e-13 3.67e-14 0.8223
1. PBF Q9TKU8 Probable sulfate transport system permease protein cysT 9.33e-15 4.65e-16 7.85e-05 0.7532
1. PBF P0CL49 Spermidine/putrescine transport system permease protein PotB 0.00e+00 7.05e-13 6.77e-28 0.8459
1. PBF P26246 Probable sulfate transport system permease protein cysT 0.00e+00 3.35e-10 5.44e-07 0.7825
1. PBF Q9V2C1 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 4.74e-13 4.18e-07 0.8459
1. PBF Q83RR7 Spermidine/putrescine transport system permease protein PotC 0.00e+00 2.92e-17 0.006 0.7972
1. PBF P0AFR8 Inner membrane ABC transporter permease protein YcjO 0.00e+00 2.29e-15 0.001 0.7547
1. PBF P46339 Probable ABC transporter permease protein YqgH 1.20e-12 2.06e-21 0.035 0.579
1. PBF Q8RVC7 Sulfate permease 1, chloroplastic 6.98e-13 5.60e-05 0.006 0.7531
1. PBF P45169 Spermidine/putrescine transport system permease protein PotC 0.00e+00 4.16e-17 0.001 0.8578
1. PBF Q9K9G6 Formylaminopyrimidine transport permease protein ThiX 1.52e-07 1.49e-07 0.016 0.582
1. PBF O51924 Trehalose/maltose transport system permease protein MalF 0.00e+00 2.60e-21 2.34e-06 0.7494
1. PBF P18795 Probable transport system permease protein NifC 3.33e-16 2.64e-22 0.004 0.7024
1. PBF Q6QJE2 Sulfate permease 2, chloroplastic 0.00e+00 1.14e-15 0.008 0.731
1. PBF Q9TJR4 Probable sulfate transport system permease protein cysT 0.00e+00 5.48e-08 3.38e-05 0.8175
1. PBF P47289 Spermidine/putrescine transport system permease protein PotB homolog 0.00e+00 3.55e-12 1.28e-16 0.8128
1. PBF D4GQ17 Probable molybdenum ABC transporter permease protein HVO_B0370 0.00e+00 9.62e-14 0.005 0.7598
1. PBF E1WF94 Spermidine/putrescine transport system permease protein PotB 0.00e+00 7.05e-13 6.77e-28 0.8467
1. PBF O34706 Melibiose/raffinose/stachyose import permease protein MelD 0.00e+00 2.75e-26 0.020 0.788
1. PBF Q85AI0 Probable sulfate transport system permease protein cysT 7.56e-14 1.03e-15 0.029 0.8066
1. PBF P27370 Sulfate transport system permease protein CysW 1.85e-14 3.13e-17 0.001 0.7694
1. PBF P41032 Sulfate transport system permease protein CysT 0.00e+00 1.93e-15 0.047 0.7997
1. PBF Q2EEX6 Probable sulfate transport system permease protein cysT 0.00e+00 1.96e-07 0.001 0.7891
1. PBF P56343 Probable sulfate transport system permease protein cysT 0.00e+00 6.77e-09 1.65e-06 0.8008
1. PBF Q53683 Putative ABC transporter permease protein ORF1 (Fragment) 0.00e+00 3.62e-07 0.003 0.8809
1. PBF Q55472 Osmoprotective compounds uptake permease protein GgtC 0.00e+00 1.14e-09 0.015 0.7215
1. PBF A2CI71 Probable sulfate transport system permease protein cysT 3.33e-16 2.41e-16 1.08e-05 0.7466
1. PBF P47290 Spermidine/putrescine transport system permease protein PotC homolog 2.78e-12 4.47e-21 7.53e-06 0.6524
1. PBF P0AFK7 Spermidine/putrescine transport system permease protein PotC 0.00e+00 1.97e-17 0.006 0.804
1. PBF P0AFK8 Spermidine/putrescine transport system permease protein PotC 0.00e+00 1.97e-17 0.006 0.839
1. PBF P75057 Spermidine/putrescine transport system permease protein PotC homolog 1.10e-11 1.24e-20 4.52e-05 0.6496
1. PBF P0AFK5 Spermidine/putrescine transport system permease protein PotB 0.00e+00 1.30e-09 1.75e-28 0.8409
1. PBF Q8U4K4 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 1.64e-08 4.30e-04 0.8365
1. PBF P45170 Spermidine/putrescine transport system permease protein PotB 0.00e+00 3.32e-15 6.63e-28 0.819
1. PBF P9WG12 Molybdenum transport system permease protein ModB 0.00e+00 2.42e-07 2.08e-06 0.7851
1. PBF Q9MUL9 Probable sulfate transport system permease protein cysT 0.00e+00 7.78e-09 3.76e-06 0.8023
1. PBF Q32RF7 Probable sulfate transport system permease protein cysT 2.09e-10 3.44e-13 0.003 0.7533
1. PBF P0A625 Molybdenum transport system permease protein ModB 0.00e+00 2.42e-07 2.08e-06 0.7893
1. PBF O50501 Diacetylchitobiose uptake system permease protein NgcG 6.90e-11 9.19e-31 0.004 0.6563
1. PBF Q5JEB3 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 1.11e-11 5.75e-04 0.7803
2. PF Q8FW08 sn-glycerol-3-phosphate transport system permease protein UgpE 1.10e-12 2.82e-16 NA 0.6515
2. PF P40980 Putative ABC transporter permease protein ORF2 0.00e+00 5.16e-16 NA 0.7509
2. PF P29823 Lactose transport system permease protein LacF 0.00e+00 1.40e-15 NA 0.749
2. PF Q8ZLF2 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 7.72e-17 NA 0.7137
2. PF Q2YKR7 sn-glycerol-3-phosphate transport system permease protein UgpE 7.26e-13 8.14e-17 NA 0.652
2. PF Q98FL4 Phosphate transport system permease protein PstA 3.44e-11 4.62e-12 NA 0.5587
2. PF P68184 Maltose/maltodextrin transport system permease protein MalG 5.93e-12 3.55e-21 NA 0.759
2. PF P37729 Probable starch degradation products transport system permease protein AmyC 1.06e-13 5.62e-16 NA 0.6707
2. PF P96064 Putative 2-aminoethylphosphonate transport system permease protein PhnU 0.00e+00 2.10e-19 NA 0.7636
2. PF P0A631 Phosphate transport system permease protein PstC 2 8.17e-11 1.95e-11 NA 0.533
2. PF O58967 Probable ABC transporter permease protein PH1216 1.90e-13 1.13e-14 NA 0.7277
2. PF P94529 Arabinooligosaccharides transport system permease protein AraP 1.85e-13 5.50e-24 NA 0.7374
2. PF A1AGY2 sn-glycerol-3-phosphate transport system permease protein UgpE 1.17e-12 1.06e-13 NA 0.6642
2. PF Q7AA80 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.43e-16 NA 0.756
2. PF P45191 Phosphate transport system permease protein PstC 6.45e-11 3.55e-13 NA 0.6118
2. PF P9WG06 Phosphate transport system permease protein PstC 1 1.39e-10 2.30e-09 NA 0.5705
2. PF P9WG02 Trehalose transport system permease protein SugA 5.57e-14 8.79e-26 NA 0.7397
