Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54660.1

JCVISYN3A_0202

16S rRNA (guanine(966)-N(2))-methyltransferase.
M. mycoides homolog: Q6MU24.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 138
Unique PROST Go: 47
Unique BLAST Go: 1
Unique Foldseek Go: 69

Total Homologs: 1413
Unique PROST Homologs: 430
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 972

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rsmD; 16S rRNA (guanine(966)-N(2))-methyltransferase
Zhang et al. [4]: GO:0052913|16S rRNA (guanine(966)-N(2))-m ethyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O34331 (Putative rRNA methyltransferase YlbH) with a FATCAT P-Value: 0 and RMSD of 2.27 angstrom. The sequence alignment identity is 31.3%.
Structural alignment shown in left. Query protein AVX54660.1 colored as red in alignment, homolog O34331 colored as blue. Query protein AVX54660.1 is also shown in right top, homolog O34331 showed in right bottom. They are colored based on secondary structures.

  AVX54660.1 MHIISGKYKKMKLQTLDSSITRPTLTRIKEDMFNIISNYFIFENKTSLDLFGGSGSLSIEGLSRGIKFAIINDLNKDANKI--ISFNLKKIP-TSDYVLY 97
      O34331 MRVISGSKKGRSLKAVAGTSTRPTTDKVKESIFNMIGPY--FDGGRGLDLFAGSGGLGIEALSRGFEHCIFVD--RDFKAIQTVKSNLKTLELTKHAQVY 96

  AVX54660.1 QKDYLELLNLLKIQH--QKVDL----VYLDPPFKE--IDYYYVVFDFLINNNLLNDWAIIISETNQKLDL--TKIKDLNLLKFKD-YNKKYLYIFRLEK- 185
      O34331 RND-AE--RAL---HAAAKRETGFRGIFLDPPYKEQKLKALLTLID---EYQMLEEDGFIVAEHDREVELPET-VGDL-VMTRKETYGLTGVAIYK--KR 183

  AVX54660.1 - 185
      O34331 G 184

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0052913	16S rRNA (guanine(966)-N(2))-methyltransferase activity
1. PBF	GO:0008168	methyltransferase activity
1. PBF	GO:0031167	rRNA methylation
2. PF	GO:0006479	protein methylation
2. PF	GO:0008276	protein methyltransferase activity
2. PF	GO:0000179	rRNA (adenine-N6,N6-)-dimethyltransferase activity
2. PF	GO:0005737	cytoplasm
2. PF	GO:0036009	protein-glutamine N-methyltransferase activity
2. PF	GO:0070043	rRNA (guanine-N7-)-methyltransferase activity
2. PF	GO:0102559	protein-(glutamine-N5) methyltransferase activity
2. PF	GO:0008173	RNA methyltransferase activity
2. PF	GO:0032259	methylation
2. PF	GO:0018364	peptidyl-glutamine methylation
3. BF	GO:0070475	rRNA base methylation
4. PB	GO:1904047	S-adenosyl-L-methionine binding
4. PB	GO:0098794	postsynapse
4. PB	GO:0042995	cell projection
4. PB	GO:0008988	rRNA (adenine-N6-)-methyltransferase activity
4. PB	GO:0003676	nucleic acid binding
4. PB	GO:0098793	presynapse
4. PB	GO:0048863	stem cell differentiation
5. P	GO:0018023	peptidyl-lysine trimethylation
5. P	GO:0032780	negative regulation of ATP-dependent activity
5. P	GO:0030488	tRNA methylation
5. P	GO:0018024	histone-lysine N-methyltransferase activity
5. P	GO:0008112	nicotinamide N-methyltransferase activity
5. P	GO:0043776	cobalt-precorrin-6B C5-methyltransferase activity
5. P	GO:0006480	N-terminal protein amino acid methylation
5. P	GO:0008650	rRNA (uridine-2'-O-)-methyltransferase activity
5. P	GO:0071164	RNA trimethylguanosine synthase activity
5. P	GO:0018013	N-terminal peptidyl-glycine methylation
5. P	GO:0030792	methylarsonite methyltransferase activity
5. P	GO:0030494	bacteriochlorophyll biosynthetic process
5. P	GO:0036265	RNA (guanine-N7)-methylation
5. P	GO:0036308	16S rRNA (guanine(1516)-N(2))-methyltransferase activity
5. P	GO:0030307	positive regulation of cell growth
5. P	GO:0010038	response to metal ion
5. P	GO:0008990	rRNA (guanine-N2-)-methyltransferase activity
5. P	GO:0006769	nicotinamide metabolic process
5. P	GO:0009452	7-methylguanosine RNA capping
5. P	GO:0016300	tRNA (uracil) methyltransferase activity
5. P	GO:0009312	oligosaccharide biosynthetic process
5. P	GO:0046406	magnesium protoporphyrin IX methyltransferase activity
5. P	GO:0016279	protein-lysine N-methyltransferase activity
5. P	GO:0046690	response to tellurium ion
5. P	GO:0008171	O-methyltransferase activity
5. P	GO:0018022	peptidyl-lysine methylation
5. P	GO:0035657	eRF1 methyltransferase complex
5. P	GO:0008989	rRNA (guanine-N1-)-methyltransferase activity
5. P	GO:0009236	cobalamin biosynthetic process
5. P	GO:0036261	7-methylguanosine cap hypermethylation
5. P	GO:0008119	thiopurine S-methyltransferase activity
5. P	GO:0043527	tRNA methyltransferase complex
5. P	GO:0071891	N-terminal peptidyl-proline dimethylation involved in translation
5. P	GO:0018872	arsonoacetate metabolic process
5. P	GO:0030544	Hsp70 protein binding
5. P	GO:0051117	ATPase binding
5. P	GO:0018027	peptidyl-lysine dimethylation
5. P	GO:0034968	histone lysine methylation
5. P	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
5. P	GO:0009404	toxin metabolic process
5. P	GO:0001510	RNA methylation
5. P	GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity
5. P	GO:0032775	DNA methylation on adenine
5. P	GO:0046140	corrin biosynthetic process
5. P	GO:0071885	N-terminal protein N-methyltransferase activity
5. P	GO:0032991	protein-containing complex
5. P	GO:0008176	tRNA (guanine-N7-)-methyltransferase activity
6. F	GO:0003677	DNA binding
6. F	GO:0003723	RNA binding
6. F	GO:0045653	negative regulation of megakaryocyte differentiation
6. F	GO:0006744	ubiquinone biosynthetic process
6. F	GO:0008175	tRNA methyltransferase activity
6. F	GO:0030794	(S)-coclaurine-N-methyltransferase activity
6. F	GO:0052729	dimethylglycine N-methyltransferase activity
6. F	GO:1904736	negative regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase
6. F	GO:0035246	peptidyl-arginine N-methylation
6. F	GO:0071768	mycolic acid biosynthetic process
6. F	GO:0006338	chromatin remodeling
6. F	GO:0042054	histone methyltransferase activity
6. F	GO:0019702	protein-arginine N5-methyltransferase activity
6. F	GO:0005759	mitochondrial matrix
6. F	GO:0008689	3-demethylubiquinone-9 3-O-methyltransferase activity
6. F	GO:0003838	sterol 24-C-methyltransferase activity
6. F	GO:0006696	ergosterol biosynthetic process
6. F	GO:0019843	rRNA binding
6. F	GO:0008170	N-methyltransferase activity
6. F	GO:0052730	sarcosine N-methyltransferase activity
6. F	GO:0030697	S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity
6. F	GO:0019286	glycine betaine biosynthetic process from glycine
6. F	GO:0000154	rRNA modification
6. F	GO:0004719	protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
6. F	GO:0071424	rRNA (cytosine-N4-)-methyltransferase activity
6. F	GO:0016126	sterol biosynthetic process
6. F	GO:0051539	4 iron, 4 sulfur cluster binding
6. F	GO:0070611	histone methyltransferase activity (H3-R2 specific)
6. F	GO:0034969	histone arginine methylation
6. F	GO:0016571	histone methylation
6. F	GO:0030091	protein repair
6. F	GO:0070612	histone methyltransferase activity (H2A-R3 specific)
6. F	GO:0006396	RNA processing
6. F	GO:0016021	integral component of membrane
6. F	GO:0006694	steroid biosynthetic process
6. F	GO:0007552	metamorphosis
6. F	GO:0002098	tRNA wobble uridine modification
6. F	GO:0052915	23S rRNA (guanine(2445)-N(2))-methyltransferase activity
6. F	GO:0018216	peptidyl-arginine methylation
6. F	GO:0044020	histone methyltransferase activity (H4-R3 specific)
6. F	GO:0045652	regulation of megakaryocyte differentiation
6. F	GO:0043985	histone H4-R3 methylation
6. F	GO:0102082	demethylrebeccamycin--D-glucose O-methyltransferase activity
6. F	GO:0008610	lipid biosynthetic process
6. F	GO:0036307	23S rRNA (adenine(2030)-N(6))-methyltransferase activity
6. F	GO:0102208	2-polyprenyl-6-hydroxyphenol methylase activity
6. F	GO:1904733	negative regulation of electron transfer activity
6. F	GO:0052906	tRNA (guanine(37)-N(1))-methyltransferase activity
6. F	GO:0005576	extracellular region
6. F	GO:0016434	rRNA (cytosine) methyltransferase activity
6. F	GO:0005506	iron ion binding
6. F	GO:0008425	2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
6. F	GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine
6. F	GO:0016430	tRNA (adenine-N6-)-methyltransferase activity
6. F	GO:0120142	positive regulation of ecdysone receptor-mediated signaling pathway
6. F	GO:0048738	cardiac muscle tissue development
6. F	GO:0035241	protein-arginine omega-N monomethyltransferase activity
6. F	GO:0016765	transferase activity, transferring alkyl or aryl (other than methyl) groups
6. F	GO:0009019	tRNA (guanine-N1-)-methyltransferase activity
6. F	GO:0035097	histone methyltransferase complex
6. F	GO:1901012	(S)-reticuline biosynthetic process
6. F	GO:0052908	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity
6. F	GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity
6. F	GO:0002939	tRNA N1-guanine methylation
6. F	GO:0031056	regulation of histone modification
6. F	GO:0008825	cyclopropane-fatty-acyl-phospholipid synthase activity
6. F	GO:0070041	rRNA (uridine-C5-)-methyltransferase activity
6. F	GO:0016274	protein-arginine N-methyltransferase activity
6. F	GO:0034970	histone H3-R2 methylation
7. B	GO:0045727	positive regulation of translation

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0043412	macromolecule modification
GO:0006807	nitrogen compound metabolic process
GO:0008168	methyltransferase activity
GO:0003676	nucleic acid binding
GO:0044238	primary metabolic process
GO:0044260	cellular macromolecule metabolic process
GO:0032259	methylation
GO:0031167	rRNA methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	O34331	Putative rRNA methyltransferase YlbH	0.00e+00	7.89e-62	1.04e-21	0.8946
1. PBF	P0ADY0	Ribosomal RNA small subunit methyltransferase D	7.77e-16	3.24e-42	3.29e-14	0.8426
1. PBF	Q9ZD05	Uncharacterized methylase RP545	4.33e-15	4.22e-35	2.49e-15	0.8438
1. PBF	P44869	Ribosomal RNA small subunit methyltransferase D	2.22e-16	5.08e-43	2.18e-15	0.8316
1. PBF	Q89B29	Ribosomal RNA small subunit methyltransferase D	3.33e-16	6.32e-51	1.16e-13	0.8577
1. PBF	P57136	Ribosomal RNA small subunit methyltransferase D	3.33e-16	7.19e-50	4.29e-11	0.873
2. PF	P55136	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Fragment)	2.81e-09	5.53e-04	NA	0.7157
4. PB	P0ADX9	Ribosomal RNA small subunit methyltransferase D	7.77e-16	3.24e-42	3.29e-14	NA
4. PB	Q9NRN9	rRNA N6-adenosine-methyltransferase METTL5	3.75e-07	5.36e-10	4.66e-04	NA
4. PB	Q8K1A0	rRNA N6-adenosine-methyltransferase METTL5	4.25e-07	8.05e-09	1.56e-04	NA
5. P	C3MTW8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.13e-10	5.59e-04	NA	NA
5. P	B0KS71	Ribosomal RNA small subunit methyltransferase J	2.34e-05	4.48e-03	NA	NA
5. P	Q09814	Trimethylguanosine synthase	1.72e-08	2.74e-08	NA	NA
5. P	Q1C1A9	Ribosomal RNA small subunit methyltransferase J	3.82e-04	6.23e-04	NA	NA
5. P	Q5BLD8	Protein N-lysine methyltransferase METTL21A	5.70e-09	3.89e-03	NA	NA
5. P	Q9HXW0	Ribosomal RNA small subunit methyltransferase J	2.03e-04	5.20e-03	NA	NA
5. P	B2S360	tRNA (guanine-N(7)-)-methyltransferase	3.84e-05	4.98e-02	NA	NA
5. P	B4U1E2	tRNA (guanine-N(7)-)-methyltransferase	1.60e-05	4.12e-02	NA	NA
5. P	B2K6K6	Ribosomal RNA small subunit methyltransferase J	3.69e-04	6.23e-04	NA	NA
5. P	Q1G997	tRNA (guanine-N(7)-)-methyltransferase	7.29e-06	3.87e-02	NA	NA
5. P	Q55467	Magnesium-protoporphyrin O-methyltransferase	6.65e-11	4.78e-03	NA	NA
5. P	A8G2P9	tRNA (guanine-N(7)-)-methyltransferase	6.88e-05	1.83e-02	NA	NA
5. P	Q9UT28	Protein N-terminal and lysine N-methyltransferase efm7	5.96e-09	3.08e-02	NA	NA
5. P	A5W873	Ribosomal RNA small subunit methyltransferase J	2.20e-05	2.48e-03	NA	NA
5. P	B8ZTI4	tRNA (guanine-N(7)-)-methyltransferase	1.46e-04	1.18e-02	NA	NA
5. P	A1SYH7	Ribosomal RNA small subunit methyltransferase J	2.82e-04	1.54e-03	NA	NA
5. P	A7N9Y1	Ribosomal RNA small subunit methyltransferase J	2.75e-08	3.37e-04	NA	NA
5. P	Q3BCR1	Thiopurine S-methyltransferase	6.10e-07	4.73e-02	NA	NA
5. P	A9KV34	Ribosomal RNA small subunit methyltransferase J	2.82e-05	3.86e-05	NA	NA
5. P	C3NJQ5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.88e-10	5.75e-04	NA	NA
5. P	Q2IYG1	Ribosomal RNA small subunit methyltransferase J	1.60e-05	5.08e-09	NA	NA
5. P	Q47IZ2	Ribosomal RNA small subunit methyltransferase J	1.29e-04	1.65e-04	NA	NA
5. P	Q7MQD7	Ribosomal RNA small subunit methyltransferase J	2.80e-05	2.49e-04	NA	NA
5. P	Q7P0V2	Ribosomal RNA small subunit methyltransferase J	2.43e-05	3.40e-04	NA	NA
5. P	A7FRB3	tRNA (guanine-N(7)-)-methyltransferase	8.54e-06	3.17e-03	NA	NA
5. P	Q57732	Uncharacterized protein MJ0284	8.30e-09	1.01e-08	NA	NA
5. P	A5ICZ5	Ribosomal RNA small subunit methyltransferase J	5.78e-06	9.66e-05	NA	NA
5. P	A6TFB5	Ribosomal RNA small subunit methyltransferase J	2.74e-04	1.48e-03	NA	NA
5. P	O32036	tRNA 5-hydroxyuridine methyltransferase	2.00e-09	1.83e-02	NA	NA
5. P	Q8K904	Ribosomal RNA small subunit methyltransferase J	7.30e-05	8.19e-05	NA	NA
5. P	Q8F9Q1	tRNA (guanine-N(7)-)-methyltransferase	8.34e-06	1.08e-02	NA	NA
5. P	A7MVH9	Thiopurine S-methyltransferase	2.72e-07	1.43e-02	NA	NA
5. P	A1RQ25	Ribosomal RNA small subunit methyltransferase J	4.61e-05	5.10e-03	NA	NA
5. P	A9A3M9	Ribosomal RNA large subunit methyltransferase E	6.34e-08	2.93e-02	NA	NA
5. P	Q5ZRP5	Thiopurine S-methyltransferase	2.27e-07	6.41e-04	NA	NA
5. P	Q7WM36	Thiopurine S-methyltransferase	2.08e-07	5.06e-03	NA	NA
5. P	C6C068	Ribosomal RNA large subunit methyltransferase E	1.90e-07	5.15e-03	NA	NA
5. P	Q5WVL3	Ribosomal RNA small subunit methyltransferase J	5.74e-06	1.20e-04	NA	NA
5. P	Q0SNJ8	Ribosomal RNA large subunit methyltransferase E	8.10e-05	7.32e-03	NA	NA
5. P	Q8PLQ8	Ribosomal RNA large subunit methyltransferase E	3.62e-08	3.14e-02	NA	NA
5. P	P61820	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.63e-09	2.37e-04	NA	NA
5. P	Q07758	Nodulation protein S	3.12e-08	2.45e-03	NA	NA
5. P	C3K732	Thiopurine S-methyltransferase	2.03e-07	4.87e-03	NA	NA
5. P	Q8YVX4	tRNA (guanine-N(7)-)-methyltransferase	5.01e-05	4.81e-02	NA	NA
5. P	Q15Z03	Ribosomal RNA small subunit methyltransferase J	1.09e-05	3.50e-04	NA	NA
5. P	P75967	Uncharacterized protein YmfD	2.34e-05	3.84e-02	NA	NA
5. P	B0JUK5	tRNA (guanine-N(7)-)-methyltransferase	7.07e-05	2.97e-03	NA	NA
5. P	Q4QM52	Ribosomal RNA small subunit methyltransferase J	1.01e-03	3.48e-03	NA	NA
5. P	A5UHZ6	Ribosomal RNA small subunit methyltransferase J	8.21e-04	2.67e-03	NA	NA
5. P	B5RRD2	Ribosomal RNA large subunit methyltransferase E	1.24e-04	9.76e-04	NA	NA
5. P	Q2GGT6	Ribosomal RNA large subunit methyltransferase E	4.09e-08	4.12e-02	NA	NA
5. P	B4TYZ1	Ribosomal RNA small subunit methyltransferase J	3.20e-04	9.48e-04	NA	NA
5. P	A9I3K3	Thiopurine S-methyltransferase	1.78e-07	6.73e-04	NA	NA
5. P	B0U1F2	Ribosomal RNA large subunit methyltransferase E	1.65e-07	2.85e-02	NA	NA
5. P	B8GG79	Ribosomal RNA large subunit methyltransferase E	1.76e-05	4.30e-02	NA	NA
5. P	Q18511	rRNA N6-adenosine-methyltransferase metl-5	4.83e-07	1.29e-05	NA	NA
5. P	Q48F42	Ribosomal RNA small subunit methyltransferase J	1.56e-04	1.99e-03	NA	NA
5. P	O51293	Ribosomal RNA large subunit methyltransferase E	8.08e-05	3.20e-03	NA	NA
5. P	A1RFQ1	Thiopurine S-methyltransferase	1.97e-07	4.04e-03	NA	NA
5. P	P72546	tRNA (guanine-N(7)-)-methyltransferase	4.78e-05	4.87e-03	NA	NA
5. P	B1J0D5	Ribosomal RNA small subunit methyltransferase J	2.95e-04	1.31e-03	NA	NA