2. PF Q57306 Probable ABC transporter permease protein HI_0355 2.50e-09 4.02e-08 NA 0.6578
2. PF P40401 Putative aliphatic sulfonates transport permease protein SsuC 4.14e-07 6.09e-14 NA 0.5671
2. PF Q55106 Bicarbonate transport system permease protein CmpB 8.03e-12 5.62e-16 NA 0.5679
2. PF Q8Z247 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 9.88e-17 NA 0.7293
2. PF O06991 Maltodextrin transport system permease protein MdxG 0.00e+00 1.44e-15 NA 0.7615
2. PF Q8Z246 sn-glycerol-3-phosphate transport system permease protein UgpE 1.37e-12 1.40e-15 NA 0.6682
2. PF O32261 Galactooligosaccharides transport system permease protein GanP 8.14e-12 7.70e-15 NA 0.6501
2. PF Q8Z8W9 Putative 2-aminoethylphosphonate transport system permease protein PhnU 0.00e+00 3.51e-18 NA 0.7714
2. PF P9WG04 Phosphate transport system permease protein PstC 2 1.64e-12 1.95e-11 NA 0.5302
2. PF Q83PU6 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.33e-16 NA 0.7322
2. PF P96065 Putative 2-aminoethylphosphonate transport system permease protein PhnV 0.00e+00 3.09e-18 NA 0.8955
2. PF Q8Z8X0 Putative 2-aminoethylphosphonate transport system permease protein PhnV 0.00e+00 2.16e-17 NA 0.8937
2. PF Q8ZPK1 Osmoprotectant import permease protein OsmY 2.33e-12 6.91e-06 NA 0.6962
2. PF Q32AT5 sn-glycerol-3-phosphate transport system permease protein UgpE 1.04e-12 9.23e-13 NA 0.6679
2. PF A1AGY3 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.40e-16 NA 0.75
2. PF Q7LYX6 Trehalose/maltose transport system permease protein MalG 3.47e-14 5.74e-12 NA 0.7324
2. PF Q0TC09 sn-glycerol-3-phosphate transport system permease protein UgpE 1.58e-12 1.06e-13 NA 0.6664
2. PF Q8X4P0 sn-glycerol-3-phosphate transport system permease protein UgpE 9.60e-13 6.31e-13 NA 0.6684
2. PF P0A4N4 Maltodextrin transport system permease protein MalD 2.95e-13 9.41e-19 NA 0.6975
2. PF Q97UZ0 Glucose import system permease protein GlcT 0.00e+00 2.77e-16 NA 0.7657
2. PF P45190 Phosphate transport system permease protein PstA 4.19e-14 5.90e-14 NA 0.6589
2. PF P73451 Nitrate import permease protein NrtB 2.61e-11 2.62e-15 NA 0.6253
2. PF O06990 Maltodextrin transport system permease protein MdxF 1.93e-13 8.44e-14 NA 0.6573
2. PF Q8FW09 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 3.88e-20 NA 0.7545
2. PF Q83P81 Maltose/maltodextrin transport system permease protein MalF 1.51e-07 3.20e-02 NA 0.7002
2. PF D4GP37 Xylose/arabinose import permease protein XacI 1.95e-12 2.95e-23 NA 0.614
2. PF P55603 Probable ABC transporter permease protein y4oR 3.28e-14 1.32e-21 NA 0.7518
2. PF P58655 Phosphate transport system permease protein PstA 2.46e-14 5.61e-18 NA 0.5907
2. PF P74547 Sulfate transport system permease protein CysW 0.00e+00 5.66e-10 NA 0.7739
2. PF O07011 Galactooligosaccharides transport system permease protein GanQ 6.82e-13 2.11e-18 NA 0.7187
2. PF O31519 Probable ABC transporter permease protein YesP 2.44e-15 1.37e-21 NA 0.7263
2. PF Q66FU6 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 8.20e-18 NA 0.7731
2. PF Q92WD7 sn-glycerol-3-phosphate transport system permease protein UgpE 1.08e-12 1.56e-17 NA 0.6444
2. PF P38044 Nitrate import permease protein NrtB 6.40e-11 1.64e-16 NA 0.6301
2. PF Q92WD8 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.36e-20 NA 0.7685
2. PF Q7N983 Maltose/maltodextrin transport system permease protein MalG 3.63e-11 1.29e-20 NA 0.7073
2. PF Q50097 Phosphate transport system permease protein PstA 1.23e-13 7.83e-19 NA 0.7109
2. PF Q9CNJ6 Phosphate transport system permease protein PstA 3.31e-13 5.13e-11 NA 0.6405
2. PF O32155 Probable ABC transporter permease protein YurN 0.00e+00 1.28e-16 NA 0.7394
2. PF Q9PBK2 Phosphate transport system permease protein PstC 8.22e-13 5.69e-15 NA 0.5867
2. PF Q97UY9 Glucose import system permease protein GlcU 4.51e-13 1.82e-18 NA 0.6236
2. PF Q9CNJ5 Phosphate transport system permease protein PstC 1.83e-10 1.99e-14 NA 0.5388
2. PF Q6CZ32 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.12e-16 NA 0.7723
2. PF P18814 Maltose/maltodextrin transport system permease protein MalG 4.96e-11 1.80e-21 NA 0.7042
2. PF Q66FU5 sn-glycerol-3-phosphate transport system permease protein UgpE 1.69e-12 2.85e-15 NA 0.6744
2. PF Q00751 Multiple sugar-binding transport system permease protein MsmG 6.69e-13 6.61e-14 NA 0.7232
2. PF P0AFS0 Inner membrane ABC transporter permease protein YdcV 0.00e+00 5.69e-22 NA 0.842
2. PF P0A4N1 Maltodextrin transport system permease protein MalC 4.57e-11 1.67e-13 NA 0.6226
2. PF Q9K489 Diacetylchitobiose uptake system permease protein DasC 0.00e+00 4.93e-14 NA 0.7749
2. PF Q578E7 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 3.59e-20 NA 0.7713
2. PF Q1CNC7 sn-glycerol-3-phosphate transport system permease protein UgpE 1.45e-12 2.85e-15 NA 0.673
2. PF P39128 Protein LplB 0.00e+00 7.53e-14 NA 0.6639
2. PF D4GP36 Xylose/arabinose import permease protein XacH 6.59e-13 3.87e-25 NA 0.7474
2. PF P9WG08 Phosphate transport system permease protein PstA 2 5.07e-14 5.45e-20 NA 0.6202
2. PF Q576D9 Probable ABC transporter permease protein BruAb2_1124 5.89e-09 1.16e-08 NA 0.6903
2. PF P75263 Probable ABC transporter permease protein MG188 homolog 6.88e-15 1.05e-19 NA 0.7046
2. PF Q52814 General L-amino acid transport system permease protein AapM 4.18e-07 3.39e-12 NA 0.5306
2. PF Q5PJL0 sn-glycerol-3-phosphate transport system permease protein UgpE 1.40e-12 3.38e-15 NA 0.6623
2. PF Q32IB7 Glutathione transport system permease protein GsiC 6.31e-09 3.56e-02 NA 0.7154
2. PF P53561 Polygalacturonan/rhamnogalacturonan transport system permease protein YtcP 1.77e-12 8.72e-06 NA 0.6543
2. PF Q8YCB0 sn-glycerol-3-phosphate transport system permease protein UgpE 1.22e-12 3.43e-17 NA 0.6412
2. PF P9WG10 Phosphate transport system permease protein PstA 1 2.05e-13 7.50e-20 NA 0.7382
2. PF O50500 Diacetylchitobiose uptake system permease protein NgcF 0.00e+00 4.98e-15 NA 0.6695
2. PF Q1R5H6 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.40e-16 NA 0.7551
2. PF Q5PFQ5 Putative 2-aminoethylphosphonate transport system permease protein PhnV 0.00e+00 6.26e-18 NA 0.8943
2. PF Q98FL3 Phosphate transport system permease protein PstC 1.92e-13 1.68e-15 NA 0.582
2. PF Q8X6V7 Glutathione transport system permease protein GsiC 6.90e-09 4.64e-02 NA 0.6965
2. PF P68185 Maltose/maltodextrin transport system permease protein MalG 5.81e-12 3.55e-21 NA 0.7634
2. PF O58760 Probable ABC transporter permease protein PH1036 0.00e+00 3.61e-12 NA 0.7467
2. PF P27367 Sulfate transport system permease protein CysT 0.00e+00 4.27e-09 NA 0.808
2. PF Q8UB30 sn-glycerol-3-phosphate transport system permease protein UgpE 1.95e-10 8.35e-18 NA 0.6523
2. PF P47434 Probable ABC transporter permease protein MG188 4.66e-15 3.70e-18 NA 0.744
2. PF Q8FUN2 Probable ABC transporter permease protein BRA1188/BS1330_II1179 6.41e-09 9.58e-09 NA 0.6876
2. PF Q0P886 Tungstate uptake system permease protein TupB 1.47e-12 4.12e-07 NA 0.7655
2. PF Q2YL00 Probable ABC transporter permease protein BAB2_0490 0.00e+00 3.72e-16 NA 0.7421
2. PF Q0SZM0 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.33e-16 NA 0.7551
2. PF Q93KD5 Tungstate uptake system permease protein TupB 1.07e-11 1.48e-04 NA 0.7668
2. PF P0A4N3 Maltodextrin transport system permease protein MalD 2.84e-13 9.41e-19 NA 0.6943
2. PF P0AGI0 Phosphate transport system permease protein PstC 8.17e-13 1.48e-12 NA 0.6256
2. PF Q8D3U7 Maltose/maltodextrin transport system permease protein MalG 3.69e-11 2.46e-21 NA 0.7229
2. PF Q7CKV5 sn-glycerol-3-phosphate transport system permease protein UgpE 1.34e-12 2.85e-15 NA 0.6648
2. PF P94530 Arabinooligosaccharides transport system permease protein AraQ 1.03e-12 2.09e-16 NA 0.6911
2. PF Q7A937 Maltose/maltodextrin transport system permease protein MalF 1.70e-07 4.64e-02 NA 0.6977
2. PF A1JID9 sn-glycerol-3-phosphate transport system permease protein UgpE 1.90e-10 4.39e-14 NA 0.6741
2. PF Q32AT4 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 3.49e-17 NA 0.7652
2. PF Q8FJK9 Glutathione transport system permease protein GsiC 7.90e-09 3.67e-02 NA 0.6961
2. PF Q50098 Phosphate transport system permease protein PstC 2.32e-12 1.79e-10 NA 0.5011
2. PF Q87C89 Phosphate transport system permease protein PstA 3.33e-14 1.54e-13 NA 0.6324
2. PF Q9K490 Diacetylchitobiose uptake system permease protein DasB 3.33e-15 8.99e-29 NA 0.7362
2. PF O34649 Uncharacterized ABC transporter permease protein YtlD 2.99e-08 2.97e-16 NA 0.6311
2. PF P75262 Probable ABC transporter permease protein MG189 homolog 1.39e-11 6.66e-22 NA 0.5807
2. PF Q5MZ55 Bicarbonate transport system permease protein CmpB 6.29e-12 5.62e-16 NA 0.5996
2. PF Q8Z1U3 Maltose/maltodextrin transport system permease protein MalG 5.24e-11 4.41e-22 NA 0.7148
2. PF A1JID8 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 5.33e-17 NA 0.7205
2. PF A0A140NFA3 Phosphonate transport system permease protein PhnE 3.34e-09 5.00e-12 NA 0.6036
2. PF Q8ZLF3 sn-glycerol-3-phosphate transport system permease protein UgpE 1.45e-12 3.38e-15 NA 0.6641
2. PF Q578M9 Probable ABC transporter permease protein BruAb2_0483 0.00e+00 3.72e-16 NA 0.7448
2. PF Q9KL07 Maltose/maltodextrin transport system permease protein MalG 4.24e-11 1.64e-22 NA 0.7184
2. PF Q9Z3R7 Alpha-glucoside transport system permease protein AglG 4.36e-10 2.79e-13 NA 0.8218
2. PF Q74RF8 Maltose/maltodextrin transport system permease protein MalG 3.43e-11 5.60e-23 NA 0.6908
2. PF Q8FCQ1 sn-glycerol-3-phosphate transport system permease protein UgpE 1.24e-12 1.06e-13 NA 0.67
2. PF O30143 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 2.50e-09 NA 0.7974
2. PF Q7CRU3 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 2.99e-19 NA 0.748
2. PF P45054 Oligopeptide transport system permease protein OppB 1.01e-09 2.70e-05 NA 0.7278
2. PF O34518 Melibiose/raffinose/stachyose import permease protein MelC 4.00e-13 5.92e-16 NA 0.7087
2. PF P55602 Probable ABC transporter permease protein y4oQ 0.00e+00 1.08e-25 NA 0.7413
2. PF Q0SZM1 sn-glycerol-3-phosphate transport system permease protein UgpE 1.24e-12 5.38e-13 NA 0.6633
2. PF Q57IS1 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 9.92e-16 NA 0.7461
2. PF Q00750 Multiple sugar-binding transport system permease protein MsmF 0.00e+00 1.44e-20 NA 0.7277
2. PF Q52665 Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC 1.52e-06 2.31e-05 NA 0.6029
2. PF Q5PJK9 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 9.92e-16 NA 0.7386
2. PF O32154 Probable ABC transporter permease protein YurM 1.23e-12 3.90e-32 NA 0.7525
2. PF P0AGH9 Phosphate transport system permease protein PstC 8.82e-13 1.48e-12 NA 0.6199
2. PF O31520 Probable ABC transporter permease protein YesQ 1.32e-12 3.15e-22 NA 0.6655
2. PF Q55461 Bicarbonate transport system permease protein CmpB 8.10e-10 2.50e-13 NA 0.5648
2. PF O58759 Probable ABC transporter permease protein PH1038 0.00e+00 3.61e-14 NA 0.7017
2. PF Q83S26 Glutathione transport system permease protein GsiC 7.21e-09 2.24e-02 NA 0.7197
2. PF P46340 Probable ABC transporter permease protein YqgI 4.45e-10 4.73e-08 NA 0.568
2. PF Q2YKR6 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 3.59e-20 NA 0.7663
2. PF Q8FVS6 Probable ABC transporter permease protein BRA0749/BS1330_II0742 0.00e+00 3.07e-16 NA 0.7321