5. P	F0NBH8	Protein-lysine N-methyltransferase	7.97e-10	1.66e-02	NA	NA
5. P	A4VN38	Ribosomal RNA small subunit methyltransferase J	1.62e-04	1.52e-03	NA	NA
5. P	C3L0Q0	tRNA (guanine-N(7)-)-methyltransferase	8.29e-06	1.76e-03	NA	NA
5. P	Q8TI93	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.34e-10	2.56e-05	NA	NA
5. P	B3PLF9	Ribosomal RNA small subunit methyltransferase J	2.69e-04	1.41e-02	NA	NA
5. P	P68567	Ribosomal RNA small subunit methyltransferase J	3.07e-04	1.31e-03	NA	NA
5. P	A3QI29	Thiopurine S-methyltransferase	2.85e-07	3.61e-04	NA	NA
5. P	Q4WYS7	Protein N-terminal and lysine N-methyltransferase efm7	1.90e-08	3.97e-03	NA	NA
5. P	Q8P9Y1	Ribosomal RNA large subunit methyltransferase E	3.57e-08	3.64e-02	NA	NA
5. P	Q134B7	Ribosomal RNA small subunit methyltransferase J	1.09e-04	1.60e-08	NA	NA
5. P	Q32AW6	Ribosomal RNA small subunit methyltransferase J	3.99e-04	1.10e-03	NA	NA
5. P	Q92B94	tRNA (guanine-N(7)-)-methyltransferase	1.64e-05	9.63e-03	NA	NA
5. P	Q6N453	Ribosomal RNA small subunit methyltransferase J	8.88e-05	8.41e-10	NA	NA
5. P	C4KJM8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.69e-10	5.59e-04	NA	NA
5. P	Q48AK7	Ribosomal RNA small subunit methyltransferase J	9.40e-04	5.64e-04	NA	NA
5. P	B7VPF3	Thiopurine S-methyltransferase	3.40e-07	1.47e-03	NA	NA
5. P	A6VLG0	Ribosomal RNA small subunit methyltransferase J	9.56e-04	1.58e-02	NA	NA
5. P	C6DJB2	Ribosomal RNA small subunit methyltransferase J	3.01e-04	1.74e-03	NA	NA
5. P	B5FKL3	Ribosomal RNA small subunit methyltransferase J	2.87e-04	6.16e-04	NA	NA
5. P	A4IGU3	Protein N-lysine methyltransferase METTL21A	6.41e-09	2.70e-04	NA	NA
5. P	Q2A5B9	Ribosomal RNA small subunit methyltransferase J	3.04e-08	3.37e-04	NA	NA
5. P	B7GIU6	Uncharacterized methyltransferase Aflv_0758	2.01e-07	3.68e-03	NA	NA
5. P	A1U560	Thiopurine S-methyltransferase	5.51e-07	1.14e-04	NA	NA
5. P	Q6DB47	Ribosomal RNA small subunit methyltransferase J	3.00e-04	1.29e-03	NA	NA
5. P	A6UYJ1	tRNA (guanine-N(7)-)-methyltransferase	1.47e-05	3.20e-02	NA	NA
5. P	Q3K932	Thiopurine S-methyltransferase	2.51e-07	4.45e-04	NA	NA
5. P	B1JBT2	Ribosomal RNA small subunit methyltransferase J	2.23e-05	5.87e-03	NA	NA
5. P	Q8Z5M9	Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	6.31e-09	6.32e-05	NA	NA
5. P	Q7W8H4	Thiopurine S-methyltransferase	1.55e-07	5.06e-03	NA	NA
5. P	P57646	Ribosomal RNA small subunit methyltransferase J	3.05e-05	4.07e-05	NA	NA
5. P	Q8PAT3	Thiopurine S-methyltransferase	2.10e-07	1.95e-02	NA	NA
5. P	A1S2Z7	Thiopurine S-methyltransferase	6.58e-07	1.04e-02	NA	NA
5. P	Q8PY64	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.12e-11	2.41e-06	NA	NA
5. P	B1X7V2	Ribosomal RNA small subunit methyltransferase J	2.89e-04	1.31e-03	NA	NA
5. P	B8ECC0	Thiopurine S-methyltransferase	1.27e-07	6.49e-03	NA	NA
5. P	A5TZU0	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	1.87e-06	2.02e-02	NA	NA
5. P	Q97A64	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.25e-09	1.08e-02	NA	NA
5. P	F1QVR8	rRNA N6-adenosine-methyltransferase METTL5	1.01e-09	7.72e-08	NA	NA
5. P	Q7V350	tRNA (guanine-N(7)-)-methyltransferase	6.94e-05	5.25e-03	NA	NA
5. P	Q1Q8I2	Thiopurine S-methyltransferase	4.54e-07	1.08e-02	NA	NA
5. P	Q3BVI6	Thiopurine S-methyltransferase	2.09e-07	7.95e-04	NA	NA
5. P	A9AA91	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.57e-09	1.52e-04	NA	NA
5. P	A0Q3W9	Thiopurine S-methyltransferase	5.22e-06	1.49e-02	NA	NA
5. P	P73161	tRNA (guanine-N(7)-)-methyltransferase	1.11e-04	1.88e-04	NA	NA
5. P	B5RGT3	Ribosomal RNA small subunit methyltransferase J	3.27e-04	6.16e-04	NA	NA
5. P	Q04XB2	tRNA (guanine-N(7)-)-methyltransferase	8.32e-06	1.24e-03	NA	NA
5. P	B7V2T3	Ribosomal RNA small subunit methyltransferase J	2.01e-04	8.40e-03	NA	NA
5. P	Q93JT2	Thiopurine S-methyltransferase	3.97e-07	3.33e-04	NA	NA
5. P	Q5WSX9	Thiopurine S-methyltransferase	2.11e-07	6.87e-04	NA	NA
5. P	Q3JC80	Ribosomal RNA small subunit methyltransferase J	1.83e-04	1.26e-02	NA	NA
5. P	B4SWD9	Ribosomal RNA small subunit methyltransferase J	4.13e-04	6.16e-04	NA	NA
5. P	Q3IIA6	Ribosomal RNA small subunit methyltransferase J	2.11e-05	4.45e-04	NA	NA
5. P	Q5A013	Protein N-terminal and lysine N-methyltransferase EFM7	7.78e-09	1.56e-02	NA	NA
5. P	A8H029	Thiopurine S-methyltransferase	2.77e-07	6.67e-04	NA	NA
5. P	Q5F7B7	Ribosomal RNA small subunit methyltransferase J	1.08e-04	7.60e-07	NA	NA
5. P	A4VRK4	tRNA (guanine-N(7)-)-methyltransferase	1.24e-05	1.02e-02	NA	NA
5. P	A0KSQ0	Thiopurine S-methyltransferase	2.02e-07	5.10e-03	NA	NA
5. P	Q8EJ86	Thiopurine S-methyltransferase	2.09e-07	3.61e-02	NA	NA
5. P	B5ENR5	Ribosomal RNA large subunit methyltransferase E	8.22e-08	2.41e-02	NA	NA
5. P	Q3BUR8	Ribosomal RNA large subunit methyltransferase E	3.63e-08	3.14e-02	NA	NA
5. P	Q3YW34	Ribosomal RNA small subunit methyltransferase J	2.96e-04	1.11e-03	NA	NA
5. P	Q9I6B3	tRNA (guanine-N(7)-)-methyltransferase	1.44e-05	3.94e-02	NA	NA
5. P	A5UJR5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.93e-10	6.94e-05	NA	NA
5. P	B1MCE2	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	1.02e-07	9.90e-03	NA	NA
5. P	A9FQE4	Ribosomal RNA large subunit methyltransferase E	1.30e-05	1.81e-03	NA	NA
5. P	B8ECV6	Ribosomal RNA small subunit methyltransferase J	2.82e-05	3.00e-05	NA	NA
5. P	Q5QV55	Ribosomal RNA small subunit methyltransferase J	1.51e-03	1.61e-04	NA	NA
5. P	Q9X6G2	Ribosomal RNA small subunit methyltransferase J	3.07e-04	6.67e-04	NA	NA
5. P	A6VGG1	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.64e-09	6.35e-04	NA	NA
5. P	A6WXR2	Ribosomal RNA small subunit methyltransferase J	9.18e-06	2.63e-11	NA	NA
5. P	C4LD58	Ribosomal RNA small subunit methyltransferase J	2.18e-05	5.32e-04	NA	NA
5. P	Q87F66	Ribosomal RNA large subunit methyltransferase E	5.29e-08	1.24e-02	NA	NA
5. P	O28490	Putative protein N5-glutamine methyltransferase AF_1784	7.32e-09	2.10e-04	NA	NA
5. P	Q5RE14	Protein N-lysine methyltransferase METTL21A	2.27e-08	4.69e-02	NA	NA
5. P	A0KEG6	Ribosomal RNA small subunit methyltransferase J	3.03e-05	8.90e-05	NA	NA
5. P	O27801	Ribosomal RNA large subunit methyltransferase E	3.35e-05	4.12e-02	NA	NA
5. P	B6EGR4	Ribosomal RNA small subunit methyltransferase J	2.03e-05	7.62e-05	NA	NA
5. P	A1SBL0	Ribosomal RNA small subunit methyltransferase J	3.12e-05	2.09e-05	NA	NA
5. P	Q57836	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.78e-10	2.27e-06	NA	NA
5. P	P19441	Nodulation protein S	1.76e-08	1.28e-03	NA	NA
5. P	Q86A24	Protein-lysine N-methyltransferase DDB_G0272708	1.57e-02	2.07e-03	NA	NA
5. P	A1KG37	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	6.99e-06	2.02e-02	NA	NA
5. P	B2SUB8	Ribosomal RNA large subunit methyltransferase E	1.37e-07	2.90e-02	NA	NA
5. P	A3N3G7	Ribosomal RNA small subunit methyltransferase J	7.19e-04	1.84e-04	NA	NA
5. P	A1KV29	Ribosomal RNA small subunit methyltransferase J	1.07e-04	1.66e-06	NA	NA
5. P	Q6MN40	Ribosomal RNA large subunit methyltransferase E	4.91e-05	2.33e-02	NA	NA
5. P	A0R2D5	Putative O-methyltransferase MSMEG_5073/MSMEI_4947	1.23e-08	2.50e-02	NA	NA
5. P	Q73IS9	Ribosomal RNA large subunit methyltransferase E	2.25e-08	2.07e-02	NA	NA
5. P	Q5X479	Ribosomal RNA small subunit methyltransferase J	6.51e-06	4.67e-05	NA	NA
5. P	Q1CDI1	Ribosomal RNA small subunit methyltransferase J	3.71e-04	6.23e-04	NA	NA
5. P	A4XZZ7	tRNA (guanine-N(7)-)-methyltransferase	9.77e-05	2.33e-02	NA	NA
5. P	Q0TBW6	Ribosomal RNA small subunit methyltransferase J	3.89e-04	1.12e-03	NA	NA
5. P	B0TN76	Ribosomal RNA small subunit methyltransferase J	5.90e-05	9.96e-05	NA	NA
5. P	Q8E8K6	Ribosomal RNA small subunit methyltransferase J	3.30e-05	1.65e-04	NA	NA
5. P	Q07LH9	Ribosomal RNA large subunit methyltransferase E	1.23e-07	1.64e-02	NA	NA
5. P	O83687	Ribosomal RNA large subunit methyltransferase E	3.63e-07	3.55e-02	NA	NA
5. P	A6WU68	Ribosomal RNA small subunit methyltransferase J	3.00e-05	3.63e-05	NA	NA
5. P	P05409	Probable tRNA (guanine(10)-N2)-dimethyltransferase (Fragment)	7.96e-12	7.05e-03	NA	NA
5. P	B8GQ90	Ribosomal RNA small subunit methyltransferase J	1.77e-04	9.30e-04	NA	NA
5. P	O13748	Alpha N-terminal protein methyltransferase 1	2.34e-09	2.81e-04	NA	NA
5. P	Q2JJQ0	tRNA (guanine-N(7)-)-methyltransferase	8.18e-05	3.37e-02	NA	NA
5. P	A9MLL7	Ribosomal RNA small subunit methyltransferase J	3.88e-04	7.43e-04	NA	NA
5. P	A4TQY1	Ribosomal RNA small subunit methyltransferase J	5.95e-05	6.23e-04	NA	NA
5. P	A7ZT33	Ribosomal RNA small subunit methyltransferase J	4.08e-04	1.11e-03	NA	NA
5. P	Q9HPN4	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.47e-09	8.19e-04	NA	NA
5. P	Q07XD8	Thiopurine S-methyltransferase	2.01e-07	5.30e-03	NA	NA
5. P	Q97C13	Ribosomal RNA large subunit methyltransferase E	2.46e-07	6.14e-03	NA	NA
5. P	A7FP06	Ribosomal RNA small subunit methyltransferase J	3.82e-04	6.23e-04	NA	NA
5. P	Q31CU2	tRNA (guanine-N(7)-)-methyltransferase	1.04e-04	1.43e-04	NA	NA
5. P	Q5NEH3	Thiopurine S-methyltransferase	5.04e-06	2.24e-02	NA	NA
5. P	B2VHE7	Ribosomal RNA small subunit methyltransferase J	3.09e-04	3.55e-05	NA	NA
5. P	Q87TJ6	Ribosomal RNA small subunit methyltransferase J	2.32e-04	1.31e-04	NA	NA
5. P	B4T8C7	Ribosomal RNA small subunit methyltransferase J	3.24e-04	5.11e-04	NA	NA
5. P	A8AR83	Ribosomal RNA small subunit methyltransferase J	2.91e-04	8.35e-04	NA	NA
5. P	P59718	tRNA (guanine-N(7)-)-methyltransferase	2.50e-05	3.87e-02	NA	NA
5. P	A4XVB5	Thiopurine S-methyltransferase	2.24e-07	2.11e-03	NA	NA
5. P	A8G0J1	Thiopurine S-methyltransferase	4.75e-07	1.42e-02	NA	NA
5. P	P9WKL4	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	2.20e-06	2.02e-02	NA	NA
5. P	Q9PL91	tRNA (guanine-N(7)-)-methyltransferase	7.08e-05	3.87e-02	NA	NA
5. P	Q5E4N9	Thiopurine S-methyltransferase	2.75e-07	6.55e-03	NA	NA
5. P	Q8D2X0	Ribosomal RNA large subunit methyltransferase E	1.74e-06	1.32e-02	NA	NA
5. P	B2I696	Ribosomal RNA large subunit methyltransferase E	5.45e-08	1.24e-02	NA	NA
5. P	C3MJI5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.62e-10	5.59e-04	NA	NA
5. P	Q2SL17	Ribosomal RNA small subunit methyltransferase J	7.11e-04	4.53e-02	NA	NA
5. P	B4RIY4	Ribosomal RNA small subunit methyltransferase J	8.91e-05	9.88e-07	NA	NA
5. P	Q5F929	tRNA (guanine-N(7)-)-methyltransferase	1.21e-05	3.25e-02	NA	NA
5. P	P26026	Nodulation protein S	1.89e-09	5.00e-06	NA	NA
5. P	A9MU21	Ribosomal RNA small subunit methyltransferase J	3.04e-04	5.93e-04	NA	NA
5. P	P72077	Ribosomal RNA small subunit methyltransferase J	8.62e-05	7.60e-07	NA	NA
5. P	Q5GYL7	Ribosomal RNA large subunit methyltransferase E	1.37e-07	2.90e-02	NA	NA
5. P	B5RLD9	Ribosomal RNA large subunit methyltransferase E	1.21e-04	9.76e-04	NA	NA
5. P	A3D007	Thiopurine S-methyltransferase	1.43e-07	1.70e-02	NA	NA
5. P	P44901	Ribosomal RNA small subunit methyltransferase J	7.54e-04	5.01e-03	NA	NA
5. P	B8DHC7	tRNA (guanine-N(7)-)-methyltransferase	1.14e-05	4.53e-02	NA	NA
5. P	C1FSH8	tRNA (guanine-N(7)-)-methyltransferase	9.39e-06	3.17e-03	NA	NA
5. P	A0Q2J7	tRNA (guanine-N(7)-)-methyltransferase	2.80e-06	2.85e-02	NA	NA
5. P	Q9JTE9	Ribosomal RNA small subunit methyltransferase J	1.04e-04	3.02e-07	NA	NA
5. P	Q1ID19	Thiopurine S-methyltransferase	9.38e-08	2.27e-03	NA	NA
5. P	Q14GA7	Ribosomal RNA small subunit methyltransferase J	1.78e-08	3.37e-04	NA	NA
5. P	A7IQW5	Protein-lysine methyltransferase C42C1.13	3.61e-08	2.49e-06	NA	NA
5. P	B3QEZ3	Ribosomal RNA small subunit methyltransferase J	9.37e-06	1.05e-09	NA	NA
5. P	A5EWT6	Ribosomal RNA small subunit methyltransferase J	1.01e-04	1.44e-06	NA	NA
5. P	B1KLA4	Ribosomal RNA small subunit methyltransferase J	7.72e-05	4.16e-03	NA	NA
5. P	Q9H867	Protein N-lysine methyltransferase METTL21D	2.97e-07	1.16e-02	NA	NA
5. P	Q897E6	tRNA (guanine-N(7)-)-methyltransferase	2.75e-06	7.66e-03	NA	NA
5. P	A3QJ65	Ribosomal RNA small subunit methyltransferase J	4.82e-05	3.55e-03	NA	NA
5. P	A2BP39	tRNA (guanine-N(7)-)-methyltransferase	7.57e-05	5.37e-04	NA	NA
5. P	Q9UT94	eRF1 methyltransferase catalytic subunit mtq2	1.02e-08	4.56e-03	NA	NA
5. P	L0D9B6	Ornithine lipid N-methyltransferase	1.53e-06	9.30e-04	NA	NA
5. P	B1KHT1	Thiopurine S-methyltransferase	4.51e-07	7.80e-03	NA	NA
5. P	P9WKL5	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	6.72e-06	2.02e-02	NA	NA
5. P	Q6SKR2	Methyltransferase N6AMT1	1.54e-06	3.68e-04	NA	NA
5. P	Q8PMI8	Thiopurine S-methyltransferase	2.24e-07	1.49e-03	NA	NA
5. P	B7NNB9	Ribosomal RNA small subunit methyltransferase J	2.96e-04	1.31e-03	NA	NA
5. P	B1KV69	tRNA (guanine-N(7)-)-methyltransferase	8.46e-06	2.50e-03	NA	NA
5. P	O84836	tRNA (guanine-N(7)-)-methyltransferase	5.19e-05	6.29e-04	NA	NA
5. P	C1DRL5	Thiopurine S-methyltransferase	2.22e-07	5.30e-03	NA	NA
5. P	O83477	tRNA (guanine-N(7)-)-methyltransferase	4.02e-05	4.98e-02	NA	NA
5. P	Q21HF7	Ribosomal RNA small subunit methyltransferase J	3.12e-05	1.28e-02	NA	NA
5. P	Q5ZUG1	Ribosomal RNA small subunit methyltransferase J	6.72e-06	2.02e-04	NA	NA
5. P	Q4ZWU6	Ribosomal RNA small subunit methyltransferase J	1.37e-04	2.01e-03	NA	NA
5. P	C3N0H8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.58e-10	5.59e-04	NA	NA
5. P	A8FPK4	Ribosomal RNA small subunit methyltransferase J	1.45e-04	2.67e-03	NA	NA
5. P	A1WYS6	Ribosomal RNA small subunit methyltransferase J	2.39e-04	2.59e-02	NA	NA
5. P	P26236	Magnesium-protoporphyrin O-methyltransferase	5.85e-11	2.23e-04	NA	NA
5. P	B5FFB3	Ribosomal RNA small subunit methyltransferase J	2.09e-05	1.30e-04	NA	NA
5. P	B5R3Z4	Ribosomal RNA small subunit methyltransferase J	3.28e-04	6.16e-04	NA	NA
5. P	C5BB22	Ribosomal RNA small subunit methyltransferase J	2.54e-04	2.84e-04	NA	NA
5. P	Q88MQ7	Ribosomal RNA small subunit methyltransferase J	2.56e-05	3.97e-03	NA	NA
5. P	Q02RF2	Ribosomal RNA small subunit methyltransferase J	2.00e-04	7.95e-03	NA	NA
5. P	Q9Y5N5	Methyltransferase N6AMT1	1.56e-06	2.86e-03	NA	NA
5. P	A6V3Q8	Thiopurine S-methyltransferase	3.56e-07	6.80e-04	NA	NA
5. P	Q5E8R9	Ribosomal RNA small subunit methyltransferase J	2.06e-05	1.24e-04	NA	NA
5. P	B7VAP9	Thiopurine S-methyltransferase	3.26e-07	1.13e-03	NA	NA
5. P	B6ENK8	Thiopurine S-methyltransferase	2.82e-07	2.27e-03	NA	NA
5. P	A1VC40	Ribosomal RNA large subunit methyltransferase E	3.82e-05	1.26e-03	NA	NA
5. P	Q729T9	Ribosomal RNA large subunit methyltransferase E	3.71e-05	1.26e-03	NA	NA
5. P	A7GAQ4	tRNA (guanine-N(7)-)-methyltransferase	7.48e-06	3.17e-03	NA	NA
5. P	B1YKZ4	Uncharacterized methyltransferase Exig_2346	2.64e-07	1.92e-03	NA	NA
5. P	Q4A9M3	tRNA (guanine-N(7)-)-methyltransferase	3.22e-06	4.41e-02	NA	NA
5. P	B8DNJ4	Ribosomal RNA large subunit methyltransferase E	8.59e-08	2.62e-03	NA	NA
5. P	Q9CCZ9	tRNA (guanine-N(7)-)-methyltransferase	1.55e-04	1.18e-02	NA	NA
5. P	Q9CQL0	Protein N-lysine methyltransferase METTL21A	8.38e-09	1.24e-02	NA	NA
5. P	B5FEQ9	Thiopurine S-methyltransferase	3.13e-07	5.40e-03	NA	NA
5. P	Q7NA24	Ribosomal RNA small subunit methyltransferase J	6.04e-05	1.15e-03	NA	NA
5. P	Q6NYP8	EEF1A lysine methyltransferase 1	6.52e-03	6.09e-03	NA	NA
5. P	P59719	tRNA (guanine-N(7)-)-methyltransferase	9.77e-06	1.78e-02	NA	NA
5. P	Q9KVR6	Ribosomal RNA small subunit methyltransferase J	2.65e-05	7.23e-05	NA	NA