2. PF Q2YJB4 Probable ABC transporter permease protein BAB2_1148 5.52e-09 1.16e-08 NA 0.6819
2. PF Q53192 Probable peptide ABC transporter permease protein y4tQ 2.00e-07 5.13e-08 NA 0.672
2. PF P68186 Maltose/maltodextrin transport system permease protein MalG 1.33e-11 3.55e-21 NA 0.7492
2. PF P0A627 Phosphate transport system permease protein PstA 2 4.67e-14 5.45e-20 NA 0.6268
2. PF Q01895 Sulfate transport system permease protein CysT 0.00e+00 1.54e-17 NA 0.77
2. PF Q8Z862 Glutathione transport system permease protein GsiC 4.28e-10 3.56e-02 NA 0.6955
2. PF O69053 Phosphite transport system permease protein PtxC 5.07e-10 2.21e-15 NA 0.5692
2. PF Q1CBH3 sn-glycerol-3-phosphate transport system permease protein UgpE 1.30e-12 2.85e-15 NA 0.6684
2. PF Q57SD7 Putative 2-aminoethylphosphonate transport system permease protein PhnU 0.00e+00 2.94e-19 NA 0.7623
2. PF P0A4N2 Maltodextrin transport system permease protein MalC 2.42e-13 1.67e-13 NA 0.626
2. PF O69062 Putative phosphite transport system permease protein HtxC 2.39e-11 3.98e-14 NA 0.6007
2. PF Q3Z3V2 Glutathione transport system permease protein GsiC 6.38e-09 2.17e-02 NA 0.6964
2. PF O32209 Putative molybdenum transport system permease protein YvgM 2.22e-16 1.25e-02 NA 0.7391
2. PF P29824 Lactose transport system permease protein LacG 4.37e-11 1.58e-14 NA 0.6603
2. PF P26468 Maltose/maltodextrin transport system permease protein MalG 4.63e-11 3.09e-22 NA 0.7181
2. PF Q0TC08 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 9.88e-17 NA 0.7158
2. PF Q1CBH4 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.35e-16 NA 0.7672
2. PF Q9Z3R6 Alpha-glucoside transport system permease protein AglF 1.33e-15 3.87e-27 NA 0.6808
2. PF Q7CKV6 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.35e-16 NA 0.7695
2. PF Q7MFC1 Maltose/maltodextrin transport system permease protein MalG 3.75e-11 2.46e-21 NA 0.723
2. PF Q9PBK1 Phosphate transport system permease protein PstA 6.66e-14 2.06e-13 NA 0.6216
2. PF Q57RB0 Glutathione transport system permease protein GsiC 3.08e-10 3.56e-02 NA 0.7384
2. PF Q1R5H7 sn-glycerol-3-phosphate transport system permease protein UgpE 4.15e-11 1.06e-13 NA 0.6653
2. PF O58968 Probable ABC transporter permease protein PH1215 0.00e+00 7.96e-15 NA 0.7315
2. PF P47435 Probable ABC transporter permease protein MG189 5.75e-12 1.92e-22 NA 0.6341
2. PF Q0TJL7 Glutathione transport system permease protein GsiC 7.71e-09 3.56e-02 NA 0.6951
2. PF Q83PU7 sn-glycerol-3-phosphate transport system permease protein UgpE 1.10e-12 6.31e-13 NA 0.6679
2. PF Q1CNC8 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.35e-16 NA 0.7708
2. PF Q57IS2 sn-glycerol-3-phosphate transport system permease protein UgpE 1.62e-12 3.38e-15 NA 0.6664
2. PF P9WG00 Trehalose transport system permease protein SugB 4.97e-13 1.42e-11 NA 0.7558
2. PF C0SPB3 Polygalacturonan/rhamnogalacturonan transport system permease protein YteP 8.77e-15 1.77e-14 NA 0.6219
2. PF Q57SD8 Putative 2-aminoethylphosphonate transport system permease protein PhnV 0.00e+00 1.53e-19 NA 0.8732
2. PF P0A629 Phosphate transport system permease protein PstC 1 2.41e-09 2.30e-09 NA 0.6456
2. PF Q9KEE9 Arabinooligosaccharides transport system permease protein AraQ 0.00e+00 8.35e-16 NA 0.7134
2. PF P0AEB1 Sulfate transport system permease protein CysW 0.00e+00 1.06e-13 NA 0.7441
2. PF Q55473 Osmoprotective compounds uptake permease protein GgtD 4.33e-15 8.25e-26 NA 0.732
2. PF Q51881 Nitrate import permease protein NrtB 3.63e-10 1.79e-16 NA 0.6163
2. PF Q578E8 sn-glycerol-3-phosphate transport system permease protein UgpE 1.44e-12 8.14e-17 NA 0.654
2. PF Q9KEF0 Arabinooligosaccharides transport system permease protein AraP 0.00e+00 1.11e-25 NA 0.7395
2. PF Q8FCQ0 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 2.92e-16 NA 0.7368
2. PF Q8YCA8 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 3.73e-20 NA 0.75
2. PF Q1RE94 Glutathione transport system permease protein GsiC 6.71e-09 3.56e-02 NA 0.7423
2. PF P24138 Oligopeptide transport system permease protein OppB 7.06e-09 3.76e-05 NA 0.5362
2. PF Q8YDR8 Probable ABC transporter permease protein BMEII0107 7.47e-09 7.44e-10 NA 0.6856
2. PF A9WGD1 Riboflavin transport system permease protein RibX 9.99e-12 3.33e-20 NA 0.6373
2. PF Q5PFQ6 Putative 2-aminoethylphosphonate transport system permease protein PhnU 0.00e+00 1.84e-17 NA 0.7792
2. PF Q87GB8 Maltose/maltodextrin transport system permease protein MalG 3.57e-11 2.65e-21 NA 0.7223
2. PF P37730 Probable starch degradation products transport system permease protein AmyD 0.00e+00 7.04e-16 NA 0.7687
2. PF Q87C90 Phosphate transport system permease protein PstC 9.31e-13 1.29e-14 NA 0.5809
2. PF P39129 Protein LplC 1.10e-12 3.31e-07 NA 0.6278
3. BF P37731 Molybdenum transport system permease protein ModB 0.00e+00 NA 0.007 0.8149
3. BF P71338 Fe(3+)-transport system permease protein FbpB 2 9.30e-09 NA 0.001 0.7069
3. BF P75185 Phosphate transport system permease protein PstA homolog 7.96e-08 NA 0.023 0.5873
3. BF P0AF02 Molybdenum transport system permease protein ModB 0.00e+00 NA 0.023 0.7359
3. BF P45322 Molybdenum transport system permease protein ModB 5.55e-16 NA 0.001 0.7554
4. PB P16701 Sulfate transport system permease protein CysT 0.00e+00 1.13e-14 0.016 NA
4. PB P0AFR7 Inner membrane ABC transporter permease protein YcjO 0.00e+00 2.29e-15 0.001 NA
4. PB P0AFL1 Putrescine transport system permease protein PotI 0.00e+00 8.50e-18 0.041 NA
4. PB P77156 Inner membrane ABC transporter permease protein YdcU 3.33e-16 2.81e-28 5.43e-04 NA
4. PB P0AFK6 Spermidine/putrescine transport system permease protein PotC 0.00e+00 1.97e-17 0.006 NA
4. PB P9WG13 Molybdenum transport system permease protein ModB 0.00e+00 2.42e-07 2.08e-06 NA
4. PB P31135 Putrescine transport system permease protein PotH 0.00e+00 1.38e-33 9.43e-19 NA
4. PB P0AFK4 Spermidine/putrescine transport system permease protein PotB 0.00e+00 1.30e-09 1.75e-28 NA
4. PB Q58763 Molybdate/tungstate transport system permease protein WtpB 0.00e+00 8.64e-08 0.013 NA
5. P P47324 Oligopeptide transport system permease protein OppC 2.58e-07 2.88e-06 NA NA
5. P Q2FH55 Nickel import system permease protein NikB 4.62e-09 2.04e-08 NA NA
5. P Q6G9H9 Nickel import system permease protein NikC 2.34e-07 2.67e-05 NA NA
5. P P0AGH5 Putrescine export system permease protein SapC 1.09e-08 1.26e-08 NA NA
5. P D1BTU8 Sec-independent protein translocase protein TatC 4.16e-04 4.16e-03 NA NA
5. P P0AGH4 Peptide transport system permease protein SapB 1.19e-09 1.01e-02 NA NA
5. P P26903 Dipeptide transport system permease protein DppB 4.38e-09 1.42e-05 NA NA
5. P Q57RA9 Glutathione transport system permease protein GsiD 1.95e-07 1.51e-08 NA NA
5. P P0A4N7 Oligopeptide transport system permease protein OppB 3.16e-08 7.41e-04 NA NA
5. P P26904 Dipeptide transport system permease protein DppC 1.07e-08 1.67e-07 NA NA
5. P Q32IB8 Glutathione transport system permease protein GsiD 1.35e-07 4.15e-09 NA NA
5. P Q0T6D1 Glutathione transport system permease protein GsiC 6.45e-09 2.47e-02 NA NA
5. P Q8XF88 Glutathione transport system permease protein GsiD 1.56e-07 1.51e-08 NA NA
5. P P0AEB0 Sulfate transport system permease protein CysW 0.00e+00 1.06e-13 NA NA
5. P Q58419 Probable phosphate transport system permease protein PstA 4.27e-13 4.81e-13 NA NA
5. P Q8FUW9 Putative peptide transport system permease protein BRA1093/BS1330_II1085 1.80e-06 1.91e-07 NA NA
5. P P0AFH6 Oligopeptide transport system permease protein OppC 3.96e-08 3.88e-06 NA NA
5. P Q2FYQ6 Nickel import system permease protein NikC 1.78e-08 2.67e-05 NA NA
5. P P0AGH7 Peptide transport system permease protein SapC 1.04e-08 1.26e-08 NA NA
5. P Q7A0Y0 Nickel import system permease protein NikC 2.38e-07 2.67e-05 NA NA
5. P P08005 Oligopeptide transport system permease protein OppB 7.55e-10 3.42e-05 NA NA
5. P A2RI76 Dipeptide transport system permease protein DppC 1.10e-07 9.99e-09 NA NA
5. P D2BJS8 Sec-independent protein translocase protein TatC 7.81e-04 4.31e-04 NA NA
5. P P0AGH6 Peptide transport system permease protein SapC 1.06e-08 1.26e-08 NA NA
5. P P02916 Maltose/maltodextrin transport system permease protein MalF 1.65e-06 3.82e-02 NA NA
5. P C0ZIL1 Energy-coupling factor transporter transmembrane protein EcfT 1.80e-04 2.79e-02 NA NA
5. P D8IIP4 Energy-coupling factor transporter transmembrane protein EcfT 1.97e-04 3.78e-02 NA NA
5. P P46921 Glycine betaine transport system permease protein OpuAB 8.90e-09 2.03e-13 NA NA
5. P P14176 Glycine betaine/proline betaine transport system permease protein ProW 1.47e-08 6.46e-16 NA NA
5. P P75798 Glutathione transport system permease protein GsiC 5.34e-09 3.56e-02 NA NA
5. P P33359 Glycine betaine uptake system permease protein YehW 9.72e-11 2.58e-07 NA NA
5. P Q8ZQM2 Glutathione transport system permease protein GsiC 4.01e-10 4.01e-02 NA NA
5. P P75799 Glutathione transport system permease protein GsiD 4.70e-08 6.41e-09 NA NA
5. P P0AGH3 Putrescine export system permease protein SapB 1.22e-09 1.01e-02 NA NA
5. P Q8FJK8 Glutathione transport system permease protein GsiD 1.47e-07 7.16e-09 NA NA
5. P P66967 Putative peptide transport permease protein Mb1314c 5.73e-09 5.40e-03 NA NA
5. P P0A4N0 Oligopeptide transport system permease protein AmiD 8.60e-07 1.64e-10 NA NA
5. P Q6G9H8 Nickel import system permease protein NikB 4.22e-09 3.51e-08 NA NA
5. P O69064 Putative phosphite transport system permease protein HtxE 9.38e-08 3.35e-10 NA NA
5. P P42063 Oligopeptide transport system permease protein AppC 1.93e-07 3.76e-07 NA NA
5. P P9WG09 Phosphate transport system permease protein PstA 2 5.25e-14 5.45e-20 NA NA
5. P D8MHM9 Energy-coupling factor transporter transmembrane protein EcfT 1.83e-04 1.26e-02 NA NA
5. P Q1XDM3 Uncharacterized tatC-like protein ycf43 1.47e-03 3.90e-04 NA NA
5. P Q9X2I1 Energy-coupling factor transporter transmembrane protein EcfT 6.58e-05 4.42e-02 NA NA
5. P A8YXN4 Energy-coupling factor transporter transmembrane protein EcfT 1.25e-03 3.55e-03 NA NA
5. P Q6CZ33 sn-glycerol-3-phosphate transport system permease protein UgpE 1.05e-12 3.32e-15 NA NA
5. P P0AFR9 Inner membrane ABC transporter permease protein YdcV 0.00e+00 5.69e-22 NA NA
5. P Q2YXY7 Nickel import system permease protein NikB 3.38e-09 2.10e-08 NA NA
5. P A5VEV5 ATP synthase subunit a 9.29e-04 3.70e-02 NA NA
5. P P0AFU1 Inner membrane ABC transporter permease protein YejB 1.00e-07 9.61e-06 NA NA
5. P Q1RE93 Glutathione transport system permease protein GsiD 3.65e-07 8.23e-09 NA NA
5. P P0AFH2 Oligopeptide transport system permease protein OppB 8.45e-10 9.04e-06 NA NA
5. P P0AFH7 Oligopeptide transport system permease protein OppC 5.24e-08 3.88e-06 NA NA
5. P P0AGH8 Phosphate transport system permease protein PstC 8.84e-13 1.48e-12 NA NA
5. P D1B5U2 Energy-coupling factor transporter transmembrane protein EcfT 2.47e-04 8.41e-03 NA NA
5. P P33591 Nickel transport system permease protein NikB 1.95e-09 1.33e-05 NA NA
5. P A1A971 Glutathione transport system permease protein GsiD 2.60e-07 8.23e-09 NA NA
5. P Q8VQK5 Putative peptide transport system permease protein BruAb2_1032 2.56e-07 1.14e-07 NA NA
5. P Q577J7 Putative peptide permease protein BruAb2_0794 9.32e-08 1.60e-04 NA NA
5. P P0A4N8 Oligopeptide transport system permease protein OppB 3.44e-08 7.41e-04 NA NA