5. P	A9NAW7	Ribosomal RNA small subunit methyltransferase J	1.25e-04	1.88e-03	NA	NA
5. P	Q9HKE4	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.55e-09	3.46e-02	NA	NA
5. P	A6VUQ9	Ribosomal RNA small subunit methyltransferase J	6.08e-04	9.99e-03	NA	NA
5. P	Q2P1M0	Ribosomal RNA large subunit methyltransferase E	1.41e-07	2.90e-02	NA	NA
5. P	Q24W00	tRNA (guanine-N(7)-)-methyltransferase	1.27e-05	1.34e-02	NA	NA
5. P	A6V1A8	Ribosomal RNA small subunit methyltransferase J	2.02e-04	9.12e-03	NA	NA
5. P	Q30YX3	Ribosomal RNA large subunit methyltransferase E	4.91e-05	1.12e-02	NA	NA
5. P	Q8ZA46	Ribosomal RNA small subunit methyltransferase J	5.44e-05	6.23e-04	NA	NA
5. P	Q65PY5	Ribosomal RNA small subunit methyltransferase J	7.24e-04	9.90e-03	NA	NA
5. P	B0TX95	Ribosomal RNA small subunit methyltransferase J	8.25e-09	2.62e-04	NA	NA
5. P	Q5X154	Thiopurine S-methyltransferase	1.88e-07	5.42e-04	NA	NA
5. P	Q03920	eRF1 methyltransferase catalytic subunit MTQ2	1.83e-09	1.22e-04	NA	NA
5. P	Q05632	Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	7.45e-09	7.88e-04	NA	NA
5. P	Q9PH52	Ribosomal RNA large subunit methyltransferase E	5.18e-08	2.85e-02	NA	NA
5. P	A1AH34	Ribosomal RNA small subunit methyltransferase J	2.77e-04	1.12e-03	NA	NA
5. P	Q4ZQC3	Thiopurine S-methyltransferase	2.08e-07	7.73e-03	NA	NA
5. P	Q8U8Q0	Ribosomal RNA small subunit methyltransferase J	1.07e-05	1.76e-09	NA	NA
5. P	Q6LLM4	Ribosomal RNA small subunit methyltransferase J	1.83e-05	5.58e-05	NA	NA
5. P	A7IIX3	Thiopurine S-methyltransferase	1.83e-07	7.72e-04	NA	NA
5. P	Q7UAV7	Ribosomal RNA small subunit methyltransferase J	2.92e-04	1.11e-03	NA	NA
5. P	Q5NEV4	Ribosomal RNA small subunit methyltransferase J	3.04e-08	3.37e-04	NA	NA
5. P	Q9JYF4	Ribosomal RNA small subunit methyltransferase J	9.84e-05	2.48e-07	NA	NA
5. P	B6I359	Ribosomal RNA small subunit methyltransferase J	2.77e-04	9.48e-04	NA	NA
5. P	A9L3X6	Thiopurine S-methyltransferase	1.77e-07	5.01e-03	NA	NA
5. P	O86262	Thiopurine S-methyltransferase	2.62e-07	2.90e-02	NA	NA
5. P	Q6AJ42	Ribosomal RNA large subunit methyltransferase E	3.18e-08	1.16e-03	NA	NA
5. P	Q5N2X5	tRNA (guanine-N(7)-)-methyltransferase	5.79e-05	4.87e-03	NA	NA
5. P	B5BHN9	Ribosomal RNA small subunit methyltransferase J	3.41e-04	6.16e-04	NA	NA
5. P	A3MWC5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.60e-09	7.10e-06	NA	NA
5. P	B2S3S1	Ribosomal RNA large subunit methyltransferase E	3.36e-07	3.55e-02	NA	NA
5. P	C5BIS1	Thiopurine S-methyltransferase	2.17e-07	4.45e-04	NA	NA
5. P	B1LIG5	Ribosomal RNA small subunit methyltransferase J	2.88e-04	1.31e-03	NA	NA
5. P	B7VHB0	Ribosomal RNA small subunit methyltransferase J	2.02e-04	1.97e-04	NA	NA
5. P	P37872	Uncharacterized protein YbxB	9.46e-10	7.51e-07	NA	NA
5. P	Q4UST1	Thiopurine S-methyltransferase	2.44e-07	1.95e-02	NA	NA
5. P	P44243	Uncharacterized protein HI_1523	1.27e-02	2.78e-02	NA	NA
5. P	Q02NZ5	Thiopurine S-methyltransferase	4.43e-07	4.23e-04	NA	NA
5. P	B3GZC5	Ribosomal RNA small subunit methyltransferase J	6.65e-04	1.84e-04	NA	NA
5. P	Q8HX86	Thiopurine S-methyltransferase	3.21e-07	4.05e-02	NA	NA
5. P	A4FWV6	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.53e-10	2.73e-04	NA	NA
5. P	B5F9F6	Ribosomal RNA small subunit methyltransferase J	3.19e-04	6.16e-04	NA	NA
5. P	B0TSS5	Thiopurine S-methyltransferase	1.81e-07	3.35e-03	NA	NA
5. P	Q4UTQ4	Ribosomal RNA large subunit methyltransferase E	3.70e-08	3.64e-02	NA	NA
5. P	Q31VC8	Ribosomal RNA small subunit methyltransferase J	2.72e-04	9.86e-04	NA	NA
5. P	Q58338	Putative protein N5-glutamine methyltransferase MJ0928	2.47e-10	7.69e-07	NA	NA
5. P	A1JSQ2	Ribosomal RNA small subunit methyltransferase J	4.40e-04	5.60e-03	NA	NA
5. P	Q5PJN8	Ribosomal RNA small subunit methyltransferase J	4.17e-04	6.16e-04	NA	NA
5. P	A6WSW9	Thiopurine S-methyltransferase	1.64e-07	6.55e-03	NA	NA
5. P	Q7VNM5	Putative 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	1.68e-10	2.73e-02	NA	NA
5. P	Q4K8U2	Thiopurine S-methyltransferase	3.03e-07	8.77e-04	NA	NA
5. P	A5UKI5	Ribosomal RNA large subunit methyltransferase E	2.39e-05	3.14e-02	NA	NA
5. P	B7MEJ2	Ribosomal RNA small subunit methyltransferase J	3.80e-04	1.12e-03	NA	NA
5. P	A4STK0	Ribosomal RNA small subunit methyltransferase J	2.99e-05	2.30e-04	NA	NA
5. P	A4YAM5	Thiopurine S-methyltransferase	1.85e-07	2.65e-03	NA	NA
5. P	Q96ZL5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	4.22e-10	3.32e-03	NA	NA
5. P	B7L5X8	Ribosomal RNA small subunit methyltransferase J	3.00e-04	1.11e-03	NA	NA
5. P	Q5WZ61	tRNA (guanine-N(7)-)-methyltransferase	8.81e-06	1.21e-02	NA	NA
5. P	Q885Q4	Thiopurine S-methyltransferase	2.47e-07	1.98e-02	NA	NA
5. P	C3K4Q4	Ribosomal RNA small subunit methyltransferase J	1.57e-04	4.01e-02	NA	NA
5. P	Q0I1I8	Ribosomal RNA small subunit methyltransferase J	7.57e-04	1.54e-02	NA	NA
5. P	Q4JBL7	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.04e-09	1.78e-05	NA	NA
5. P	Q7VNB5	Ribosomal RNA small subunit methyltransferase J	5.99e-04	5.08e-05	NA	NA
5. P	Q6F8H8	Thiopurine S-methyltransferase	9.24e-08	1.52e-04	NA	NA
5. P	A5HZ44	tRNA (guanine-N(7)-)-methyltransferase	8.59e-06	3.17e-03	NA	NA
5. P	Q8DD95	Ribosomal RNA small subunit methyltransferase J	3.00e-05	1.20e-04	NA	NA
5. P	C5D4Y0	Uncharacterized methyltransferase GWCH70_2477	1.90e-07	4.65e-02	NA	NA
5. P	B8CUG6	Thiopurine S-methyltransferase	9.16e-08	1.93e-03	NA	NA
5. P	Q0HR25	Thiopurine S-methyltransferase	1.73e-07	7.12e-03	NA	NA
5. P	Q1MRQ0	Ribosomal RNA large subunit methyltransferase E	3.23e-05	4.57e-02	NA	NA
5. P	B8D8A6	Ribosomal RNA small subunit methyltransferase J	2.99e-05	2.35e-05	NA	NA
5. P	Q0A6F5	Ribosomal RNA small subunit methyltransferase J	2.29e-04	1.23e-02	NA	NA
5. P	A4IXK7	Ribosomal RNA small subunit methyltransferase J	4.83e-06	3.37e-04	NA	NA
5. P	C0Q148	Ribosomal RNA small subunit methyltransferase J	3.19e-04	5.87e-04	NA	NA
5. P	Q60AQ2	Thiopurine S-methyltransferase	4.45e-07	2.19e-03	NA	NA
5. P	B7LSX8	Ribosomal RNA small subunit methyltransferase J	2.70e-04	1.08e-03	NA	NA
5. P	B2SEQ2	Ribosomal RNA small subunit methyltransferase J	5.21e-06	3.37e-04	NA	NA
5. P	Q9I011	Thiopurine S-methyltransferase	2.80e-07	1.33e-03	NA	NA
5. P	Q5ZY91	tRNA (guanine-N(7)-)-methyltransferase	7.10e-05	9.20e-03	NA	NA
5. P	B7N1D6	Ribosomal RNA small subunit methyltransferase J	2.67e-04	1.12e-03	NA	NA
5. P	Q8C436	Protein N-lysine methyltransferase METTL21D	3.31e-07	2.07e-02	NA	NA
5. P	Q057J5	Ribosomal RNA large subunit methyltransferase E	6.80e-08	3.58e-02	NA	NA
5. P	A8H9X0	Ribosomal RNA small subunit methyltransferase J	5.22e-05	9.76e-05	NA	NA
5. P	B7J8G6	Ribosomal RNA large subunit methyltransferase E	8.05e-08	2.41e-02	NA	NA
5. P	Q6GN98	EEF1A lysine methyltransferase 1	3.47e-02	3.87e-02	NA	NA
5. P	Q3KKL0	tRNA (guanine-N(7)-)-methyltransferase	7.11e-05	8.69e-04	NA	NA
5. P	Q8MSW4	rRNA N6-adenosine-methyltransferase Mettl5	5.52e-07	2.12e-08	NA	NA
5. P	Q97WC7	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.18e-10	1.34e-03	NA	NA
5. P	Q2KV81	Thiopurine S-methyltransferase	1.61e-07	4.96e-03	NA	NA
5. P	B0UVN8	Ribosomal RNA small subunit methyltransferase J	1.07e-04	2.24e-02	NA	NA
5. P	B7J1P0	Ribosomal RNA large subunit methyltransferase E	9.72e-05	8.54e-05	NA	NA
5. P	Q12I41	Ribosomal RNA small subunit methyltransferase J	3.59e-05	6.66e-05	NA	NA
5. P	Q8FCL1	Ribosomal RNA small subunit methyltransferase J	2.66e-04	1.12e-03	NA	NA
5. P	C3N8G6	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.36e-10	5.59e-04	NA	NA
5. P	Q9CK31	Ribosomal RNA small subunit methyltransferase J	6.61e-04	2.33e-02	NA	NA
5. P	Q0BNN3	Ribosomal RNA small subunit methyltransferase J	2.84e-08	3.37e-04	NA	NA
5. P	A6UPM1	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.16e-09	1.27e-04	NA	NA
5. P	A8MGS9	Uncharacterized methyltransferase Clos_1076	4.50e-08	4.81e-02	NA	NA
5. P	B4F016	Ribosomal RNA small subunit methyltransferase J	2.02e-04	1.63e-04	NA	NA
5. P	A4WFT5	Ribosomal RNA small subunit methyltransferase J	3.45e-04	8.19e-05	NA	NA
5. P	Q0ADU3	Thiopurine S-methyltransferase	2.17e-07	5.55e-03	NA	NA
5. P	B7UL45	Ribosomal RNA small subunit methyltransferase J	4.01e-04	2.01e-03	NA	NA
5. P	Q3BCR6	Thiopurine S-methyltransferase	4.70e-06	3.00e-02	NA	NA
5. P	Q57IN4	Ribosomal RNA small subunit methyltransferase J	4.19e-04	5.87e-04	NA	NA
5. P	B4RMI6	tRNA (guanine-N(7)-)-methyltransferase	1.51e-05	2.15e-02	NA	NA
5. P	B1J4W2	Thiopurine S-methyltransferase	1.95e-07	4.36e-03	NA	NA
5. P	Q3BCR5	Thiopurine S-methyltransferase	3.12e-07	3.06e-02	NA	NA
5. P	Q8WXB1	Protein N-lysine methyltransferase METTL21A	5.21e-09	1.72e-02	NA	NA
5. P	A9KB94	Ribosomal RNA small subunit methyltransferase J	1.58e-05	2.83e-03	NA	NA
5. P	Q9F5K5	23S rRNA (guanine(2535)-N(1))-methyltransferase	3.16e-07	1.24e-05	NA	NA
5. P	B0RTZ3	Ribosomal RNA large subunit methyltransferase E	1.34e-07	3.64e-02	NA	NA
5. P	B0KUP7	Thiopurine S-methyltransferase	1.72e-07	4.44e-03	NA	NA
5. P	B1IEK9	tRNA (guanine-N(7)-)-methyltransferase	8.19e-06	3.61e-03	NA	NA
5. P	Q12RU3	Thiopurine S-methyltransferase	2.87e-07	1.97e-04	NA	NA
5. P	Q1QZ91	Ribosomal RNA small subunit methyltransferase J	1.62e-05	5.01e-03	NA	NA
5. P	A5IHB4	tRNA (guanine-N(7)-)-methyltransferase	8.37e-06	1.49e-02	NA	NA
5. P	A0Q814	Ribosomal RNA small subunit methyltransferase J	2.18e-08	6.04e-04	NA	NA
5. P	A5W759	Thiopurine S-methyltransferase	1.89e-07	4.83e-03	NA	NA
5. P	P68568	Ribosomal RNA small subunit methyltransferase J	2.80e-04	1.31e-03	NA	NA
5. P	Q0HMQ6	Thiopurine S-methyltransferase	1.72e-07	1.16e-02	NA	NA
5. P	B0BTF1	Ribosomal RNA small subunit methyltransferase J	7.60e-04	2.08e-04	NA	NA
5. P	C4ZW44	Ribosomal RNA small subunit methyltransferase J	2.82e-04	1.31e-03	NA	NA
5. P	Q14FX6	Thiopurine S-methyltransferase	5.05e-06	2.24e-02	NA	NA
5. P	Q0SZG8	Ribosomal RNA small subunit methyltransferase J	2.89e-04	1.11e-03	NA	NA
5. P	B8D8E9	Ribosomal RNA small subunit methyltransferase J	5.81e-05	2.40e-05	NA	NA
5. P	Q72W15	tRNA (guanine-N(7)-)-methyltransferase	8.25e-06	1.16e-02	NA	NA
5. P	Q4I2X5	Protein N-terminal and lysine N-methyltransferase EFM7	8.47e-09	4.74e-03	NA	NA
5. P	B5YUS8	Ribosomal RNA small subunit methyltransferase J	3.00e-04	1.31e-03	NA	NA
5. P	Q8Z270	Ribosomal RNA small subunit methyltransferase J	2.87e-04	3.40e-04	NA	NA
5. P	Q83AK9	Ribosomal RNA small subunit methyltransferase J	1.20e-04	1.88e-03	NA	NA
5. P	A8A5V4	Ribosomal RNA small subunit methyltransferase J	4.14e-04	1.31e-03	NA	NA
5. P	Q88LQ9	Thiopurine S-methyltransferase	1.82e-07	8.71e-03	NA	NA
5. P	Q2Y6S0	Thiopurine S-methyltransferase	2.27e-07	4.82e-04	NA	NA
5. P	B8F6M3	Ribosomal RNA small subunit methyltransferase J	1.35e-04	1.19e-04	NA	NA
5. P	A7MU00	Ribosomal RNA small subunit methyltransferase J	2.43e-04	1.56e-04	NA	NA
5. P	B6J489	Ribosomal RNA small subunit methyltransferase J	1.22e-04	1.88e-03	NA	NA
5. P	Q504A5	Probable thiopurine S-methyltransferase	4.05e-07	2.30e-03	NA	NA
5. P	O26249	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	7.25e-10	5.98e-04	NA	NA
5. P	Q3M3Q5	tRNA (guanine-N(7)-)-methyltransferase	5.11e-05	9.20e-03	NA	NA
5. P	Q16CZ7	Ribosomal RNA small subunit methyltransferase G	4.02e-06	3.81e-02	NA	NA
5. P	C3PKL1	Demethylmenaquinone methyltransferase	1.11e-06	2.75e-02	NA	NA
5. P	B7NEC8	Ribosomal RNA small subunit methyltransferase J	2.94e-04	1.31e-03	NA	NA
5. P	Q6LRI5	Thiopurine S-methyltransferase	2.50e-07	1.47e-02	NA	NA
5. P	P75220	Ribosomal RNA small subunit methyltransferase G	9.57e-11	1.33e-04	NA	NA
5. P	Q8ZZA9	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.64e-10	2.28e-04	NA	NA
5. P	A2BUM1	tRNA (guanine-N(7)-)-methyltransferase	6.90e-05	2.72e-03	NA	NA
5. P	Q3KHD6	Ribosomal RNA small subunit methyltransferase J	1.52e-04	2.02e-02	NA	NA
5. P	Q9N4D9	Alpha N-terminal protein methyltransferase 1	1.22e-08	4.53e-02	NA	NA
5. P	A4Y1K3	Ribosomal RNA small subunit methyltransferase J	4.45e-05	5.10e-03	NA	NA
5. P	Q886R2	Ribosomal RNA small subunit methyltransferase J	1.51e-04	1.49e-03	NA	NA
5. P	Q58292	Probable S-adenosylmethionine-dependent methyltransferase MJ0882	2.33e-10	3.53e-09	NA	NA
5. P	A5UDM5	Ribosomal RNA small subunit methyltransferase J	8.16e-04	1.81e-03	NA	NA
5. P	A4IR67	Uncharacterized methyltransferase GTNG_2476	3.28e-07	2.45e-02	NA	NA
5. P	A7MKM8	Ribosomal RNA small subunit methyltransferase J	3.10e-04	9.48e-04	NA	NA
5. P	Q04W54	tRNA (guanine-N(7)-)-methyltransferase	7.83e-06	1.24e-03	NA	NA
5. P	A0AJ67	tRNA (guanine-N(7)-)-methyltransferase	1.20e-05	3.14e-02	NA	NA
5. P	C1DSX1	Ribosomal RNA small subunit methyltransferase J	2.70e-05	2.95e-02	NA	NA
5. P	Q1R5B9	Ribosomal RNA small subunit methyltransferase J	2.72e-04	1.51e-03	NA	NA
5. P	Q17QF2	EEF1A lysine methyltransferase 1	2.92e-03	2.80e-02	NA	NA
5. P	B2U3P9	Ribosomal RNA small subunit methyltransferase J	3.87e-04	9.86e-04	NA	NA
5. P	Q73L97	Ribosomal RNA large subunit methyltransferase E	2.68e-05	9.48e-04	NA	NA
5. P	B6J3G6	Ribosomal RNA small subunit methyltransferase J	1.18e-04	1.88e-03	NA	NA
5. P	A8WVR2	Alpha N-terminal protein methyltransferase 1	4.97e-09	1.10e-02	NA	NA
5. P	Q7VZM5	Thiopurine S-methyltransferase	2.00e-07	1.57e-03	NA	NA
5. P	Q4KHJ7	Ribosomal RNA small subunit methyltransferase J	1.49e-04	1.56e-02	NA	NA
5. P	A8GL03	Ribosomal RNA small subunit methyltransferase J	2.95e-04	4.67e-04	NA	NA
5. P	Q6C6X6	Probable thiopurine S-methyltransferase	1.48e-07	4.53e-02	NA	NA
5. P	C3LPR5	Ribosomal RNA small subunit methyltransferase J	1.76e-05	7.23e-05	NA	NA
5. P	A5II06	Thiopurine S-methyltransferase	1.99e-07	5.16e-04	NA	NA
5. P	P47620	Ribosomal RNA small subunit methyltransferase G	4.03e-11	4.40e-03	NA	NA
5. P	Q664F4	Ribosomal RNA small subunit methyltransferase J	5.37e-05	6.23e-04	NA	NA
5. P	B7M2Q7	Ribosomal RNA small subunit methyltransferase J	2.88e-04	1.11e-03	NA	NA
5. P	B1JHU7	Ribosomal RNA small subunit methyltransferase J	5.77e-05	7.95e-04	NA	NA
5. P	B8G1D7	tRNA (guanine-N(7)-)-methyltransferase	3.68e-06	1.10e-02	NA	NA
5. P	B9DN09	Uncharacterized methyltransferase Sca_1399	1.33e-06	8.69e-04	NA	NA
5. P	A9M1A6	Ribosomal RNA small subunit methyltransferase J	1.05e-04	3.02e-07	NA	NA
5. P	Q5KWV8	Uncharacterized methyltransferase GK2543	3.42e-07	6.37e-03	NA	NA
5. P	Q661V2	Ribosomal RNA large subunit methyltransferase E	8.13e-05	2.54e-04	NA	NA
5. P	Q5FT39	Thiopurine S-methyltransferase	1.19e-05	4.61e-02	NA	NA
5. P	Q2JRH1	tRNA (guanine-N(7)-)-methyltransferase	3.57e-05	4.23e-02	NA	NA
5. P	B5XN47	Ribosomal RNA small subunit methyltransferase J	3.79e-04	9.39e-04	NA	NA
5. P	C0QX75	Ribosomal RNA large subunit methyltransferase E	1.92e-05	1.13e-02	NA	NA
6. F	Q21MK7	Ribosomal protein L11 methyltransferase	6.51e-08	NA	NA	0.6677
6. F	B7VK72	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.48e-07	NA	NA	0.6321
6. F	Q088J8	Ribosomal protein L11 methyltransferase	8.56e-08	NA	NA	0.6808
6. F	B2TUM0	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.41e-08	NA	NA	0.7041
6. F	Q8UGD5	Ribosomal RNA small subunit methyltransferase A	1.15e-07	NA	NA	0.5707
6. F	O34614	Putative rRNA methylase YtqB	3.88e-09	NA	NA	0.6537
6. F	Q033A6	Ribosomal protein L11 methyltransferase	1.35e-08	NA	NA	0.7259