5. P P0AEG1 Dipeptide transport system permease protein DppC 7.06e-07 1.45e-08 NA NA
5. P Q8NWT4 Nickel import system permease protein NikB 4.56e-09 3.51e-08 NA NA
5. P Q6GH25 Nickel import system permease protein NikB 6.98e-09 9.61e-08 NA NA
5. P Q2FH56 Nickel import system permease protein NikC 2.74e-08 2.67e-05 NA NA
5. P Q8YBN8 Putative peptide permease protein BMEII0861 8.38e-07 1.60e-04 NA NA
5. P P08006 Oligopeptide transport system permease protein OppC 6.11e-08 3.10e-06 NA NA
5. P Q2YXY8 Nickel import system permease protein NikC 8.78e-08 1.76e-05 NA NA
5. P Q8VQK4 Putative peptide transport system permease protein BruAb2_1031 5.02e-09 2.43e-03 NA NA
5. P B8I813 Energy-coupling factor transporter transmembrane protein EcfT 8.55e-05 2.47e-02 NA NA
5. P P0AFH4 Oligopeptide transport system permease protein OppB 3.87e-10 9.04e-06 NA NA
5. P P9WFZ6 Putative peptide transport permease protein MT1320 7.96e-09 5.40e-03 NA NA
5. P P0A4N9 Oligopeptide transport system permease protein OppC 1.93e-09 7.26e-09 NA NA
5. P O29470 Uncharacterized transporter AF_0788 5.66e-04 4.42e-02 NA NA
5. P P0ABT9 Probable cystine transporter YijE 9.52e-03 4.42e-02 NA NA
5. P A1A970 Glutathione transport system permease protein GsiC 4.42e-09 3.56e-02 NA NA
5. P Q2FYQ5 Nickel import system permease protein NikB 4.85e-09 2.04e-08 NA NA
5. P Q53191 Probable peptide ABC transporter permease protein y4tP 9.61e-09 6.01e-04 NA NA
5. P P9WG05 Phosphate transport system permease protein PstC 2 1.65e-12 1.95e-11 NA NA
5. P P17327 Glycine betaine/proline betaine transport system permease protein ProW 3.74e-08 2.21e-15 NA NA
5. P P0AFH3 Oligopeptide transport system permease protein OppB 3.83e-10 9.04e-06 NA NA
5. P Q1GU79 ATP synthase subunit a 2.53e-03 2.26e-02 NA NA
5. P A0A0H3JU73 Metal-staphylopine import system permease protein CntC 5.00e-07 7.86e-05 NA NA
5. P D3FRP0 Energy-coupling factor transporter transmembrane protein EcfT 3.98e-04 4.72e-03 NA NA
5. P P49936 Iron(3+)-hydroxamate import system permease protein FhuB 3.62e-04 2.43e-02 NA NA
5. P Q58420 Probable phosphate transport system permease protein PstC 4.30e-11 2.85e-11 NA NA
5. P P9WG01 Trehalose transport system permease protein SugB 2.09e-13 1.42e-11 NA NA
5. P P68183 Maltose/maltodextrin transport system permease protein MalG 1.04e-11 3.55e-21 NA NA
5. P C0MBF3 Energy-coupling factor transporter transmembrane protein EcfT 1.33e-04 4.12e-03 NA NA
5. P P0AFA9 Nickel transport system permease protein NikC 3.11e-07 4.54e-05 NA NA
5. P P66965 Putative peptide transport permease protein Mb1313c 5.54e-07 3.38e-06 NA NA
5. P Q8FWN9 Putative peptide permease protein BRA0407/BS1330_II0404 1.30e-07 1.07e-04 NA NA
5. P Q8X6V6 Glutathione transport system permease protein GsiD 3.94e-07 7.36e-09 NA NA
5. P P0AEG2 Dipeptide transport system permease protein DppC 9.51e-07 1.45e-08 NA NA
5. P P45096 Dipeptide transport system permease protein DppB 4.68e-09 3.16e-04 NA NA
5. P Q2YJK1 Putative peptide transport system permease protein BAB2_1050 5.25e-09 2.43e-03 NA NA
5. P P9WFZ9 Putative peptide transport permease protein Rv1282c 5.10e-07 3.38e-06 NA NA
5. P P0ABT8 Probable cystine transporter YijE 2.54e-03 4.42e-02 NA NA
5. P Q5W7C1 UPF0014 membrane protein STAR2 4.20e-05 1.25e-02 NA NA
5. P A5VU89 Putative peptide permease protein BOV_A0350 1.26e-07 2.61e-05 NA NA
5. P Q2YK65 Putative peptide permease protein BAB2_0815 8.20e-08 1.60e-04 NA NA
5. P P0A2J3 Peptide transport system permease protein SapB 1.42e-09 2.09e-02 NA NA
5. P Q3Z3V1 Glutathione transport system permease protein GsiD 2.36e-07 7.36e-09 NA NA
5. P Q2YJK0 Putative peptide transport system permease protein BAB2_1051 3.36e-07 1.14e-07 NA NA
5. P Q5HG39 Nickel import system permease protein NikC 1.50e-07 2.67e-05 NA NA
5. P Q8FUX0 Putative peptide transport system permease protein BRA1092/BS1330_II1084 7.42e-09 1.92e-03 NA NA
5. P P42062 Oligopeptide transport system permease protein AppB 8.41e-10 5.60e-05 NA NA
5. P A0A0H3K104 Metal-staphylopine import system permease protein CntB 4.83e-09 7.35e-07 NA NA
5. P D9RZP4 Energy-coupling factor transporter transmembrane protein EcfT 3.34e-04 1.15e-02 NA NA
5. P A0A0H2ZFV0 Di/tripeptide transport system permease protein DppC 8.89e-07 3.35e-07 NA NA
5. P P24139 Oligopeptide transport system permease protein OppC 1.84e-07 2.64e-08 NA NA
5. P P77308 Probable D,D-dipeptide transport system permease protein DdpB 1.23e-08 1.32e-02 NA NA
5. P Q6GH26 Nickel import system permease protein NikC 1.80e-08 1.21e-05 NA NA
5. P P74369 UPF0014 membrane protein slr1647 5.66e-05 2.31e-02 NA NA
5. P P0C2L2 Glutathione transport system permease protein GsiD 8.93e-08 3.23e-09 NA NA
5. P Q99UA0 Nickel import system permease protein NikB 4.75e-09 1.93e-08 NA NA
5. P P0A4M9 Oligopeptide transport system permease protein AmiD 8.57e-07 1.64e-10 NA NA
5. P P33361 Glycine betaine uptake system permease protein YehY 2.84e-09 4.12e-06 NA NA
5. P P0AFU0 Inner membrane ABC transporter permease protein YejB 7.82e-08 9.61e-06 NA NA
5. P P0A2J6 Peptide transport system permease protein SapC 9.48e-09 1.99e-08 NA NA
5. P P0AFH5 Oligopeptide transport system permease protein OppB 8.06e-10 9.04e-06 NA NA
5. P Q2FVE9 Metal-staphylopine import system permease protein CntC 5.23e-07 6.91e-05 NA NA
5. P P54086 Sec-independent protein translocase protein TatC 5.59e-04 2.07e-02 NA NA
5. P A0LDW6 ATP synthase subunit a 4.06e-04 3.60e-02 NA NA
5. P Q83S25 Glutathione transport system permease protein GsiD 1.25e-07 3.23e-09 NA NA
5. P P75553 Oligopeptide transport system permease protein OppC 1.14e-08 1.74e-05 NA NA
5. P P51264 Uncharacterized tatC-like protein ycf43 3.05e-04 5.33e-04 NA NA
5. P Q5M245 Energy-coupling factor transporter transmembrane protein EcfT 2.14e-04 1.83e-02 NA NA
5. P Q57856 Putative ABC transporter permease protein MJ0413 5.99e-09 1.90e-17 NA NA
5. P P9WG11 Phosphate transport system permease protein PstA 1 8.64e-14 6.45e-20 NA NA
5. P Q75G39 ATP synthase subunit a 1.17e-03 8.07e-03 NA NA
5. P Q7A5Q6 Nickel import system permease protein NikB 4.39e-09 1.93e-08 NA NA
5. P P9WG03 Trehalose transport system permease protein SugA 6.54e-14 8.79e-26 NA NA
5. P P66896 Sec-independent protein translocase protein TatC 8.17e-04 2.82e-04 NA NA
5. P P9WFZ8 Putative peptide transport permease protein MT1319 5.51e-07 3.38e-06 NA NA
5. P Q5PGP6 Glutathione transport system permease protein GsiD 2.00e-07 1.51e-08 NA NA
5. P Q99UA1 Nickel import system permease protein NikC 1.66e-08 3.04e-05 NA NA
5. P Q1MIM3 Riboflavin transporter 2.24e-03 4.21e-02 NA NA
5. P P9WG96 Sec-independent protein translocase protein TatC 7.65e-04 2.82e-04 NA NA
5. P P9WG07 Phosphate transport system permease protein PstC 1 1.11e-10 2.30e-09 NA NA
5. P P0A2J5 Peptide transport system permease protein SapC 9.65e-09 1.99e-08 NA NA
5. P P94312 Dipeptide transport system permease protein DppC 3.33e-08 7.36e-08 NA NA
5. P Q5HG38 Nickel import system permease protein NikB 4.91e-09 2.04e-08 NA NA
5. P Q7A5Q7 Nickel import system permease protein NikC 1.43e-07 3.04e-05 NA NA
5. P Q7CQV4 Glutathione transport system permease protein GsiD 2.15e-07 1.51e-08 NA NA
5. P P0AFB0 Nickel transport system permease protein NikC 2.78e-07 4.54e-05 NA NA
5. P P45768 Inner membrane amino-acid ABC transporter permease protein YhdY 7.40e-07 5.34e-10 NA NA
5. P E0SCY2 Glycine betaine/choline transport system permease protein OusW 1.48e-07 1.40e-09 NA NA
5. P P0AEG3 Dipeptide transport system permease protein DppC 9.13e-07 1.45e-08 NA NA
5. P Q9RR45 Glycine betaine/carnitine transport permease protein GbuB 5.41e-09 6.61e-13 NA NA
5. P P77463 Probable D,D-dipeptide transport system permease protein DdpC 1.39e-06 7.74e-07 NA NA
5. P Q6D3B2 Glutathione transport system permease protein GsiD 4.97e-07 2.04e-08 NA NA
5. P P45286 Peptide transport system permease protein SapB 8.54e-10 8.67e-03 NA NA
5. P Q323W2 Glutathione transport system permease protein GsiD 2.02e-07 7.36e-09 NA NA
5. P P07654 Phosphate transport system permease protein PstA 2.09e-14 4.24e-17 NA NA
5. P Q8YDG8 Putative peptide transport system permease protein BMEII0207/BMEII0208 2.35e-07 1.14e-07 NA NA
5. P P75851 Putative aliphatic sulfonates transport permease protein SsuC 3.08e-07 3.86e-08 NA NA
5. P Q0TJL6 Glutathione transport system permease protein GsiD 1.03e-07 7.16e-09 NA NA
5. P A2RI75 Dipeptide transport system permease protein DppB 1.58e-09 7.00e-06 NA NA
5. P A0A0H2ZGW7 Di/tripeptide transport system permease protein DppB 1.84e-09 6.11e-03 NA NA
5. P Q2FVE8 Metal-staphylopine import system permease protein CntB 3.97e-09 1.01e-06 NA NA
5. P P9WG97 Sec-independent protein translocase protein TatC 7.63e-04 2.82e-04 NA NA
5. P P0A4P0 Oligopeptide transport system permease protein OppC 1.27e-09 5.81e-09 NA NA
5. P P51000 Dipeptide transport system permease protein DppC 6.59e-07 4.18e-07 NA NA
5. P Q47539 Taurine transport system permease protein TauC 2.27e-09 6.68e-16 NA NA
5. P P0A2J4 Peptide transport system permease protein SapB 1.77e-09 2.09e-02 NA NA
5. P P45053 Oligopeptide transport system permease protein OppC 3.51e-08 2.21e-07 NA NA
5. P P10905 sn-glycerol-3-phosphate transport system permease protein UgpA 0.00e+00 1.01e-16 NA NA
5. P P9WFZ7 Putative peptide transport permease protein Rv1283c 9.13e-09 5.40e-03 NA NA
5. P P10906 sn-glycerol-3-phosphate transport system permease protein UgpE 1.12e-12 2.38e-13 NA NA
5. P P77716 Inner membrane ABC transporter permease protein YcjP 7.14e-14 1.31e-17 NA NA
5. P P45287 Peptide transport system permease protein SapC 2.41e-08 1.67e-07 NA NA
5. P Q8YDG7 Putative peptide transport system permease protein BMEII0209 4.38e-09 1.84e-03 NA NA
6. F P35118 Nopaline transport system permease protein NocQ 7.77e-16 NA NA 0.5786
6. F Q8X800 D-methionine transport system permease protein MetI 2.22e-15 NA NA 0.7639
6. F P35113 Nopaline transport system permease protein NocM 2.59e-10 NA NA 0.5801
6. F O34878 Glycine betaine/carnitine/choline transport system permease protein OpuCB 4.39e-14 NA NA 0.7218
6. F Q74RF9 Maltose/maltodextrin transport system permease protein MalF 2.79e-06 NA NA 0.6555
6. F Q8YJ03 Thiamine transport system permease protein ThiP 1.45e-09 NA NA 0.8225
6. F Q5PGP5 Glutathione transport system permease protein GsiC 4.47e-10 NA NA 0.6959
6. F P55661 Probable amino-acid ABC transporter permease protein y4tG 8.13e-09 NA NA 0.6489
6. F Q45461 Choline transport system permease protein OpuBB 9.88e-15 NA NA 0.765
6. F Q9KHT8 Carnitine transport permease protein OpuCB 2.44e-15 NA NA 0.7334
6. F Q9CK96 Probable D-methionine transport system permease protein MetI 2.66e-15 NA NA 0.7923
6. F D4GSY8 Probable anion ABC transporter permease protein HVO_1887 2.22e-16 NA NA 0.76
6. F P26467 Maltose/maltodextrin transport system permease protein MalF 1.60e-07 NA NA 0.6732
6. F P47651 Phosphate transport system permease protein PstA homolog 4.09e-07 NA NA 0.5772
6. F P39775 Choline transport system permease protein OpuBD 1.35e-14 NA NA 0.7762
6. F P54953 Probable amino-acid permease protein YxeN 6.33e-15 NA NA 0.7315
6. F Q8D3U8 Maltose/maltodextrin transport system permease protein MalF 1.02e-06 NA NA 0.6082
6. F Q8ZH39 D-methionine transport system permease protein MetI 2.66e-15 NA NA 0.767