6. F	P0DG17	Uncharacterized RNA methyltransferase SPs0562	3.29e-08	NA	NA	0.6789
6. F	A1SAM0	Ribosomal protein L11 methyltransferase	9.13e-08	NA	NA	0.6927
6. F	Q9I5G4	tRNA U34 carboxymethyltransferase	9.94e-06	NA	NA	0.5886
6. F	Q8PD33	Ribosomal protein L11 methyltransferase	6.12e-08	NA	NA	0.6673
6. F	Q2IG17	Ribosomal RNA small subunit methyltransferase H	1.06e-03	NA	NA	0.6229
6. F	Q875K1	Sterol 24-C-methyltransferase	1.32e-06	NA	NA	0.5332
6. F	Q8P0H4	Uncharacterized RNA methyltransferase spyM18_1360	6.55e-08	NA	NA	0.6974
6. F	Q7VG38	Ribosomal RNA small subunit methyltransferase G	2.26e-07	NA	NA	0.619
6. F	Q48FH7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.01e-06	NA	NA	0.7057
6. F	B1J5U4	Ribosomal protein L11 methyltransferase	1.27e-07	NA	NA	0.6446
6. F	B7JN37	Ribosomal protein L11 methyltransferase	2.79e-08	NA	NA	0.7047
6. F	Q837V0	Uncharacterized RNA methyltransferase EF_0728	5.23e-08	NA	NA	0.7079
6. F	B1XHD9	tRNA U34 carboxymethyltransferase	9.12e-06	NA	NA	0.5849
6. F	C4K4P6	Ribosomal protein L11 methyltransferase	8.10e-08	NA	NA	0.6294
6. F	Q8FEG6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.35e-06	NA	NA	0.7212
6. F	B3GYL9	Ribosomal protein L11 methyltransferase	7.71e-08	NA	NA	0.5956
6. F	A2Z0C0	Probable protein arginine N-methyltransferase 1	7.68e-06	NA	NA	0.4308
6. F	A7MTS9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.46e-06	NA	NA	0.6274
6. F	Q8EI67	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.72e-08	NA	NA	0.6872
6. F	Q71ZJ9	Ribosomal protein L11 methyltransferase	1.40e-08	NA	NA	0.7514
6. F	B1KZN5	Ribosomal protein L11 methyltransferase	1.40e-08	NA	NA	0.6604
6. F	A5W926	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.88e-08	NA	NA	0.6629
6. F	A8A172	tRNA U34 carboxymethyltransferase	8.93e-06	NA	NA	0.5901
6. F	Q0K956	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.18e-07	NA	NA	0.6875
6. F	Q5FH30	Ribosomal RNA small subunit methyltransferase A	1.38e-07	NA	NA	0.5918
6. F	B4QVW6	Histone-arginine methyltransferase CARMER	1.17e-03	NA	NA	0.4323
6. F	C1DLJ6	Ribosomal protein L11 methyltransferase	9.71e-08	NA	NA	0.6362
6. F	Q92AV4	Uncharacterized RNA methyltransferase lin1815	5.48e-08	NA	NA	0.6996
6. F	Q9PP92	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.24e-08	NA	NA	0.6659
6. F	Q8ES75	Uncharacterized RNA methyltransferase OB0768	5.87e-08	NA	NA	0.7158
6. F	Q65W13	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.43e-07	NA	NA	0.6721
6. F	A4YT90	Ribosomal RNA small subunit methyltransferase A	1.44e-07	NA	NA	0.5712
6. F	A7N1I8	tRNA U34 carboxymethyltransferase	8.31e-05	NA	NA	0.5875
6. F	B7NPF5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.69e-08	NA	NA	0.7028
6. F	Q1R7Q7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.40e-06	NA	NA	0.7206
6. F	B2TWG0	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.32e-08	NA	NA	0.6866
6. F	B5BBK0	Ribosomal RNA large subunit methyltransferase I	7.88e-09	NA	NA	0.6673
6. F	B5R1C6	Ribosomal protein L11 methyltransferase	7.54e-08	NA	NA	0.6327
6. F	B2USL4	Ribosomal protein L11 methyltransferase	2.00e-07	NA	NA	0.7174
6. F	Q92QZ1	Ribosomal RNA small subunit methyltransferase A	1.28e-07	NA	NA	0.5533
6. F	B6JCF0	Ribosomal RNA small subunit methyltransferase H	3.44e-03	NA	NA	0.5991
6. F	B1ILM1	Ribosomal protein L11 methyltransferase	1.28e-08	NA	NA	0.6639
6. F	B5F7P3	Ribosomal protein L11 methyltransferase	1.17e-07	NA	NA	0.6336
6. F	Q1QV72	Ribosomal protein L11 methyltransferase	4.83e-08	NA	NA	0.6851
6. F	Q0TNT3	Ribosomal protein L11 methyltransferase	6.19e-09	NA	NA	0.6495
6. F	A5GV37	Ribosomal protein L11 methyltransferase	5.95e-08	NA	NA	0.7069
6. F	Q9Z721	Uncharacterized RNA methyltransferase CPn_0885/CP_0981/CPj0885/CpB0914	1.57e-07	NA	NA	0.7063
6. F	A5U029	Cyclopropane mycolic acid synthase MmaA2	2.22e-04	NA	NA	0.665
6. F	A8YUZ6	Ribosomal protein L11 methyltransferase	1.31e-08	NA	NA	0.6662
6. F	Q03CJ9	Ribosomal RNA small subunit methyltransferase G	2.39e-09	NA	NA	0.6304
6. F	B4S130	Ribosomal protein L11 methyltransferase	7.99e-08	NA	NA	0.6299
6. F	A4VIY1	tRNA U34 carboxymethyltransferase	9.60e-06	NA	NA	0.6257
6. F	Q7M7T6	tRNA/tmRNA (uracil-C(5))-methyltransferase	7.16e-08	NA	NA	0.6488
6. F	A4TN73	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.05e-08	NA	NA	0.6578
6. F	P39587	Putative ribosomal RNA large subunit methyltransferase YwbD	3.38e-08	NA	NA	0.6746
6. F	Q1D6W9	Protein-L-isoaspartate O-methyltransferase	3.14e-07	NA	NA	0.6139
6. F	P0DJO9	Ribosomal protein L11 methyltransferase	1.42e-08	NA	NA	0.7449
6. F	C6CWS7	Malonyl-[acyl-carrier protein] O-methyltransferase	2.01e-07	NA	NA	0.6955
6. F	Q5RFM7	tRNA (uracil(54)-C(5))-methyltransferase homolog	6.90e-07	NA	NA	0.6386
6. F	Q3YRX7	Ribosomal RNA small subunit methyltransferase H	6.43e-04	NA	NA	0.6147
6. F	Q74IX0	Ribosomal protein L11 methyltransferase	1.13e-08	NA	NA	0.7372
6. F	A6VAK2	tRNA U34 carboxymethyltransferase	5.54e-06	NA	NA	0.6295
6. F	Q46ZH7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.05e-06	NA	NA	0.6985
6. F	Q759S7	Sterol 24-C-methyltransferase	2.61e-06	NA	NA	0.5331
6. F	O66617	Uncharacterized RNA methyltransferase aq_257	5.58e-05	NA	NA	0.6731
6. F	B4UER3	Ribosomal RNA small subunit methyltransferase H	9.52e-04	NA	NA	0.6189
6. F	A4TJK9	tRNA U34 carboxymethyltransferase	1.14e-05	NA	NA	0.5689
6. F	A2C717	Ribosomal protein L11 methyltransferase	4.64e-09	NA	NA	0.7087
6. F	B4TRN5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.23e-08	NA	NA	0.6807
6. F	Q5HB44	Ribosomal RNA small subunit methyltransferase H	4.71e-04	NA	NA	0.637
6. F	Q8XED8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.35e-06	NA	NA	0.7216
6. F	Q730M3	Ribosomal protein L11 methyltransferase	2.78e-08	NA	NA	0.7049
6. F	Q1QKW0	Ribosomal RNA small subunit methyltransferase A	1.41e-07	NA	NA	0.5391
6. F	Q88T09	Ribosomal RNA small subunit methyltransferase G	7.31e-09	NA	NA	0.5835
6. F	A0Q1R2	Ribosomal protein L11 methyltransferase	7.50e-09	NA	NA	0.7571
6. F	Q1CUC6	Ribosomal protein L11 methyltransferase	1.05e-07	NA	NA	0.6896
6. F	Q57J85	Ribosomal protein L11 methyltransferase	9.80e-08	NA	NA	0.632
6. F	Q8Z841	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.43e-08	NA	NA	0.703
6. F	Q8XNG6	Uncharacterized RNA methyltransferase CPE0367	5.97e-08	NA	NA	0.7229
6. F	A9MHG7	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.43e-08	NA	NA	0.7003
6. F	A0LXM6	tRNA1(Val) (adenine(37)-N6)-methyltransferase	4.02e-09	NA	NA	0.6798
6. F	Q5MZ45	Ribosomal protein L11 methyltransferase	2.92e-09	NA	NA	0.7486
6. F	A6VCV6	Ribosomal protein L11 methyltransferase	7.29e-08	NA	NA	0.6984
6. F	A6L2N4	Ribosomal protein L11 methyltransferase	3.46e-09	NA	NA	0.7605
6. F	Q9JWE6	Ubiquinone biosynthesis O-methyltransferase	1.23e-09	NA	NA	0.6843
6. F	Q5QX63	Ribosomal RNA large subunit methyltransferase K/L	2.01e-05	NA	NA	0.6744
6. F	B6I1X9	Ribosomal protein L11 methyltransferase	1.24e-07	NA	NA	0.6334
6. F	Q0HQK1	Ribosomal protein L11 methyltransferase	1.14e-07	NA	NA	0.6638
6. F	B2K467	Ribosomal protein L11 methyltransferase	1.33e-07	NA	NA	0.6159
6. F	Q2P856	Ribosomal protein L11 methyltransferase	5.77e-08	NA	NA	0.6933
6. F	Q9ZM65	Ribosomal protein L11 methyltransferase	1.06e-07	NA	NA	0.7242
6. F	Q4KIX1	Ribosomal protein L11 methyltransferase	1.09e-07	NA	NA	0.6422
6. F	A0KWL2	tRNA U34 carboxymethyltransferase	2.82e-05	NA	NA	0.5939
6. F	Q135P2	Ribosomal RNA small subunit methyltransferase A	1.32e-07	NA	NA	0.5738
6. F	Q5HBC6	Ribosomal RNA small subunit methyltransferase A	1.59e-07	NA	NA	0.5916
6. F	Q6N5B4	Ribosomal RNA small subunit methyltransferase A	1.96e-07	NA	NA	0.571
6. F	Q71YW4	Uncharacterized RNA methyltransferase LMOf2365_1727	5.63e-08	NA	NA	0.698
6. F	Q83R57	tRNA U34 carboxymethyltransferase	1.06e-05	NA	NA	0.6035
6. F	B7NDN7	Ribosomal protein L11 methyltransferase	9.88e-08	NA	NA	0.6282
6. F	Q87BR3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.20e-06	NA	NA	0.5934
6. F	B0UUV6	Ubiquinone biosynthesis O-methyltransferase	7.65e-10	NA	NA	0.6897
6. F	B7LUM8	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.60e-08	NA	NA	0.6337
6. F	Q3JRP8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.31e-06	NA	NA	0.6654
6. F	B5FR09	Ribosomal RNA large subunit methyltransferase I	8.16e-09	NA	NA	0.647
6. F	P62470	Ribosomal RNA small subunit methyltransferase H	7.71e-04	NA	NA	0.6013
6. F	Q65UK6	Ribosomal RNA large subunit methyltransferase K/L	3.98e-05	NA	NA	0.6723
6. F	Q493Q9	Ribosomal RNA small subunit methyltransferase H	1.05e-03	NA	NA	0.598
6. F	B7KJ88	Ribosomal protein L11 methyltransferase	3.12e-09	NA	NA	0.7433
6. F	B4SUN8	Ribosomal protein L11 methyltransferase	1.14e-07	NA	NA	0.6341
6. F	Q8GHA0	Ribosomal RNA small subunit methyltransferase G	2.01e-10	NA	NA	0.686
6. F	Q4ZUM1	Ribosomal RNA large subunit methyltransferase K/L	7.42e-05	NA	NA	0.6099
6. F	P31777	Ribosomal RNA large subunit methyltransferase J	1.98e-04	NA	NA	0.4793
6. F	Q48EV7	tRNA U34 carboxymethyltransferase	7.43e-06	NA	NA	0.6064
6. F	Q48EF0	Ribosomal RNA small subunit methyltransferase H	2.05e-03	NA	NA	0.608
6. F	Q0TCJ7	Ribosomal protein L11 methyltransferase	9.79e-08	NA	NA	0.6328
6. F	A6U7I6	Ribosomal RNA small subunit methyltransferase A	7.82e-08	NA	NA	0.5565
6. F	C3K6Z3	tRNA U34 carboxymethyltransferase	9.36e-06	NA	NA	0.6127
6. F	Q0HIZ8	tRNA U34 carboxymethyltransferase	1.10e-04	NA	NA	0.5727
6. F	Q7NGN4	Uncharacterized RNA methyltransferase gll3134	1.26e-06	NA	NA	0.6391
6. F	B7M2G2	tRNA U34 carboxymethyltransferase	8.87e-06	NA	NA	0.5903
6. F	Q83QD5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.42e-06	NA	NA	0.7208
6. F	B1JRJ4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.47e-08	NA	NA	0.7211
6. F	B8EA68	tRNA U34 carboxymethyltransferase	1.26e-04	NA	NA	0.5838
6. F	Q88SY9	Uncharacterized RNA methyltransferase lp_3226	1.10e-07	NA	NA	0.7026
6. F	Q6MAY1	Uncharacterized RNA methyltransferase pc1544	2.31e-07	NA	NA	0.6378
6. F	Q73NS2	Ribosomal RNA small subunit methyltransferase A	1.15e-07	NA	NA	0.6487
6. F	Q04Z65	Ribosomal protein L11 methyltransferase	6.74e-08	NA	NA	0.6626
6. F	Q3K8E9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.44e-06	NA	NA	0.6331
6. F	Q5XAU1	Uncharacterized RNA methyltransferase M6_Spy1337	5.58e-08	NA	NA	0.6721
6. F	Q97R12	Uncharacterized RNA methyltransferase SP_1029	9.91e-07	NA	NA	0.6929
6. F	Q12S38	Ribosomal protein L11 methyltransferase	8.72e-08	NA	NA	0.654
6. F	A4XSD0	tRNA U34 carboxymethyltransferase	7.23e-06	NA	NA	0.6107
6. F	Q6CYB3	Sterol 24-C-methyltransferase	2.02e-06	NA	NA	0.5516
6. F	Q73EJ5	Uncharacterized RNA methyltransferase BCE_0363	5.88e-08	NA	NA	0.7121
6. F	C0Q8C5	Ribosomal RNA large subunit methyltransferase I	7.24e-09	NA	NA	0.6442
6. F	B7M7D4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.03e-08	NA	NA	0.6469
6. F	Q0T1Q1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.40e-06	NA	NA	0.7207
6. F	A5FZ96	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	7.59e-08	NA	NA	0.6555
6. F	Q8R918	Uncharacterized RNA methyltransferase TTE1812	2.55e-07	NA	NA	0.6992
6. F	Q31XK5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.40e-06	NA	NA	0.721
6. F	C6UJK3	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.60e-08	NA	NA	0.6997
6. F	Q3K736	Ribosomal RNA small subunit methyltransferase H	2.30e-03	NA	NA	0.6255
6. F	Q6FMP0	Protein arginine N-methyltransferase 2	4.08e-07	NA	NA	0.6009
6. F	Q043X8	Ribosomal protein L11 methyltransferase	1.22e-08	NA	NA	0.7384
6. F	A0LLH7	Ribosomal RNA small subunit methyltransferase G 1	4.16e-09	NA	NA	0.6017
6. F	Q89MU0	Ribosomal RNA small subunit methyltransferase A	1.18e-07	NA	NA	0.5811
6. F	A1RGE6	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.03e-08	NA	NA	0.7051
6. F	Q6MEM7	Uncharacterized RNA methyltransferase pc0248	1.62e-07	NA	NA	0.7314
6. F	B2V2I9	Ribosomal protein L11 methyltransferase	7.13e-09	NA	NA	0.7271
6. F	Q0AEV2	Ribosomal protein L11 methyltransferase	1.08e-07	NA	NA	0.5947
6. F	B1JKF2	Ribosomal protein L11 methyltransferase	1.02e-07	NA	NA	0.6161
6. F	B7H3Q6	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.59e-08	NA	NA	0.6381
6. F	A8GCB4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.54e-08	NA	NA	0.6367
6. F	A8A3M2	Protein-L-isoaspartate O-methyltransferase	2.35e-07	NA	NA	0.5347
6. F	B5F3I4	tRNA U34 carboxymethyltransferase	1.16e-05	NA	NA	0.5863
6. F	A1A998	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.18e-08	NA	NA	0.6391
6. F	B5FPZ6	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.40e-08	NA	NA	0.6798
6. F	B7HPL1	Ribosomal protein L11 methyltransferase	2.07e-08	NA	NA	0.7031
6. F	B3PL62	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.67e-06	NA	NA	0.6703
6. F	A6Q2V7	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.93e-08	NA	NA	0.6151
6. F	Q0TA91	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.12e-08	NA	NA	0.6343
6. F	Q74IG2	Uncharacterized RNA methyltransferase LJ_1606	1.25e-07	NA	NA	0.7145
6. F	Q74CC6	Uncharacterized RNA methyltransferase GSU1748	1.08e-08	NA	NA	0.7286
6. F	Q1CGA8	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.35e-08	NA	NA	0.6992
6. F	Q99YP3	Uncharacterized RNA methyltransferase SPy_1606/M5005_Spy1319	6.04e-08	NA	NA	0.6652
6. F	Q0I1I7	tRNA/tmRNA (uracil-C(5))-methyltransferase	7.06e-08	NA	NA	0.6329
6. F	B0VR22	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.51e-08	NA	NA	0.6183
6. F	Q133W3	Ribosomal RNA small subunit methyltransferase H	2.06e-03	NA	NA	0.5819
6. F	Q7TTX0	Ribosomal protein L11 methyltransferase	3.79e-08	NA	NA	0.6796
6. F	A3D0Y0	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.30e-08	NA	NA	0.7045
6. F	A9L1L1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	5.93e-09	NA	NA	0.5936
6. F	Q8EJR7	Ribosomal protein L11 methyltransferase	8.61e-08	NA	NA	0.6131
6. F	Q2KA84	Ribosomal RNA small subunit methyltransferase A	1.25e-07	NA	NA	0.5834
6. F	Q0A8Y4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	5.89e-07	NA	NA	0.6485
6. F	A3PEI7	Ribosomal protein L11 methyltransferase	2.14e-09	NA	NA	0.7222
6. F	Q65V70	Ribosomal protein L11 methyltransferase	7.88e-08	NA	NA	0.6313
6. F	B0TJ37	Ribosomal protein L11 methyltransferase	1.12e-07	NA	NA	0.7128
6. F	A1AEX2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.37e-06	NA	NA	0.7212
6. F	Q1RH40	Bifunctional methyltransferase	1.07e-05	NA	NA	0.6153
6. F	Q10V92	tRNA U34 carboxymethyltransferase	9.96e-06	NA	NA	0.5854
6. F	P9WPB4	Cyclopropane mycolic acid synthase 2	6.24e-07	NA	NA	0.5861
6. F	B7NLI5	Ribosomal protein L11 methyltransferase	9.94e-08	NA	NA	0.6329
6. F	B3WEN7	Ribosomal protein L11 methyltransferase	1.08e-08	NA	NA	0.6983
6. F	A5G9V1	Ribosomal RNA small subunit methyltransferase G	8.15e-10	NA	NA	0.5953
6. F	Q1LLI5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.24e-07	NA	NA	0.6885
6. F	B8I303	Ribosomal protein L11 methyltransferase	1.14e-08	NA	NA	0.7057
6. F	Q88DK7	Ribosomal protein L11 methyltransferase	1.19e-07	NA	NA	0.6447
6. F	Q1RE66	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.63e-08	NA	NA	0.692
6. F	Q2W0I1	Ribosomal RNA small subunit methyltransferase H	1.60e-03	NA	NA	0.6116
6. F	Q02I93	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.53e-07	NA	NA	0.6636