6. F Q8RQL4 Glutamate transport system permease protein GluD 2.15e-07 NA NA 0.6582
6. F P18812 Maltose/maltodextrin transport system permease protein MalF 7.45e-07 NA NA 0.6553
6. F Q8Z1U2 Maltose/maltodextrin transport system permease protein MalF 2.94e-06 NA NA 0.6444
6. F P48244 Glutamate transport system permease protein GluC 7.71e-11 NA NA 0.6332
6. F P0A2I9 Histidine transport system permease protein HisQ 1.78e-15 NA NA 0.7186
6. F P72296 Octopine transport system permease protein OccM 2.10e-08 NA NA 0.6712
6. F Q8ZPK3 Osmoprotectant import permease protein OsmW 1.33e-15 NA NA 0.7927
6. F P52625 Probable amino-acid ABC transporter permease protein PatM 7.49e-11 NA NA 0.6616
6. F Q87GB7 Maltose/maltodextrin transport system permease protein MalF 1.24e-06 NA NA 0.6103
6. F P46492 Probable D-methionine transport system permease protein MetI 5.55e-16 NA NA 0.792
6. F Q8FYV0 Thiamine transport system permease protein ThiP 1.28e-09 NA NA 0.8182
6. F P72295 Octopine transport system permease protein OccQ 8.88e-16 NA NA 0.6556
6. F P0AFT3 L-cystine transport system permease protein TcyL 5.88e-11 NA NA 0.6657
6. F P0A4N6 Octopine transport system permease protein OccQ 7.77e-16 NA NA 0.6832
6. F P0AEU6 Histidine transport system permease protein HisM 4.87e-09 NA NA 0.6608
6. F Q7MFC2 Maltose/maltodextrin transport system permease protein MalF 1.05e-06 NA NA 0.6159
6. F G2JZ41 Carnitine transport permease protein OpuCD 1.11e-14 NA NA 0.7528
6. F Q44123 Ferric transport system permease protein FbpB 1.69e-09 NA NA 0.7636
6. F P0A2J0 Histidine transport system permease protein HisQ 1.89e-15 NA NA 0.7189
6. F Q8RQL5 Glutamate transport system permease protein GluC 8.15e-11 NA NA 0.6493
6. F Q08382 Molybdenum transport system permease protein ModB 0.00e+00 NA NA 0.8261
6. F P0AEU4 Histidine transport system permease protein HisM 5.13e-09 NA NA 0.66
6. F Q9KTJ6 Probable D-methionine transport system permease protein MetI 6.44e-15 NA NA 0.7597
6. F Q9KHT6 Carnitine transport permease protein OpuCD 9.33e-15 NA NA 0.754
6. F P42399 Probable amino-acid ABC transporter permease protein YckA 8.83e-09 NA NA 0.6077
6. F P0A2I8 Histidine transport system permease protein HisM 4.37e-09 NA NA 0.6302
6. F Q9KL06 Maltose/maltodextrin transport system permease protein MalF 9.49e-07 NA NA 0.6376
6. F Q57341 Putative ferric transport system permease protein FbpB 1 1.08e-09 NA NA 0.7428
6. F Q8ZRN0 D-methionine transport system permease protein MetI 2.66e-15 NA NA 0.7655
6. F P35114 Octopine transport system permease protein OccM 4.08e-10 NA NA 0.6704
6. F P48245 Glutamate transport system permease protein GluD 1.79e-07 NA NA 0.6681
6. F Q323W3 Glutathione transport system permease protein GsiC 7.04e-09 NA NA 0.692
6. F P54536 Arginine transport system permease protein ArtQ 1.49e-10 NA NA 0.7064
6. F P0AFT4 L-cystine transport system permease protein TcyL 5.59e-11 NA NA 0.6783
6. F P47323 Oligopeptide transport system permease protein OppB 3.42e-08 NA NA 0.6276
6. F O34671 Probable glutamine ABC transporter permease protein GlnM 1.03e-10 NA NA 0.6768
6. F Q8FB38 Maltose/maltodextrin transport system permease protein MalF 1.80e-07 NA NA 0.698
6. F P44985 Thiamine transport system permease protein ThiP 4.98e-09 NA NA 0.7546
6. F Q57BC3 Thiamine transport system permease protein ThiP 1.02e-09 NA NA 0.8203
6. F O34606 Probable glutamine ABC transporter permease protein GlnP 3.88e-10 NA NA 0.5566
6. F O34315 L-cystine transport system permease protein TcyL 3.29e-10 NA NA 0.6249
6. F Q8ZRV1 Thiamine transport system permease protein ThiP 3.83e-08 NA NA 0.8038
6. F Q4UKC4 Putative glutamine transport system permease protein GlnP 1.46e-10 NA NA 0.7036
6. F P0AE36 Arginine ABC transporter permease protein ArtQ 3.89e-15 NA NA 0.6208
6. F Q52813 General L-amino acid transport system permease protein AapQ 4.95e-06 NA NA 0.4369
6. F P0AE35 Arginine ABC transporter permease protein ArtQ 4.44e-15 NA NA 0.6265
6. F P45023 Probable amino-acid ABC transporter permease protein HI_0179 3.35e-14 NA NA 0.6665
6. F P0A2I7 Histidine transport system permease protein HisM 3.91e-09 NA NA 0.6479
6. F O34742 Glycine betaine/carnitine/choline transport system permease protein OpuCD 1.47e-14 NA NA 0.7199
6. F G2JZ43 Carnitine transport permease protein OpuCB 4.77e-15 NA NA 0.7185
6. F Q2YLW7 Thiamine transport system permease protein ThiP 1.52e-09 NA NA 0.7903
6. F P0AER4 Glutamate/aspartate import permease protein GltJ 1.58e-10 NA NA 0.6385
6. F Q1RHC0 Putative glutamine transport system permease protein GlnP 1.70e-10 NA NA 0.6839
6. F P45090 Arginine ABC transporter permease protein ArtQ 2.04e-14 NA NA 0.634
6. F P41083 Putative glutamine transport system permease protein GlnP 1.41e-10 NA NA 0.6656
6. F Q7N984 Maltose/maltodextrin transport system permease protein MalF 8.58e-07 NA NA 0.6464
6. F O32168 Methionine import system permease protein MetP 9.77e-15 NA NA 0.6911
6. F Q68XN8 Putative glutamine transport system permease protein GlnP 8.62e-09 NA NA 0.7073
6. F P0A4N5 Octopine transport system permease protein OccQ 9.99e-16 NA NA 0.7072
6. F P21409 Fe(3+)-transport system permease protein SfuB 9.34e-09 NA NA 0.8005
6. F Q8Z991 D-methionine transport system permease protein MetI 3.55e-15 NA NA 0.7846
6. F Q92J96 Putative glutamine transport system permease protein GlnP 1.16e-08 NA NA 0.7034
6. F P0AEU5 Histidine transport system permease protein HisM 1.74e-10 NA NA 0.6592
6. F P75554 Oligopeptide transport system permease protein OppB 4.12e-08 NA NA 0.6029
6. F P55452 Probable ABC transporter permease protein y4fN 1.85e-08 NA NA 0.7455
7. B P0AF01 Molybdenum transport system permease protein ModB 0.00e+00 NA 0.023 NA