6. F	Q2SL27	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.50e-07	NA	NA	0.6234
6. F	B5YR16	tRNA U34 carboxymethyltransferase	8.91e-06	NA	NA	0.5862
6. F	B7IC17	Ribosomal protein L11 methyltransferase	5.00e-08	NA	NA	0.6335
6. F	A5W9K3	Ribosomal protein L11 methyltransferase	1.32e-07	NA	NA	0.6442
6. F	Q5H1Q8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.74e-07	NA	NA	0.6091
6. F	A2BY60	Ribosomal protein L11 methyltransferase	4.63e-09	NA	NA	0.7235
6. F	Q8AV13	Protein arginine N-methyltransferase 1-A	5.27e-06	NA	NA	0.4267
6. F	A4SRC5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.26e-06	NA	NA	0.6656
6. F	B0VKL3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.64e-07	NA	NA	0.6589
6. F	A5W8E5	tRNA U34 carboxymethyltransferase	9.89e-06	NA	NA	0.605
6. F	O31503	23S rRNA (uracil-C(5))-methyltransferase RlmCD	6.23e-08	NA	NA	0.7144
6. F	A2E5K9	tRNA (guanine(37)-N1)-methyltransferase	1.39e-07	NA	NA	0.6374
6. F	B7MBT0	tRNA U34 carboxymethyltransferase	9.10e-06	NA	NA	0.5812
6. F	B7USP8	tRNA U34 carboxymethyltransferase	9.06e-06	NA	NA	0.5812
6. F	C1DLS8	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.28e-08	NA	NA	0.6494
6. F	Q2P4L7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.08e-06	NA	NA	0.6046
6. F	Q3KIP5	Ribosomal protein L11 methyltransferase	1.11e-07	NA	NA	0.6418
6. F	A8GXS7	Ribosomal RNA small subunit methyltransferase A	1.98e-07	NA	NA	0.6353
6. F	Q5HN37	Uncharacterized RNA methyltransferase SERP1435	9.70e-08	NA	NA	0.6985
6. F	A4J7F1	Ribosomal protein L11 methyltransferase	5.18e-09	NA	NA	0.7362
6. F	B0BRD1	Ribosomal protein L11 methyltransferase	1.20e-07	NA	NA	0.6061
6. F	Q2NWP9	Ribosomal protein L11 methyltransferase	1.13e-07	NA	NA	0.648
6. F	Q8YVT3	Ribosomal protein L11 methyltransferase	1.42e-08	NA	NA	0.6267
6. F	Q96WX4	Sterol 24-C-methyltransferase	1.74e-06	NA	NA	0.559
6. F	Q9RHS9	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.37e-08	NA	NA	0.6491
6. F	A1WYK5	Ribosomal protein L11 methyltransferase	4.53e-08	NA	NA	0.6442
6. F	Q5WZ79	Ribosomal protein L11 methyltransferase	1.07e-08	NA	NA	0.6524
6. F	A6LRN8	Ribosomal protein L11 methyltransferase	7.46e-09	NA	NA	0.749
6. F	A8H8Q9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.70e-08	NA	NA	0.7159
6. F	A5F5I8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.18e-06	NA	NA	0.6934
6. F	Q07LF4	Ribosomal RNA small subunit methyltransferase A	1.42e-07	NA	NA	0.5743
6. F	A8G1G7	tRNA/tmRNA (uracil-C(5))-methyltransferase	8.82e-08	NA	NA	0.6526
6. F	A4TBF6	Ribosomal RNA small subunit methyltransferase H	6.35e-03	NA	NA	0.6751
6. F	Q9JXW2	Ribosomal protein L11 methyltransferase	1.63e-07	NA	NA	0.6628
6. F	Q6LMS7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.37e-06	NA	NA	0.7145
6. F	C3LQZ5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.26e-06	NA	NA	0.6943
6. F	Q9JXI7	Ubiquinone biosynthesis O-methyltransferase	1.19e-09	NA	NA	0.6818
6. F	Q9CJX3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.10e-06	NA	NA	0.6565
6. F	A5U027	Hydroxymycolate synthase MmaA4	3.47e-04	NA	NA	0.6591
6. F	B7LPH3	tRNA U34 carboxymethyltransferase	8.70e-06	NA	NA	0.5901
6. F	A7ZMZ6	tRNA U34 carboxymethyltransferase	1.07e-05	NA	NA	0.59
6. F	C5WBK5	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.07e-08	NA	NA	0.6999
6. F	P44402	Ribosomal protein L11 methyltransferase	5.88e-08	NA	NA	0.6384
6. F	B2VDG5	Ribosomal RNA large subunit methyltransferase I	1.07e-08	NA	NA	0.6577
6. F	A4WBM8	tRNA U34 carboxymethyltransferase	9.12e-06	NA	NA	0.5155
6. F	Q81LS4	Ribosomal protein L11 methyltransferase	2.02e-08	NA	NA	0.7048
6. F	B6J2R7	Ribosomal RNA small subunit methyltransferase H	3.30e-03	NA	NA	0.6053
6. F	Q04QV8	Ribosomal protein L11 methyltransferase	6.64e-08	NA	NA	0.685
6. F	Q3Z3S5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.03e-08	NA	NA	0.7074
6. F	B1HS82	Ribosomal RNA small subunit methyltransferase A	4.78e-07	NA	NA	0.5982
6. F	B5REY1	Ribosomal protein L11 methyltransferase	1.04e-07	NA	NA	0.6335
6. F	A8FLP0	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.01e-08	NA	NA	0.6479
6. F	B6JGM4	Ribosomal RNA small subunit methyltransferase A	1.38e-07	NA	NA	0.6455
6. F	Q8XCH5	tRNA U34 carboxymethyltransferase	8.92e-06	NA	NA	0.5901
6. F	B0V7H8	Ribosomal protein L11 methyltransferase	5.18e-08	NA	NA	0.7005
6. F	Q5PJW5	Ribosomal protein L11 methyltransferase	1.02e-07	NA	NA	0.6336
6. F	C6DDJ9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.76e-06	NA	NA	0.6935
6. F	A1JM74	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	1.84e-08	NA	NA	0.6415
6. F	Q3J2B9	Ribosomal RNA small subunit methyltransferase A	9.04e-08	NA	NA	0.5602
6. F	Q03DH7	Ribosomal RNA small subunit methyltransferase G	1.07e-09	NA	NA	0.6288
6. F	Q6LLY5	Ribosomal protein L11 methyltransferase	1.44e-07	NA	NA	0.6219
6. F	P60094	Ribosomal protein L11 methyltransferase	9.91e-08	NA	NA	0.6769
6. F	C3LQP9	Ribosomal protein L11 methyltransferase	1.21e-07	NA	NA	0.6742
6. F	B7I4Y4	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.69e-08	NA	NA	0.6177
6. F	Q8DNP4	Ribosomal protein L11 methyltransferase	1.13e-08	NA	NA	0.7354
6. F	Q72IZ3	Uncharacterized RNA methyltransferase TT_C0988	3.61e-05	NA	NA	0.6762
6. F	Q9HV78	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.27e-08	NA	NA	0.6486
6. F	A4XQI3	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.34e-08	NA	NA	0.6648
6. F	C4M572	tRNA (guanine(37)-N1)-methyltransferase	5.45e-08	NA	NA	0.5999
6. F	Q5PAS3	Ribosomal RNA small subunit methyltransferase H	5.89e-04	NA	NA	0.6272
6. F	Q66AU8	tRNA U34 carboxymethyltransferase	1.12e-05	NA	NA	0.584
6. F	A6W3C7	tRNA/tmRNA (uracil-C(5))-methyltransferase	6.19e-08	NA	NA	0.6976
6. F	Q31XA5	Protein-L-isoaspartate O-methyltransferase	2.34e-07	NA	NA	0.5347
6. F	A1AC32	tRNA U34 carboxymethyltransferase	9.15e-06	NA	NA	0.5812
6. F	Q8D4B4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.00e-08	NA	NA	0.6881
6. F	B4TSJ2	Ribosomal RNA large subunit methyltransferase I	6.88e-09	NA	NA	0.6647
6. F	Q8E6F5	Uncharacterized RNA methyltransferase gbs0613	4.57e-08	NA	NA	0.715
6. F	A4VI15	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.34e-08	NA	NA	0.6658
6. F	B2FPX2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.58e-07	NA	NA	0.6173
6. F	Q2GGH6	Ribosomal RNA small subunit methyltransferase A	2.97e-07	NA	NA	0.5993
6. F	B7NBM2	tRNA U34 carboxymethyltransferase	1.11e-05	NA	NA	0.6081
6. F	A1S382	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.69e-08	NA	NA	0.6417
6. F	B5FC65	Ribosomal protein L11 methyltransferase	9.91e-08	NA	NA	0.6278
6. F	Q892Z2	Uncharacterized RNA methyltransferase CTC_01941	3.68e-07	NA	NA	0.6466
6. F	A0L0G4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.07e-08	NA	NA	0.6437
6. F	B7FTW3	tRNA (guanine(37)-N1)-methyltransferase 1	4.14e-07	NA	NA	0.5873
6. F	Q3IGZ3	Ribosomal RNA large subunit methyltransferase K/L	1.54e-05	NA	NA	0.6656
6. F	H2E7U0	Sterol methyltransferase-like 3	1.83e-06	NA	NA	0.5426
6. F	B7MR93	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.43e-08	NA	NA	0.7
6. F	C0QLV7	Ribosomal protein L11 methyltransferase	1.12e-08	NA	NA	0.7525
6. F	Q62JV9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.34e-06	NA	NA	0.6675
6. F	A0KIF5	tRNA U34 carboxymethyltransferase	1.87e-05	NA	NA	0.608
6. F	Q2TBQ0	Mitochondrial dimethyladenosine transferase 1	4.31e-07	NA	NA	0.5921
6. F	Q0VQX6	tRNA U34 carboxymethyltransferase	9.81e-06	NA	NA	0.5957
6. F	B4T0X5	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.32e-08	NA	NA	0.7048
6. F	Q9I525	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.82e-07	NA	NA	0.6401
6. F	B0KFT4	Ribosomal RNA small subunit methyltransferase H	2.11e-03	NA	NA	0.6197
6. F	Q8TZR3	Protein-L-isoaspartate O-methyltransferase	8.50e-05	NA	NA	0.611
6. F	Q7VPN5	Ribosomal protein L11 methyltransferase	9.42e-08	NA	NA	0.6008
6. F	Q97NV8	Uncharacterized RNA methyltransferase SP_1901	7.97e-08	NA	NA	0.6691
6. F	A5EXH9	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.54e-08	NA	NA	0.6368
6. F	L7IP31	Sterol 24-C-methyltransferase	2.03e-06	NA	NA	0.555
6. F	Q7U1J9	Cyclopropane mycolic acid synthase MmaA2	2.23e-04	NA	NA	0.6527
6. F	B6IRH0	Ribosomal RNA small subunit methyltransferase H	1.37e-03	NA	NA	0.6374
6. F	Q984S7	Ribosomal RNA small subunit methyltransferase A	1.07e-07	NA	NA	0.5859
6. F	B7L7S4	tRNA U34 carboxymethyltransferase	8.84e-06	NA	NA	0.59
6. F	B0JYW5	Protein arginine N-methyltransferase 6	2.53e-06	NA	NA	0.5416
6. F	D3UZL8	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.30e-08	NA	NA	0.6816
6. F	B7VM88	tRNA/tmRNA (uracil-C(5))-methyltransferase	9.68e-08	NA	NA	0.6189
6. F	B2VFZ2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.89e-06	NA	NA	0.6551
6. F	C6CG41	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.19e-08	NA	NA	0.628
6. F	Q3BY72	Ribosomal protein L11 methyltransferase	5.08e-08	NA	NA	0.6627
6. F	Q4UZB8	Ribosomal protein L11 methyltransferase	6.13e-08	NA	NA	0.6678
6. F	Q7MFU0	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.48e-08	NA	NA	0.6557
6. F	A1U2U9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.65e-07	NA	NA	0.6178
6. F	P0A8T2	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.633
6. F	C3M9C2	Ribosomal RNA small subunit methyltransferase A	2.28e-07	NA	NA	0.5962
6. F	A1RFA3	Ribosomal protein L11 methyltransferase	9.54e-08	NA	NA	0.6823
6. F	A4IJB8	Ribosomal RNA small subunit methyltransferase A	3.84e-07	NA	NA	0.559
6. F	Q8DC67	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.14e-06	NA	NA	0.6284
6. F	Q216E6	Ribosomal RNA small subunit methyltransferase H	2.27e-03	NA	NA	0.6233
6. F	A5UEI8	tRNA U34 carboxymethyltransferase	1.02e-05	NA	NA	0.5391
6. F	Q03SF4	Ribosomal protein L11 methyltransferase	9.00e-09	NA	NA	0.7321
6. F	A3N0H4	tRNA U34 carboxymethyltransferase	1.12e-05	NA	NA	0.5074
6. F	Q0I3Y4	Ubiquinone biosynthesis O-methyltransferase	7.69e-10	NA	NA	0.6906
6. F	Q9CGB9	Uncharacterized RNA methyltransferase YljE	2.10e-07	NA	NA	0.734
6. F	A5VHQ2	Ribosomal RNA small subunit methyltransferase G	3.05e-09	NA	NA	0.6195
6. F	Q5GSM9	Ribosomal RNA small subunit methyltransferase A	2.45e-07	NA	NA	0.6248
6. F	A8AQF7	Ribosomal protein L11 methyltransferase	1.00e-07	NA	NA	0.6332
6. F	Q17WP3	Ribosomal RNA small subunit methyltransferase G	2.20e-10	NA	NA	0.5941
6. F	Q7U1K1	Hydroxymycolate synthase MmaA4	3.22e-04	NA	NA	0.6623
6. F	B1IQ33	Ribosomal protein L11 methyltransferase	9.79e-08	NA	NA	0.6276
6. F	Q606W5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.10e-07	NA	NA	0.6248
6. F	B5FIW1	Ribosomal protein L11 methyltransferase	1.23e-07	NA	NA	0.6335
6. F	A1SSB8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.09e-06	NA	NA	0.6962
6. F	Q87LP5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.17e-06	NA	NA	0.6593
6. F	Q323P2	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.43e-08	NA	NA	0.6394
6. F	A9KET2	Ribosomal RNA small subunit methyltransferase H	8.84e-04	NA	NA	0.5752
6. F	Q3IIC0	Ribosomal protein L11 methyltransferase	9.17e-08	NA	NA	0.6869
6. F	Q8XIT6	Ribosomal protein L11 methyltransferase	7.42e-09	NA	NA	0.6149
6. F	Q8G4I8	Uncharacterized RNA methyltransferase BL1394	3.97e-08	NA	NA	0.7465
6. F	Q1I4J8	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.94e-08	NA	NA	0.6236
6. F	Q4K898	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.54e-07	NA	NA	0.6875
6. F	B3H0C8	Ubiquinone biosynthesis O-methyltransferase	4.01e-09	NA	NA	0.6618
6. F	C5B8X6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.46e-06	NA	NA	0.6672
6. F	P60092	Ribosomal protein L11 methyltransferase	6.06e-08	NA	NA	0.6993
6. F	Q1I5M7	tRNA U34 carboxymethyltransferase	1.05e-05	NA	NA	0.6098
6. F	Q1I5B0	Ribosomal RNA small subunit methyltransferase H	1.85e-03	NA	NA	0.6419
6. F	Q7TUS7	Ribosomal protein L11 methyltransferase	6.24e-09	NA	NA	0.7062
6. F	Q39ZT2	Ribosomal RNA small subunit methyltransferase G	6.35e-10	NA	NA	0.6396
6. F	Q7MHQ8	Protein-L-isoaspartate O-methyltransferase	2.66e-07	NA	NA	0.5851
6. F	A6VW36	Ribosomal RNA large subunit methyltransferase K/L	8.27e-05	NA	NA	0.649
6. F	A8A570	Ribosomal protein L11 methyltransferase	9.51e-08	NA	NA	0.627
6. F	Q6HDK9	Ribosomal protein L11 methyltransferase	2.81e-08	NA	NA	0.7078
6. F	B7V1R2	Ribosomal protein L11 methyltransferase	6.72e-08	NA	NA	0.6981
6. F	B7LHW6	Ribosomal protein L11 methyltransferase	9.58e-08	NA	NA	0.6329
6. F	Q8ZQJ5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.69e-08	NA	NA	0.6916
6. F	A7ZUI5	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.25e-08	NA	NA	0.687
6. F	B3E6I4	Protein-L-isoaspartate O-methyltransferase	4.26e-07	NA	NA	0.5762
6. F	A4W8M4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	1.67e-08	NA	NA	0.6725
6. F	A6WS64	tRNA1(Val) (adenine(37)-N6)-methyltransferase	5.98e-09	NA	NA	0.603
6. F	B5FAG4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.69e-06	NA	NA	0.684
6. F	B9KCK3	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.66e-08	NA	NA	0.6523
6. F	P9WPB6	Cyclopropane mycolic acid synthase 1	2.56e-04	NA	NA	0.6383
6. F	A1AIE7	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.45e-08	NA	NA	0.6343
6. F	B1J0L7	tRNA U34 carboxymethyltransferase	8.86e-06	NA	NA	0.6088
6. F	C0PXN9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.13e-08	NA	NA	0.7011
6. F	A8A773	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.54e-08	NA	NA	0.6867
6. F	Q8CXW3	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.26e-08	NA	NA	0.6343
6. F	B1LVB8	Ribosomal RNA small subunit methyltransferase A	1.70e-07	NA	NA	0.6118
6. F	C3KCS2	Ribosomal RNA small subunit methyltransferase H	2.42e-03	NA	NA	0.633
6. F	B0W3L6	Histone-arginine methyltransferase CARMER	2.82e-03	NA	NA	0.4071
6. F	B2VL75	Ribosomal protein L11 methyltransferase	1.07e-07	NA	NA	0.6469
6. F	A7FK27	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.00e-08	NA	NA	0.7017
6. F	Q8DKB7	Uncharacterized RNA methyltransferase tlr0942	8.21e-07	NA	NA	0.6486
6. F	B7M0X1	Ribosomal protein L11 methyltransferase	9.90e-08	NA	NA	0.6277
6. F	Q6FRZ7	Sterol 24-C-methyltransferase	1.46e-06	NA	NA	0.5658
6. F	A7GT06	Ribosomal protein L11 methyltransferase	2.81e-08	NA	NA	0.7043
6. F	Q87WA0	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.85e-08	NA	NA	0.633
6. F	P9WPB0	Mycolic acid methyltransferase MmaA1	3.18e-04	NA	NA	0.6647
6. F	B7UYW8	tRNA U34 carboxymethyltransferase	9.56e-06	NA	NA	0.5815
6. F	Q6C2D9	Sterol 24-C-methyltransferase	2.38e-06	NA	NA	0.5838
6. F	Q31W09	Ribosomal protein L11 methyltransferase	9.27e-08	NA	NA	0.6332
6. F	A4Y9Y4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.05e-08	NA	NA	0.7046
6. F	Q8E6W1	Uncharacterized RNA methyltransferase gbs0448	3.51e-08	NA	NA	0.6752
6. F	Q9KPC1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.53e-06	NA	NA	0.6788
6. F	Q8EPW5	Ribosomal protein L11 methyltransferase	1.50e-08	NA	NA	0.6944
6. F	B0S0Y9	Ribosomal RNA small subunit methyltransferase H	5.62e-04	NA	NA	0.627
6. F	B6I8H9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.26e-08	NA	NA	0.6348
6. F	Q0HM20	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.44e-08	NA	NA	0.6806
6. F	Q7TU56	Ribosomal protein L11 methyltransferase	5.19e-09	NA	NA	0.7391
6. F	Q818F1	Ribosomal protein L11 methyltransferase	2.10e-08	NA	NA	0.703
6. F	Q74I68	Uncharacterized RNA methyltransferase LJ_1698	1.48e-07	NA	NA	0.6779
6. F	A5U030	Mycolic acid methyltransferase MmaA1	3.24e-04	NA	NA	0.6549
6. F	Q8ZAX6	Ribosomal protein L11 methyltransferase	1.07e-07	NA	NA	0.6259
6. F	P0A5Q1	Mycolic acid methyltransferase MmaA1	3.29e-04	NA	NA	0.6595
6. F	A7IJ80	Ribosomal RNA small subunit methyltransferase A	1.39e-07	NA	NA	0.6077
6. F	B4RRY8	Ribosomal RNA large subunit methyltransferase I	1.02e-08	NA	NA	0.6757
6. F	A7GHH4	Ribosomal protein L11 methyltransferase	1.17e-08	NA	NA	0.6643
6. F	B4EX23	Ribosomal protein L11 methyltransferase	1.13e-07	NA	NA	0.6018
6. F	B2HYZ7	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.47e-08	NA	NA	0.6391
6. F	A9MNA2	Ribosomal protein L11 methyltransferase	1.06e-07	NA	NA	0.6331
6. F	C5BP64	Ribosomal protein L11 methyltransferase	3.81e-08	NA	NA	0.7192
6. F	Q8F6B7	Ribosomal protein L11 methyltransferase	7.17e-08	NA	NA	0.7316
6. F	B3P4N5	Histone-arginine methyltransferase CARMER	1.18e-03	NA	NA	0.4034
6. F	B7NS47	tRNA U34 carboxymethyltransferase	8.97e-06	NA	NA	0.59
6. F	A1U698	Ribosomal protein L11 methyltransferase	2.33e-08	NA	NA	0.6469
6. F	B0TUZ2	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.31e-08	NA	NA	0.7119
6. F	A5N6M4	Ribosomal protein L11 methyltransferase	1.27e-08	NA	NA	0.7516
6. F	B4TX91	Ribosomal protein L11 methyltransferase	8.13e-08	NA	NA	0.6325
6. F	Q6AIL0	tRNA U34 carboxymethyltransferase	1.04e-05	NA	NA	0.6466
6. F	A0A1C9U5X7	N-methyltransferase 4	4.21e-07	NA	NA	0.55
6. F	Q02HS6	tRNA U34 carboxymethyltransferase	9.41e-06	NA	NA	0.5891
6. F	A6T766	Ribosomal RNA large subunit methyltransferase I	6.74e-09	NA	NA	0.6517
6. F	Q8R933	Uncharacterized RNA methyltransferase TTE1797	6.09e-08	NA	NA	0.6423
6. F	Q0HN86	Ribosomal protein L11 methyltransferase	9.58e-08	NA	NA	0.6591
6. F	Q8D3Q3	Polyamine aminopropyltransferase	2.67e-05	NA	NA	0.6173
6. F	Q1GP62	Ribosomal RNA small subunit methyltransferase G	4.20e-07	NA	NA	0.6433
6. F	Q88N84	Ribosomal RNA small subunit methyltransferase H	2.02e-03	NA	NA	0.609
6. F	A9N824	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.79e-08	NA	NA	0.7082
6. F	C5BEW8	Ribosomal protein L11 methyltransferase	1.17e-07	NA	NA	0.617
6. F	Q8NVT4	Uncharacterized RNA methyltransferase MW1838	8.64e-08	NA	NA	0.7106
6. F	Q74D67	Uncharacterized RNA methyltransferase GSU1452	3.28e-07	NA	NA	0.7383
6. F	A6QBC0	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.50e-08	NA	NA	0.638
6. F	A5WFX2	Ribosomal protein L11 methyltransferase	6.30e-08	NA	NA	0.7198
6. F	B4HJC0	Histone-arginine methyltransferase CARMER	1.21e-03	NA	NA	0.4098
6. F	Q15ZR4	Ribosomal protein L11 methyltransferase	1.04e-07	NA	NA	0.612
6. F	A3MZ07	Ubiquinone biosynthesis O-methyltransferase	7.85e-10	NA	NA	0.6497
6. F	Q5X6J0	Ribosomal RNA small subunit methyltransferase H	3.10e-03	NA	NA	0.5859
6. F	A7FXL3	Ribosomal protein L11 methyltransferase	6.37e-09	NA	NA	0.709
6. F	Q2S9L7	Ribosomal protein L11 methyltransferase	4.41e-08	NA	NA	0.6495
6. F	Q5FH93	Ribosomal RNA small subunit methyltransferase H	4.08e-04	NA	NA	0.637
6. F	Q603L5	tRNA U34 carboxymethyltransferase	3.83e-05	NA	NA	0.5656
6. F	D0NLC2	tRNA (guanine(37)-N1)-methyltransferase	2.77e-07	NA	NA	0.6269
6. F	Q2GK91	Ribosomal RNA small subunit methyltransferase A	2.28e-07	NA	NA	0.6453
6. F	A8F3S3	Ribosomal RNA small subunit methyltransferase G	6.69e-09	NA	NA	0.6125
6. F	Q7A4Q9	Uncharacterized RNA methyltransferase SA1713	8.67e-08	NA	NA	0.7108
6. F	Q4K6I5	Ribosomal RNA small subunit methyltransferase H	1.95e-03	NA	NA	0.633
6. F	Q891A0	Uncharacterized RNA methyltransferase CTC_02481	1.83e-07	NA	NA	0.7277
6. F	Q72PX0	Ribosomal protein L11 methyltransferase	6.39e-08	NA	NA	0.6684
6. F	B7I675	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.48e-07	NA	NA	0.6281
6. F	Q7W676	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	5.53e-07	NA	NA	0.6695
6. F	Q1RAR3	tRNA U34 carboxymethyltransferase	1.11e-05	NA	NA	0.5919
6. F	A1B0G4	Ribosomal RNA small subunit methyltransferase A	1.11e-07	NA	NA	0.5703
6. F	B7MW65	tRNA U34 carboxymethyltransferase	8.88e-06	NA	NA	0.5901
6. F	A4SJL7	Ribosomal protein L11 methyltransferase	8.66e-08	NA	NA	0.622
6. F	Q02FV3	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.26e-08	NA	NA	0.6504
6. F	Q8FGQ5	tRNA U34 carboxymethyltransferase	9.00e-06	NA	NA	0.5899
6. F	Q87KU2	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6434
6. F	Q17WN8	Ribosomal protein L11 methyltransferase	1.75e-07	NA	NA	0.7152
6. F	Q9X0H9	Uncharacterized RNA methyltransferase TM_1094	9.15e-08	NA	NA	0.6485
6. F	A5IHD3	Ribosomal protein L11 methyltransferase	8.88e-09	NA	NA	0.6787
6. F	A5UBW0	tRNA U34 carboxymethyltransferase	9.15e-06	NA	NA	0.5939
6. F	Q57KF9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.56e-06	NA	NA	0.647
6. F	B7UJZ0	Ribosomal protein L11 methyltransferase	9.97e-08	NA	NA	0.6324
6. F	Q1BGX9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.25e-06	NA	NA	0.6994
6. F	B1IVB3	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.37e-08	NA	NA	0.6863
6. F	C6DIJ9	Ribosomal protein L11 methyltransferase	7.02e-08	NA	NA	0.6606
6. F	Q8RB66	Ribosomal protein L11 methyltransferase	9.13e-09	NA	NA	0.6765
6. F	A5W8Q8	Ribosomal RNA small subunit methyltransferase H	2.12e-03	NA	NA	0.6235
6. F	Q48JX8	Ribosomal RNA large subunit methyltransferase K/L	7.67e-05	NA	NA	0.6343
6. F	B4LVS8	Histone-arginine methyltransferase CARMER	1.28e-03	NA	NA	0.4438
6. F	A3PJZ3	Ribosomal RNA small subunit methyltransferase A	7.29e-08	NA	NA	0.5753
6. F	C1FVT8	Ribosomal protein L11 methyltransferase	6.63e-09	NA	NA	0.709
6. F	B4SRK6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.09e-06	NA	NA	0.6197
6. F	A8EWU8	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.11e-08	NA	NA	0.6552
6. F	Q88XP4	Uncharacterized RNA methyltransferase lp_1151	1.33e-07	NA	NA	0.7457
6. F	A7MF48	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.78e-08	NA	NA	0.6556
6. F	Q32CD0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.39e-06	NA	NA	0.7209
6. F	A0KNJ1	Ribosomal protein L11 methyltransferase	8.57e-08	NA	NA	0.6298
6. F	B7N0Q3	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6259
6. F	A7ME44	Ribosomal RNA large subunit methyltransferase I	6.47e-09	NA	NA	0.6802
6. F	A5EVX5	Ribosomal protein L11 methyltransferase	8.56e-08	NA	NA	0.679
6. F	P60399	Ribosomal RNA small subunit methyltransferase H	1.67e-03	NA	NA	0.6109
6. F	C3LLK9	tRNA U34 carboxymethyltransferase	1.08e-05	NA	NA	0.5951
6. F	P56133	Protein-L-isoaspartate O-methyltransferase	6.34e-07	NA	NA	0.4824
6. F	Q10X25	Ribosomal protein L11 methyltransferase	3.76e-09	NA	NA	0.7464
6. F	Q9KV64	Ribosomal protein L11 methyltransferase	1.21e-07	NA	NA	0.6783
6. F	B0BP95	tRNA U34 carboxymethyltransferase	1.16e-05	NA	NA	0.5076
6. F	P44074	Uncharacterized protein HI_0912	6.41e-06	NA	NA	0.5535
6. F	Q8Y035	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	5.71e-07	NA	NA	0.6545
6. F	B4TJV7	Ribosomal protein L11 methyltransferase	1.00e-07	NA	NA	0.6326
6. F	B9MJY9	Ribosomal protein L11 methyltransferase	6.75e-09	NA	NA	0.7057
6. F	B7VMH7	tRNA U34 carboxymethyltransferase	7.36e-05	NA	NA	0.6126
6. F	Q0VS10	Ribosomal RNA small subunit methyltransferase H	6.63e-03	NA	NA	0.6116
6. F	Q759W1	Protein arginine N-methyltransferase 2	8.57e-07	NA	NA	0.5959
6. F	Q8CRU6	Uncharacterized RNA methyltransferase SE_1582	9.66e-08	NA	NA	0.7113
6. F	P22038	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.82e-08	NA	NA	0.7048
6. F	A4XQ64	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6292
6. F	Q0A6J4	Ribosomal RNA small subunit methyltransferase H	1.97e-03	NA	NA	0.67
6. F	Q6BNS9	Protein arginine N-methyltransferase 2	5.89e-07	NA	NA	0.6052
6. F	Q5E320	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.68e-06	NA	NA	0.6728
6. F	O31545	Uncharacterized RNA methyltransferase YfjO	2.55e-07	NA	NA	0.7225
6. F	Q215S4	Ribosomal RNA small subunit methyltransferase A	1.11e-07	NA	NA	0.5346
6. F	Q089S7	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.27e-07	NA	NA	0.6351
6. F	B9JUV4	Ribosomal RNA small subunit methyltransferase A	1.19e-07	NA	NA	0.564
6. F	C0R5G4	Ribosomal RNA small subunit methyltransferase A	3.02e-07	NA	NA	0.6142
6. F	Q4QNK7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.48e-06	NA	NA	0.6668
6. F	P67688	Ribosomal protein L11 methyltransferase	1.12e-07	NA	NA	0.6339
6. F	B3H1F1	tRNA U34 carboxymethyltransferase	1.14e-05	NA	NA	0.5155
6. F	Q5HUW5	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.29e-08	NA	NA	0.65
6. F	Q087X5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.77e-08	NA	NA	0.697
6. F	Q9KEF5	Uncharacterized RNA methyltransferase BH0897	3.59e-07	NA	NA	0.6884
6. F	A6VZL5	Ribosomal protein L11 methyltransferase	2.14e-08	NA	NA	0.6868
6. F	Q9PBE3	Ribosomal protein L11 methyltransferase	7.32e-08	NA	NA	0.6576
6. F	Q1QXW4	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.45e-08	NA	NA	0.6333
6. F	Q8EUW9	Ribosomal RNA small subunit methyltransferase G	7.48e-07	NA	NA	0.6475
6. F	Q8E0T7	Uncharacterized RNA methyltransferase SAG0633	5.08e-08	NA	NA	0.7334
6. F	B4RYR7	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.19e-08	NA	NA	0.6218
6. F	B2ISD7	Ribosomal protein L11 methyltransferase	1.08e-08	NA	NA	0.7301
6. F	Q6LT56	tRNA U34 carboxymethyltransferase	1.15e-05	NA	NA	0.5981
6. F	A3D9J5	Ribosomal protein L11 methyltransferase	9.19e-08	NA	NA	0.6299
6. F	B5YDR3	Ribosomal protein L11 methyltransferase	7.64e-09	NA	NA	0.6853
6. F	B1LN12	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	8.14e-08	NA	NA	0.6954
6. F	Q4QLT2	Ribosomal protein L11 methyltransferase	7.60e-08	NA	NA	0.6249
6. F	B0KJZ2	Ribosomal protein L11 methyltransferase	1.28e-07	NA	NA	0.6445
6. F	Q2SWE9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.37e-06	NA	NA	0.6622
6. F	B7HCT8	Ribosomal protein L11 methyltransferase	2.02e-08	NA	NA	0.7053
6. F	A1AGF9	Ribosomal protein L11 methyltransferase	9.87e-08	NA	NA	0.627
6. F	Q7MQ79	tRNA/tmRNA (uracil-C(5))-methyltransferase	8.75e-08	NA	NA	0.6291
6. F	Q2IX80	Ribosomal RNA small subunit methyltransferase A	1.26e-07	NA	NA	0.5775
6. F	A8ANZ1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.39e-06	NA	NA	0.6627
6. F	B1WNQ4	Ribosomal protein L11 methyltransferase	2.42e-09	NA	NA	0.7094
6. F	Q28F07	Protein arginine N-methyltransferase 1	3.65e-06	NA	NA	0.4237
6. F	Q9P3R1	Sterol 24-C-methyltransferase erg-4	1.61e-06	NA	NA	0.5515
6. F	Q9JP88	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.11e-06	NA	NA	0.6979
6. F	Q7VKW2	Ubiquinone biosynthesis O-methyltransferase	1.10e-09	NA	NA	0.7056
6. F	Q5ZVI4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.85e-07	NA	NA	0.6345
6. F	B5BGT7	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6327
6. F	A8HVI9	Ribosomal RNA small subunit methyltransferase A	2.12e-07	NA	NA	0.5854
6. F	B5REZ3	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.81e-08	NA	NA	0.7045
6. F	C3K2F6	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.39e-08	NA	NA	0.6286
6. F	B3PFU1	tRNA U34 carboxymethyltransferase	3.25e-05	NA	NA	0.6256
6. F	B3PBH5	Ribosomal protein L11 methyltransferase	3.62e-08	NA	NA	0.6944
6. F	Q88MB9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.00e-06	NA	NA	0.6346
6. F	C3L3G5	Ribosomal protein L11 methyltransferase	1.12e-08	NA	NA	0.7163
6. F	P44643	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.35e-06	NA	NA	0.6196
6. F	Q2RKY6	Ribosomal protein L11 methyltransferase	1.11e-08	NA	NA	0.6165
6. F	Q4ZPE5	tRNA U34 carboxymethyltransferase	7.47e-06	NA	NA	0.5943
6. F	A0LM89	Protein-L-isoaspartate O-methyltransferase 2	1.52e-04	NA	NA	0.6019
6. F	A4WF74	Ribosomal protein L11 methyltransferase	9.61e-08	NA	NA	0.6511
6. F	Q4V7W8	Electron transfer flavoprotein beta subunit lysine methyltransferase	6.80e-06	NA	NA	0.5853
6. F	A1U4B9	tRNA U34 carboxymethyltransferase	5.25e-05	NA	NA	0.5977
6. F	A1RP91	tRNA/tmRNA (uracil-C(5))-methyltransferase	6.53e-08	NA	NA	0.6426
6. F	Q8DSK3	Uncharacterized RNA methyltransferase SMU_1779c	9.94e-08	NA	NA	0.6879
6. F	B9KST5	Ribosomal RNA small subunit methyltransferase A	6.81e-08	NA	NA	0.5884
6. F	B7GKD0	Ribosomal protein L11 methyltransferase	1.83e-08	NA	NA	0.6458
6. F	Q6G836	Uncharacterized RNA methyltransferase SAS1819	8.89e-08	NA	NA	0.7405
6. F	B5EIQ6	tRNA U34 carboxymethyltransferase	1.44e-07	NA	NA	0.6048
6. F	Q7NCQ1	Ribosomal RNA small subunit methyltransferase H	4.08e-03	NA	NA	0.6354
6. F	B2TM01	Ribosomal protein L11 methyltransferase	7.86e-09	NA	NA	0.6962
6. F	Q8AAZ8	Ribosomal protein L11 methyltransferase	5.78e-09	NA	NA	0.667
6. F	Q8KCD5	Release factor glutamine methyltransferase	3.33e-08	NA	NA	0.6349
6. F	B4PVH6	Histone-arginine methyltransferase CARMER	1.11e-03	NA	NA	0.4322
6. F	Q2IYL6	Ribosomal RNA small subunit methyltransferase H	2.32e-03	NA	NA	0.6179
6. F	P0A8T3	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.628
6. F	A7MQZ8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.64e-06	NA	NA	0.6336
6. F	A0LTL5	Ribosomal RNA small subunit methyltransferase H	1.79e-03	NA	NA	0.6502
6. F	Q830R6	Uncharacterized RNA methyltransferase EF_2706	4.18e-08	NA	NA	0.7153
6. F	Q319D4	Ribosomal protein L11 methyltransferase	1.77e-09	NA	NA	0.6938
6. F	Q5QVT1	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.52e-08	NA	NA	0.6243
6. F	A6WS34	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.53e-08	NA	NA	0.7048
6. F	B1I7P5	Ribosomal protein L11 methyltransferase	1.01e-08	NA	NA	0.7315
6. F	Q1C824	tRNA U34 carboxymethyltransferase	1.13e-05	NA	NA	0.5688
6. F	B2K9X0	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.37e-08	NA	NA	0.7039
6. F	B6ENT4	tRNA/tmRNA (uracil-C(5))-methyltransferase	7.78e-08	NA	NA	0.6424
6. F	Q4QK61	tRNA U34 carboxymethyltransferase	9.35e-06	NA	NA	0.5409
6. F	Q73E18	Uncharacterized RNA methyltransferase BCE_0542	3.44e-07	NA	NA	0.6777
6. F	B4ET17	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.75e-08	NA	NA	0.6488
6. F	Q489G6	Ribosomal protein L11 methyltransferase	1.05e-07	NA	NA	0.6462
6. F	B5YSF1	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.69e-08	NA	NA	0.6466
6. F	F5ZEI8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.04e-06	NA	NA	0.6945
6. F	B1KHH0	tRNA U34 carboxymethyltransferase	9.72e-05	NA	NA	0.5999
6. F	Q38V22	Ribosomal RNA small subunit methyltransferase A	3.66e-07	NA	NA	0.6224
6. F	A2Z8S0	Probable protein arginine N-methyltransferase 6.2	5.87e-06	NA	NA	0.3902
6. F	Q6D178	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.73e-06	NA	NA	0.6941
6. F	Q9JW08	Ribosomal protein L11 methyltransferase	1.44e-07	NA	NA	0.6889
6. F	B2FJP0	Ribosomal protein L11 methyltransferase	5.16e-08	NA	NA	0.6612
6. F	Q4W9V1	Sterol 24-C-methyltransferase	1.54e-06	NA	NA	0.5764
6. F	Q3SRZ8	Ribosomal RNA small subunit methyltransferase A	1.27e-07	NA	NA	0.5758
6. F	Q0AWM5	Ribosomal protein L11 methyltransferase	5.66e-09	NA	NA	0.7249
6. F	B9E043	Ribosomal protein L11 methyltransferase	1.19e-08	NA	NA	0.7464
6. F	A7ZDV3	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.36e-07	NA	NA	0.6399
6. F	A9B5V4	Ribosomal protein L11 methyltransferase	4.98e-08	NA	NA	0.6357
6. F	Q3YY71	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.41e-06	NA	NA	0.7203
6. F	Q7U326	tRNA/tmRNA (uracil-C(5))-methyltransferase	7.31e-08	NA	NA	0.6781
6. F	Q99SY9	Uncharacterized RNA methyltransferase SAV1897	8.71e-08	NA	NA	0.7104
6. F	B5BBV5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.55e-08	NA	NA	0.6851
6. F	Q0AMV9	Ribosomal RNA small subunit methyltransferase H	2.00e-03	NA	NA	0.6226
6. F	Q4A9T0	Ribosomal RNA small subunit methyltransferase H	2.34e-04	NA	NA	0.8028
6. F	P0DG15	Uncharacterized RNA methyltransferase SPs0836	6.48e-08	NA	NA	0.682
6. F	A6TES6	Ribosomal protein L11 methyltransferase	1.10e-07	NA	NA	0.6469
6. F	B7LRN4	Ribosomal protein L11 methyltransferase	9.10e-08	NA	NA	0.6334
6. F	Q99Z86	Uncharacterized RNA methyltransferase SPy_1346/M5005_Spy1098	6.37e-08	NA	NA	0.6969
6. F	Q65UH7	tRNA U34 carboxymethyltransferase	7.60e-05	NA	NA	0.5404
6. F	Q5X7S8	Ribosomal protein L11 methyltransferase	8.49e-09	NA	NA	0.6772
6. F	Q9KSU3	tRNA U34 carboxymethyltransferase	1.07e-05	NA	NA	0.5947
6. F	A4YB19	Ribosomal protein L11 methyltransferase	8.12e-08	NA	NA	0.6306
6. F	Q0HRR5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.40e-08	NA	NA	0.636
6. F	Q0VP26	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.11e-07	NA	NA	0.6382
6. F	A5F277	tRNA U34 carboxymethyltransferase	1.09e-05	NA	NA	0.595
6. F	P31049	Probable fatty acid methyltransferase	1.37e-06	NA	NA	0.6328
6. F	Q8Y6D6	Uncharacterized RNA methyltransferase lmo1751	3.22e-08	NA	NA	0.7357
6. F	C0R598	Ribosomal RNA small subunit methyltransferase H	7.75e-04	NA	NA	0.6645
6. F	C4ZZP7	Protein-L-isoaspartate O-methyltransferase	2.35e-07	NA	NA	0.5347
6. F	B2J397	Ribosomal protein L11 methyltransferase	9.89e-09	NA	NA	0.6515
6. F	Q0TJI9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.64e-08	NA	NA	0.6462
6. F	Q8E1E4	Uncharacterized RNA methyltransferase SAG0413	2.61e-08	NA	NA	0.6766
6. F	B6ENA3	Ribosomal protein L11 methyltransferase	1.10e-07	NA	NA	0.6275
6. F	C4LBR5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.24e-06	NA	NA	0.6732
6. F	Q2PG46	Dimethyladenosine transferase 1, mitochondrial	4.15e-05	NA	NA	0.5869
6. F	Q3AF06	Ribosomal protein L11 methyltransferase	4.45e-09	NA	NA	0.6881
6. F	A5UIB7	Ribosomal protein L11 methyltransferase	7.97e-08	NA	NA	0.6249
6. F	Q057T6	Ribosomal RNA small subunit methyltransferase H	2.14e-03	NA	NA	0.5997
6. F	A8B4Q0	tRNA (guanine(37)-N1)-methyltransferase	6.93e-04	NA	NA	0.5974
6. F	Q32H78	tRNA U34 carboxymethyltransferase	8.78e-06	NA	NA	0.59
6. F	A1VZH5	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.20e-08	NA	NA	0.6476
6. F	A3Q9Q5	Ribosomal protein L11 methyltransferase	1.62e-07	NA	NA	0.6896
6. F	A3M6R7	Ribosomal protein L11 methyltransferase	5.24e-08	NA	NA	0.64
6. F	B9LA97	tRNA/tmRNA (uracil-C(5))-methyltransferase	3.54e-08	NA	NA	0.6828
6. F	B0VLL0	Ribosomal protein L11 methyltransferase	5.29e-08	NA	NA	0.6991
6. F	Q12SP8	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.28e-07	NA	NA	0.6977
6. F	B5F101	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.09e-08	NA	NA	0.6815
6. F	A6VM22	Ribosomal protein L11 methyltransferase	9.76e-08	NA	NA	0.6073
6. F	Q3K6G9	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.14e-08	NA	NA	0.6164
6. F	B2V963	Ribosomal RNA small subunit methyltransferase A	8.32e-07	NA	NA	0.6006
6. F	B3PUU6	Ribosomal RNA small subunit methyltransferase A	9.59e-08	NA	NA	0.5739
6. F	Q5PAV9	Ribosomal RNA small subunit methyltransferase A	3.31e-07	NA	NA	0.6201
6. F	Q4FUU5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.17e-06	NA	NA	0.6055
6. F	A5U028	Methoxy mycolic acid synthase MmaA3	1.10e-07	NA	NA	0.6608
6. F	A5UD93	Ribosomal protein L11 methyltransferase	7.86e-08	NA	NA	0.6223
6. F	Q2SJW1	tRNA U34 carboxymethyltransferase	8.70e-06	NA	NA	0.5889
6. F	B4T0E3	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.94e-08	NA	NA	0.6928
6. F	B6EKM3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.08e-06	NA	NA	0.7003
6. F	B4KA23	Histone-arginine methyltransferase CARMER	1.31e-03	NA	NA	0.4438
6. F	B7NU35	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.40e-08	NA	NA	0.6861
6. F	Q5PEJ4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.72e-06	NA	NA	0.6468
6. F	Q6KHR2	Ribosomal RNA small subunit methyltransferase H	1.10e-03	NA	NA	0.6286
6. F	Q1QA78	Ribosomal protein L11 methyltransferase	3.01e-08	NA	NA	0.7167
6. F	P0DG14	Uncharacterized RNA methyltransferase SpyM3_1024	6.35e-08	NA	NA	0.6822
6. F	P0A5P1	Cyclopropane mycolic acid synthase 2	6.07e-07	NA	NA	0.6371
6. F	Q8Y6I1	Uncharacterized RNA methyltransferase lmo1703	5.40e-08	NA	NA	0.7426
6. F	Q8DNH6	Uncharacterized RNA methyltransferase spr1717	7.33e-08	NA	NA	0.6734
6. F	Q8EI95	tRNA1(Val) (adenine(37)-N6)-methyltransferase	8.66e-09	NA	NA	0.6207
6. F	B4S0J9	tRNA U34 carboxymethyltransferase	2.20e-05	NA	NA	0.6047
6. F	Q57R80	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.02e-08	NA	NA	0.7089
6. F	Q885Y8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.34e-07	NA	NA	0.7078
6. F	C4L7I7	Ribosomal RNA large subunit methyltransferase I	1.25e-08	NA	NA	0.6688
6. F	I1RNL0	Sphingolipid C9-methyltransferase 2	2.86e-05	NA	NA	0.6004
6. F	Q8KZ94	Demethylrebeccamycin-D-glucose O-methyltransferase	1.12e-07	NA	NA	0.5727
6. F	Q322J0	tRNA U34 carboxymethyltransferase	8.98e-06	NA	NA	0.59
6. F	Q0T3Q7	tRNA U34 carboxymethyltransferase	1.06e-05	NA	NA	0.5901
6. F	Q1INS6	Protein-L-isoaspartate O-methyltransferase	5.58e-07	NA	NA	0.5505
6. F	Q39SM2	tRNA U34 carboxymethyltransferase	1.20e-05	NA	NA	0.6666
6. F	Q820Z9	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.80e-08	NA	NA	0.7003
6. F	A5FUK2	Ribosomal RNA small subunit methyltransferase H	9.43e-04	NA	NA	0.6413
6. F	Q1WRS8	Ribosomal RNA small subunit methyltransferase G	1.78e-09	NA	NA	0.63
6. F	Q9PAY7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.10e-06	NA	NA	0.5975
6. F	A4YZL1	Ribosomal RNA small subunit methyltransferase H	1.42e-03	NA	NA	0.6242
6. F	Q9CLW2	Ribosomal protein L11 methyltransferase	9.04e-08	NA	NA	0.6118
6. F	Q1QDU2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.55e-06	NA	NA	0.6105
6. F	B2GF22	Ribosomal RNA small subunit methyltransferase G	3.60e-09	NA	NA	0.618
6. F	B0V5N2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.64e-06	NA	NA	0.6238
6. F	A5IFZ9	Ribosomal RNA small subunit methyltransferase H	3.14e-03	NA	NA	0.589
6. F	Q5FAH7	Ribosomal protein L11 methyltransferase	1.34e-07	NA	NA	0.6915
6. F	C6DEQ3	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.42e-08	NA	NA	0.661
6. F	B8E680	Ribosomal protein L11 methyltransferase	9.89e-08	NA	NA	0.6306
6. F	Q6A9R0	Ribosomal RNA small subunit methyltransferase H	1.35e-03	NA	NA	0.6558
6. F	B9KIG4	Ribosomal RNA small subunit methyltransferase A	3.49e-07	NA	NA	0.6405
6. F	A5I638	Ribosomal protein L11 methyltransferase	1.22e-08	NA	NA	0.6857
6. F	A3QB25	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.98e-08	NA	NA	0.6841
6. F	A0KGG9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.19e-06	NA	NA	0.6851
6. F	A4SUS4	Ribosomal RNA small subunit methyltransferase G	4.79e-11	NA	NA	0.6313
6. F	B6I1E9	tRNA U34 carboxymethyltransferase	8.94e-06	NA	NA	0.5902
6. F	A3DF23	Ribosomal protein L11 methyltransferase	1.20e-08	NA	NA	0.6902
6. F	O07678	Ribosomal protein L11 methyltransferase	6.73e-09	NA	NA	0.7048
6. F	Q83S14	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.18e-08	NA	NA	0.6448
6. F	Q5HEM5	Uncharacterized RNA methyltransferase SACOL1957	8.52e-08	NA	NA	0.712
6. F	Q48DT0	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.71e-08	NA	NA	0.6516
6. F	Q3Z2P7	tRNA U34 carboxymethyltransferase	8.91e-06	NA	NA	0.5902
6. F	P9WPB2	Cyclopropane mycolic acid synthase 3	2.21e-04	NA	NA	0.6329
6. F	B7IYG5	Ribosomal protein L11 methyltransferase	2.00e-08	NA	NA	0.7035
6. F	O08249	Protein-L-isoaspartate O-methyltransferase	1.47e-07	NA	NA	0.6267
6. F	C4K2J5	Ribosomal RNA small subunit methyltransferase A	1.16e-06	NA	NA	0.6004
6. F	A4WDX1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.64e-06	NA	NA	0.6955
6. F	A9M0C4	Ubiquinone biosynthesis O-methyltransferase	1.32e-09	NA	NA	0.6888
6. F	A5IBU7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.78e-07	NA	NA	0.6294
6. F	Q8X6Q5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.07e-08	NA	NA	0.6381
6. F	Q4ZN40	Ribosomal protein L11 methyltransferase	9.48e-08	NA	NA	0.6276
6. F	C4ZAZ2	Ribosomal protein L11 methyltransferase	1.84e-08	NA	NA	0.6488
6. F	B7H018	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.33e-06	NA	NA	0.6217
6. F	Q6F847	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.85e-07	NA	NA	0.6163
6. F	A6WTE5	Ribosomal protein L11 methyltransferase	1.18e-07	NA	NA	0.6703
6. F	Q7MF74	Polyamine aminopropyltransferase	2.34e-05	NA	NA	0.6296
6. F	C5D363	Ribosomal RNA small subunit methyltransferase A	3.72e-07	NA	NA	0.5502
6. F	Q3SK67	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.91e-07	NA	NA	0.6155
6. F	Q7VXM6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	6.35e-07	NA	NA	0.6686
6. F	H2E7T7	Botryococcene C-methyltransferase	5.09e-05	NA	NA	0.5358
6. F	C0Q481	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.03e-08	NA	NA	0.6384
6. F	Q0TGW1	tRNA U34 carboxymethyltransferase	9.05e-06	NA	NA	0.5857
6. F	B5QXR0	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.65e-08	NA	NA	0.7007
6. F	A5F3S3	Ribosomal protein L11 methyltransferase	1.19e-07	NA	NA	0.6787
6. F	A5CXB2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.26e-07	NA	NA	0.6789
6. F	Q63UT8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.20e-06	NA	NA	0.669
6. F	B8CWI8	Ribosomal RNA small subunit methyltransferase H	3.29e-06	NA	NA	0.6208
6. F	Q87C45	Ribosomal protein L11 methyltransferase	6.89e-08	NA	NA	0.6452
6. F	Q1CAC8	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.49e-08	NA	NA	0.7016
6. F	Q3BVV1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.93e-07	NA	NA	0.6054
6. F	Q4K6X6	tRNA U34 carboxymethyltransferase	2.69e-06	NA	NA	0.6429
6. F	Q5QVT9	Ribosomal protein L11 methyltransferase	4.82e-08	NA	NA	0.6154
6. F	A6WNQ9	tRNA U34 carboxymethyltransferase	1.25e-04	NA	NA	0.5924
6. F	Q3JC88	Ribosomal protein L11 methyltransferase	2.37e-08	NA	NA	0.6865
6. F	B4GZ20	Histone-arginine methyltransferase CARMER	1.17e-03	NA	NA	0.4034
6. F	Q7U1K0	Methoxy mycolic acid synthase MmaA3	3.03e-07	NA	NA	0.6764
6. F	C3PPC3	Ribosomal RNA small subunit methyltransferase A	8.95e-07	NA	NA	0.6123
6. F	Q9RU72	Ribosomal protein L11 methyltransferase	2.11e-08	NA	NA	0.6065
6. F	A8AIQ7	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.26e-08	NA	NA	0.659
6. F	Q2GK29	Ribosomal RNA small subunit methyltransferase H	1.22e-03	NA	NA	0.6434
6. F	Q7VAM5	Ribosomal protein L11 methyltransferase	6.52e-09	NA	NA	0.7251
6. F	Q2GE45	Ribosomal RNA small subunit methyltransferase A	2.81e-07	NA	NA	0.6173
6. F	Q634M9	Ribosomal protein L11 methyltransferase	2.72e-08	NA	NA	0.7035
6. F	B1XT48	Ribosomal protein L11 methyltransferase	4.77e-07	NA	NA	0.7266
6. F	A1AT86	Ribosomal protein L11 methyltransferase	3.04e-08	NA	NA	0.6766
6. F	B7NFR5	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.30e-08	NA	NA	0.6988
6. F	P0A8T4	Ribosomal protein L11 methyltransferase	1.27e-07	NA	NA	0.6318
6. F	Q6DAJ5	Ribosomal protein L11 methyltransferase	9.67e-08	NA	NA	0.6389
6. F	Q8PB48	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.47e-07	NA	NA	0.6078
6. F	A7HVT9	Ribosomal RNA small subunit methyltransferase H	1.30e-03	NA	NA	0.6462
6. F	B3CPY6	Ribosomal RNA small subunit methyltransferase A	1.93e-07	NA	NA	0.6136
6. F	Q87VS3	Ribosomal protein L11 methyltransferase	7.13e-08	NA	NA	0.633
6. F	Q8DPY7	Uncharacterized RNA methyltransferase spr0932	1.08e-06	NA	NA	0.666
6. F	B4EUF2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.78e-06	NA	NA	0.6953
6. F	Q5ZYB1	Ribosomal protein L11 methyltransferase	9.77e-09	NA	NA	0.6801
6. F	Q81Z48	Uncharacterized RNA methyltransferase BA_0426/GBAA_0426/BAS0414	3.15e-07	NA	NA	0.6679
6. F	A7HNX8	Ribosomal RNA small subunit methyltransferase G	3.11e-09	NA	NA	0.6187
6. F	A0L8B5	Ribosomal RNA large subunit methyltransferase K/L	7.64e-05	NA	NA	0.6309
6. F	Q9KJ21	Sarcosine/dimethylglycine N-methyltransferase	9.42e-09	NA	NA	0.5574
6. F	C5A0R4	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.22e-08	NA	NA	0.7
6. F	B3Q9S4	Ribosomal RNA small subunit methyltransferase A	1.77e-07	NA	NA	0.5711
6. F	P45558	Ribosomal protein L11 methyltransferase	7.15e-09	NA	NA	0.6677
6. F	Q04J12	Ribosomal protein L11 methyltransferase	9.84e-09	NA	NA	0.7302
6. F	Q5HUG5	Ribosomal RNA small subunit methyltransferase G	7.11e-10	NA	NA	0.5862
6. F	Q814A6	Uncharacterized RNA methyltransferase BC_0364	6.31e-08	NA	NA	0.6818
6. F	Q8Z446	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.66e-06	NA	NA	0.647
6. F	Q0BEW2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.28e-06	NA	NA	0.6532
6. F	Q13Z67	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.84e-06	NA	NA	0.6506
6. F	B0K3X8	Ribosomal protein L11 methyltransferase	7.55e-09	NA	NA	0.6469
6. F	P0DG16	Uncharacterized RNA methyltransferase SpyM3_1299	6.09e-08	NA	NA	0.6717
6. F	Q2GGS8	Ribosomal RNA small subunit methyltransferase H	8.84e-04	NA	NA	0.613
6. F	Q4FRP0	Ribosomal protein L11 methyltransferase	3.03e-08	NA	NA	0.7059
6. F	Q8DAP0	tRNA U34 carboxymethyltransferase	8.34e-05	NA	NA	0.5879
6. F	B5ELD1	Ribosomal RNA small subunit methyltransferase H	2.89e-03	NA	NA	0.6141
6. F	Q4KFI6	Ribosomal RNA large subunit methyltransferase K/L	7.96e-05	NA	NA	0.6366
6. F	Q038Q5	Ribosomal protein L11 methyltransferase	1.23e-08	NA	NA	0.6909
6. F	E1W218	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	7.31e-07	NA	NA	0.67
6. F	A9ER52	Ribosomal protein L11 methyltransferase	4.17e-08	NA	NA	0.6524
6. F	Q39FQ4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.29e-06	NA	NA	0.6639
6. F	Q4ZQ44	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.23e-07	NA	NA	0.672
6. F	Q7MJ71	tRNA U34 carboxymethyltransferase	8.21e-05	NA	NA	0.5878
6. F	Q5PGN2	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.76e-08	NA	NA	0.7036
6. F	Q7N839	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.00e-06	NA	NA	0.65
6. F	Q5M1S5	Ribosomal protein L11 methyltransferase	1.62e-08	NA	NA	0.7325
6. F	A7IGF4	Ribosomal RNA small subunit methyltransferase H	1.92e-03	NA	NA	0.6278
6. F	A8EZN3	Ribosomal RNA small subunit methyltransferase A	1.82e-07	NA	NA	0.5917
6. F	Q8F9A3	Uncharacterized RNA methyltransferase LA_0292	2.16e-07	NA	NA	0.6802
6. F	A2RHI1	Ribosomal protein L11 methyltransferase	1.42e-08	NA	NA	0.6577
6. F	Q64VV4	Ribosomal protein L11 methyltransferase	4.48e-09	NA	NA	0.7573
6. F	Q1MJ01	Ribosomal RNA small subunit methyltransferase A	1.13e-07	NA	NA	0.5761
6. F	Q0I127	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.27e-06	NA	NA	0.6998
6. F	A9BH07	Protein-L-isoaspartate O-methyltransferase	2.79e-07	NA	NA	0.6453
6. F	B5XV15	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.37e-06	NA	NA	0.7072
6. F	Q3K7D4	tRNA U34 carboxymethyltransferase	1.07e-05	NA	NA	0.6298
6. F	B0KHR5	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.57e-08	NA	NA	0.5988
6. F	P67689	Ribosomal protein L11 methyltransferase	9.64e-08	NA	NA	0.6338
6. F	Q92GV0	Ribosomal RNA small subunit methyltransferase A	1.08e-06	NA	NA	0.6128
6. F	Q483D0	tRNA U34 carboxymethyltransferase	1.75e-05	NA	NA	0.6336
6. F	B1J3Q4	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.66e-08	NA	NA	0.6301
6. F	B1IWR3	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.59e-08	NA	NA	0.6823
6. F	A0A067XMT3	Methyltransferase ptaI	1.77e-05	NA	NA	0.5478
6. F	Q92AQ7	Uncharacterized RNA methyltransferase lin1863	3.13e-08	NA	NA	0.7359
6. F	A5VJF8	Ribosomal protein L11 methyltransferase	1.02e-08	NA	NA	0.6596
6. F	A8GK75	Ribosomal protein L11 methyltransferase	1.10e-07	NA	NA	0.6305
6. F	B2U4X2	tRNA U34 carboxymethyltransferase	8.94e-06	NA	NA	0.5862
6. F	Q3YWZ0	Ribosomal protein L11 methyltransferase	1.05e-07	NA	NA	0.6449
6. F	A8GT85	Ribosomal RNA small subunit methyltransferase A	9.95e-07	NA	NA	0.5897
6. F	B4JXV2	Histone-arginine methyltransferase CARMER	1.48e-03	NA	NA	0.4411
6. F	B1LGM4	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6326
6. F	B5QYK4	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.00e-08	NA	NA	0.7084
6. F	A0AIS2	Ribosomal protein L11 methyltransferase	1.42e-08	NA	NA	0.7511
6. F	B8E5Q5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	9.39e-08	NA	NA	0.7146
6. F	P9WJ62	16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA	5.85e-07	NA	NA	0.5917
6. F	Q88MX8	tRNA U34 carboxymethyltransferase	9.51e-06	NA	NA	0.5783
6. F	Q5C9L6	(S)-coclaurine N-methyltransferase	9.25e-07	NA	NA	0.5729
6. F	Q8ZME1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.74e-06	NA	NA	0.6468
6. F	B7J3W0	Ribosomal RNA small subunit methyltransferase H	2.75e-03	NA	NA	0.6338
6. F	A6VMT0	tRNA U34 carboxymethyltransferase	1.06e-05	NA	NA	0.5393
6. F	Q66CN7	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.34e-08	NA	NA	0.6981
6. F	Q02FH0	Ribosomal protein L11 methyltransferase	6.66e-08	NA	NA	0.6976
6. F	C3K6W5	Ribosomal protein L11 methyltransferase	1.04e-07	NA	NA	0.6858
6. F	Q97LN4	Uncharacterized RNA methyltransferase CA_C0523	5.14e-08	NA	NA	0.7048
6. F	B7K2J4	Ribosomal protein L11 methyltransferase	3.26e-09	NA	NA	0.6987
6. F	B7V1D2	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.31e-08	NA	NA	0.6485
6. F	B0BW04	Ribosomal RNA small subunit methyltransferase G	2.71e-06	NA	NA	0.597
6. F	B4NKI9	Histone-arginine methyltransferase CARMER	1.24e-03	NA	NA	0.4115
6. F	Q1QNV1	Ribosomal RNA small subunit methyltransferase H	2.11e-03	NA	NA	0.6244
6. F	A0K7U1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.22e-06	NA	NA	0.6654
6. F	Q5E263	Ribosomal protein L11 methyltransferase	1.00e-07	NA	NA	0.6278
6. F	Q5LEW2	Ribosomal protein L11 methyltransferase	6.38e-09	NA	NA	0.7579
6. F	A6TD57	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.47e-06	NA	NA	0.7209
6. F	Q7XB08	(S)-coclaurine N-methyltransferase	4.67e-07	NA	NA	0.5878
6. F	B0UV84	Ribosomal protein L11 methyltransferase	7.95e-08	NA	NA	0.6506
6. F	A9L5E5	Ribosomal protein L11 methyltransferase	9.12e-08	NA	NA	0.6434
6. F	Q3IDM6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.07e-07	NA	NA	0.7009
6. F	B5YSY4	Ribosomal protein L11 methyltransferase	1.18e-07	NA	NA	0.6329
6. F	Q0HUY4	tRNA U34 carboxymethyltransferase	1.13e-04	NA	NA	0.5729
6. F	C1CG04	Ribosomal protein L11 methyltransferase	1.15e-08	NA	NA	0.7327
6. F	A8HZ68	Ribosomal RNA small subunit methyltransferase H	1.79e-03	NA	NA	0.6204
6. F	B0JX03	Ribosomal protein L11 methyltransferase	8.47e-09	NA	NA	0.682
6. F	Q5FKI8	Ribosomal protein L11 methyltransferase	1.15e-08	NA	NA	0.6244
6. F	B0KA79	Ribosomal protein L11 methyltransferase	7.22e-09	NA	NA	0.6274
6. F	Q03NV0	Ribosomal RNA small subunit methyltransferase G	3.76e-09	NA	NA	0.6183
6. F	L0E172	Methyltransferase phqN	3.39e-07	NA	NA	0.5724
6. F	Q6CPN1	Protein arginine N-methyltransferase 2	7.42e-07	NA	NA	0.5961
6. F	Q2NI56	tRNA (guanine(26)-N(2))-dimethyltransferase	1.08e-04	NA	NA	0.6817
6. F	Q32AE5	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.02e-08	NA	NA	0.7032
6. F	Q87XG5	tRNA U34 carboxymethyltransferase	1.02e-05	NA	NA	0.6001
6. F	A0A0A2IBN3	O-methyltransferase cnsE	2.30e-08	NA	NA	0.6368
6. F	Q6D3S2	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.94e-08	NA	NA	0.6541
6. F	A3N3R7	tRNA/tmRNA (uracil-C(5))-methyltransferase	9.73e-08	NA	NA	0.6383
6. F	A3MRB1	Ribosomal protein L11 methyltransferase	2.43e-07	NA	NA	0.675
6. F	B7LA67	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.30e-08	NA	NA	0.6998
6. F	Q7N6G6	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	4.95e-08	NA	NA	0.6305
6. F	Q9CDP0	Uncharacterized RNA methyltransferase YwfF	1.14e-07	NA	NA	0.6753
6. F	Q1IDL9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.68e-07	NA	NA	0.6529
6. F	C3P8L8	Ribosomal protein L11 methyltransferase	1.99e-08	NA	NA	0.709
6. F	Q07ZR3	Ribosomal RNA large subunit methyltransferase K/L	1.75e-05	NA	NA	0.7156
6. F	Q6GFG0	Uncharacterized RNA methyltransferase SAR1988	9.35e-08	NA	NA	0.7159
6. F	B1LD00	tRNA U34 carboxymethyltransferase	8.96e-06	NA	NA	0.59
6. F	C3L5R5	Ribosomal protein L11 methyltransferase	2.71e-08	NA	NA	0.705
6. F	B6I5I3	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.15e-08	NA	NA	0.6865
6. F	B8F4B1	Ubiquinone biosynthesis O-methyltransferase	1.70e-09	NA	NA	0.6787
6. F	C4Z0Q0	Ribosomal protein L11 methyltransferase	2.69e-08	NA	NA	0.6424
6. F	Q8R5Z8	Uncharacterized RNA methyltransferase FN1713	5.40e-08	NA	NA	0.7325
6. F	A7FDQ3	Ribosomal protein L11 methyltransferase	1.30e-07	NA	NA	0.6156
6. F	Q87WX7	Ribosomal RNA small subunit methyltransferase H	2.14e-03	NA	NA	0.6105
6. F	Q5WW81	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.10e-07	NA	NA	0.6273
6. F	B7LN23	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.33e-08	NA	NA	0.6485
6. F	Q3ZXE0	Ribosomal RNA small subunit methyltransferase G	3.44e-09	NA	NA	0.623
6. F	Q7VKU9	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.78e-06	NA	NA	0.653
6. F	C4ZSZ5	Ribosomal protein L11 methyltransferase	9.17e-08	NA	NA	0.6329
6. F	A9L1I5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.82e-08	NA	NA	0.7055
6. F	Q73IR3	Ribosomal RNA small subunit methyltransferase A	4.72e-07	NA	NA	0.6044
6. F	B7MIA5	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.40e-08	NA	NA	0.6152
6. F	B7MC29	Ribosomal protein L11 methyltransferase	1.05e-07	NA	NA	0.6319
6. F	Q7MHP7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.10e-06	NA	NA	0.6488
6. F	B1XHM8	Ribosomal protein L11 methyltransferase	9.87e-08	NA	NA	0.6329
6. F	B7UZJ8	Ribosomal RNA small subunit methyltransferase H	2.01e-03	NA	NA	0.6144
6. F	O25703	Ribosomal RNA small subunit methyltransferase G	1.71e-10	NA	NA	0.6177
6. F	A5EIA8	Ribosomal RNA small subunit methyltransferase A	1.15e-07	NA	NA	0.5752
6. F	Q9HUW3	Ribosomal protein L11 methyltransferase	6.67e-08	NA	NA	0.6492
6. F	A7NI01	Protein-L-isoaspartate O-methyltransferase	6.93e-07	NA	NA	0.5552
6. F	Q0TE74	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.37e-06	NA	NA	0.7212
6. F	D3BT31	tRNA (guanine(37)-N1)-methyltransferase	1.83e-06	NA	NA	0.5768
6. F	O26833	Uncharacterized protein MTH_738	2.72e-07	NA	NA	0.5095
6. F	A7GY40	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.56e-07	NA	NA	0.6556
6. F	Q0T031	Ribosomal protein L11 methyltransferase	1.02e-07	NA	NA	0.6276
6. F	Q3AAD7	Ribosomal RNA small subunit methyltransferase H	6.34e-04	NA	NA	0.6418
6. F	Q3STT6	Ribosomal RNA small subunit methyltransferase H	1.83e-03	NA	NA	0.6408
6. F	P60093	Ribosomal protein L11 methyltransferase	4.43e-09	NA	NA	0.6709
6. F	Q71YR7	Uncharacterized RNA methyltransferase LMOf2365_1776	3.41e-08	NA	NA	0.7364
6. F	A2BSS6	Ribosomal protein L11 methyltransferase	1.69e-09	NA	NA	0.7078
6. F	Q8PMU6	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.21e-06	NA	NA	0.5971
6. F	A8G6G4	Ribosomal protein L11 methyltransferase	2.59e-09	NA	NA	0.7006
6. F	Q0SRE9	Ribosomal protein L11 methyltransferase	6.84e-09	NA	NA	0.669
6. F	Q5XBK8	Uncharacterized RNA methyltransferase M6_Spy1070	6.47e-08	NA	NA	0.6817
6. F	B2G582	Ribosomal RNA small subunit methyltransferase G	2.48e-09	NA	NA	0.6145
6. F	Q81ZD6	Uncharacterized RNA methyltransferase BA_0333/GBAA_0333/BAS0318	6.79e-08	NA	NA	0.6817
6. F	Q60A25	Ribosomal protein L11 methyltransferase	5.63e-08	NA	NA	0.6477
6. F	A5PKL6	Glutathione S-transferase C-terminal domain-containing protein	1.78e-03	NA	NA	0.6978
6. F	Q4UMV1	Ribosomal RNA small subunit methyltransferase A	9.03e-08	NA	NA	0.6048
6. F	Q8PQ06	Ribosomal protein L11 methyltransferase	5.03e-08	NA	NA	0.6602
6. F	Q1R669	Ribosomal protein L11 methyltransferase	1.02e-07	NA	NA	0.6329
6. F	A6VCH5	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.46e-08	NA	NA	0.6483
6. F	B3M1E1	Histone-arginine methyltransferase CARMER	1.18e-03	NA	NA	0.4414
6. F	Q6F9P9	Ribosomal protein L11 methyltransferase	7.44e-09	NA	NA	0.6926
6. F	B8ZMW2	Ribosomal protein L11 methyltransferase	1.05e-08	NA	NA	0.7311
6. F	A0KS74	Ribosomal protein L11 methyltransferase	8.90e-08	NA	NA	0.6463
6. F	A9AWD7	(+)-O-methylkolavelool synthase	6.11e-08	NA	NA	0.5354
6. F	P60091	Ribosomal protein L11 methyltransferase	2.21e-07	NA	NA	0.6305
6. F	Q8EEE6	tRNA U34 carboxymethyltransferase	1.01e-04	NA	NA	0.5734
6. F	Q6VRB0	Protein arginine N-methyltransferase 1-B	3.60e-06	NA	NA	0.4244
6. F	F2GA29	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.41e-06	NA	NA	0.6797
6. F	B7MQW3	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.57e-08	NA	NA	0.6479
6. F	A8IEF3	Protein arginine N-methyltransferase 1	3.74e-06	NA	NA	0.4115
6. F	D0JIM5	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.09e-08	NA	NA	0.6577
6. F	B8ETL4	Ribosomal RNA small subunit methyltransferase H	1.70e-03	NA	NA	0.7303
6. F	Q4ZNF5	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.71e-08	NA	NA	0.6516
6. F	Q0I1Y6	Ribosomal protein L11 methyltransferase	6.33e-08	NA	NA	0.6379
6. F	C1KVB8	Ribosomal protein L11 methyltransferase	1.42e-08	NA	NA	0.7317
6. F	Q3IIQ3	tRNA U34 carboxymethyltransferase	1.51e-05	NA	NA	0.6367
6. F	Q88VP9	Ribosomal protein L11 methyltransferase	1.40e-08	NA	NA	0.6699
6. F	Q31N39	Ribosomal protein L11 methyltransferase	3.13e-09	NA	NA	0.7458
6. F	Q9KF10	Uncharacterized RNA methyltransferase BH0687	2.30e-07	NA	NA	0.7242
6. F	C6E229	tRNA U34 carboxymethyltransferase	1.50e-05	NA	NA	0.5966
6. F	G2K044	Ribosomal protein L11 methyltransferase	1.43e-08	NA	NA	0.7447
6. F	A3D474	tRNA U34 carboxymethyltransferase	2.27e-05	NA	NA	0.6073
6. F	Q8DC56	Protein-L-isoaspartate O-methyltransferase	2.65e-07	NA	NA	0.5853
6. F	Q3YS70	Ribosomal RNA small subunit methyltransferase A	1.33e-07	NA	NA	0.6023
6. F	Q4A7X8	Ribosomal RNA small subunit methyltransferase H	2.27e-04	NA	NA	0.6317
6. F	D3VBF7	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.01e-08	NA	NA	0.6811
6. F	B5XND9	Ribosomal protein L11 methyltransferase	1.28e-07	NA	NA	0.6507
6. F	B8J8E0	Ribosomal RNA small subunit methyltransferase H	1.51e-03	NA	NA	0.6237
6. F	Q7U339	tRNA/tmRNA (uracil-C(5))-methyltransferase	2.70e-08	NA	NA	0.7013
6. F	Q8KGF9	Uncharacterized RNA methyltransferase CT0009	3.59e-06	NA	NA	0.6559
6. F	Q8XIK5	Uncharacterized RNA methyltransferase CPE2114	3.53e-07	NA	NA	0.6572
6. F	A3N2I5	Ribosomal protein L11 methyltransferase	9.67e-08	NA	NA	0.5955
6. F	Q4USG1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	8.79e-07	NA	NA	0.6065
6. F	Q8Z313	tRNA/tmRNA (uracil-C(5))-methyltransferase	5.60e-08	NA	NA	0.6559
6. F	D0L1G3	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.32e-08	NA	NA	0.6705
6. F	A9NA25	Ribosomal RNA small subunit methyltransferase H	8.66e-04	NA	NA	0.5904
6. F	A7MXI3	Ribosomal protein L11 methyltransferase	1.83e-07	NA	NA	0.6314
6. F	Q665E3	Ribosomal protein L11 methyltransferase	1.10e-07	NA	NA	0.6261
6. F	B2U2N5	Ribosomal protein L11 methyltransferase	9.72e-08	NA	NA	0.6325
6. F	B8F6T6	Ribosomal protein L11 methyltransferase	5.70e-08	NA	NA	0.5906
6. F	B1J4E4	tRNA U34 carboxymethyltransferase	9.35e-06	NA	NA	0.6516
6. F	A4SPN8	tRNA U34 carboxymethyltransferase	1.67e-05	NA	NA	0.6216
6. F	B3CMB5	Ribosomal RNA small subunit methyltransferase H	7.35e-04	NA	NA	0.6619
6. F	Q8Z5W0	tRNA U34 carboxymethyltransferase	1.15e-05	NA	NA	0.5971
6. F	C0QJG7	tRNA U34 carboxymethyltransferase	6.67e-06	NA	NA	0.6211
6. F	Q8DD03	Ribosomal protein L11 methyltransferase	1.03e-07	NA	NA	0.6517
6. F	Q88E14	tRNA/tmRNA (uracil-C(5))-methyltransferase	1.42e-08	NA	NA	0.6135
6. F	A1JJR0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.80e-06	NA	NA	0.6477
6. F	Q97P62	Ribosomal protein L11 methyltransferase	1.13e-08	NA	NA	0.7317
6. F	A9R4V6	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.37e-08	NA	NA	0.7048
6. F	B2HTF7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.32e-06	NA	NA	0.6118
6. F	Q3YV11	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.55e-08	NA	NA	0.6998
6. F	B4ETP0	tRNA U34 carboxymethyltransferase	9.77e-06	NA	NA	0.5995
6. F	Q892R2	Ribosomal protein L11 methyltransferase	1.23e-08	NA	NA	0.6528
6. F	A7ZSF3	Ribosomal protein L11 methyltransferase	9.49e-08	NA	NA	0.6334
6. F	A9AUP1	Protein-L-isoaspartate O-methyltransferase	9.05e-07	NA	NA	0.4819
6. F	C4ZQF5	tRNA U34 carboxymethyltransferase	9.17e-06	NA	NA	0.5816
6. F	Q8P017	Uncharacterized RNA methyltransferase spyM18_1615	6.10e-08	NA	NA	0.6712
6. F	Q5X5A8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.84e-07	NA	NA	0.6371
6. F	A7H342	Ribosomal RNA small subunit methyltransferase G	5.60e-10	NA	NA	0.5806
6. F	A2XYY8	Probable protein arginine N-methyltransferase 6.1	1.80e-04	NA	NA	0.3849
6. F	Q31U23	tRNA/tmRNA (uracil-C(5))-methyltransferase	4.87e-08	NA	NA	0.7002
6. F	B5ZWD8	Ribosomal RNA small subunit methyltransferase A	1.27e-07	NA	NA	0.5702
6. F	Q32B79	Ribosomal protein L11 methyltransferase	9.66e-08	NA	NA	0.6329
6. F	Q1DD74	Ribosomal protein L11 methyltransferase	1.01e-07	NA	NA	0.6933
6. F	Q1I4C5	Ribosomal protein L11 methyltransferase	1.06e-07	NA	NA	0.6867
6. F	Q15NL3	tRNA U34 carboxymethyltransferase	1.40e-05	NA	NA	0.6256
6. F	B5Z3A5	Protein-L-isoaspartate O-methyltransferase	2.35e-07	NA	NA	0.5348
6. F	B4SL82	Ribosomal protein L11 methyltransferase	5.40e-08	NA	NA	0.6328
6. F	C4LAF1	Ribosomal protein L11 methyltransferase	1.43e-07	NA	NA	0.6377
6. F	B9KIK0	Ribosomal RNA small subunit methyltransferase H	5.74e-04	NA	NA	0.6272
6. F	B7H0I7	Ribosomal protein L11 methyltransferase	5.25e-08	NA	NA	0.7001
6. F	Q8DUV4	Uncharacterized RNA methyltransferase SMU_788	4.57e-08	NA	NA	0.6567
6. F	B3E6X8	tRNA U34 carboxymethyltransferase	1.11e-05	NA	NA	0.6413
6. F	C1DQS9	tRNA U34 carboxymethyltransferase	8.45e-06	NA	NA	0.5296
6. F	Q29LW1	eEF1A lysine and N-terminal methyltransferase homolog	4.08e-03	NA	NA	0.5665
6. F	A5U866	Cyclopropane mycolic acid synthase 1	2.48e-04	NA	NA	0.6525
6. F	B0KV20	tRNA U34 carboxymethyltransferase	9.22e-06	NA	NA	0.5786
6. F	Q81ZZ9	Ribosomal protein L11 methyltransferase	9.39e-08	NA	NA	0.6221
6. F	Q0T8K2	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	6.65e-08	NA	NA	0.6486
6. F	F6CY50	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	6.37e-07	NA	NA	0.6451
6. F	A1JRL5	Ribosomal protein L11 methyltransferase	1.03e-07	NA	NA	0.6196
6. F	A0RIT1	Ribosomal protein L11 methyltransferase	2.01e-08	NA	NA	0.703
6. F	A8KZA9	Ribosomal RNA small subunit methyltransferase H	9.29e-04	NA	NA	0.6538
6. F	G0FUS0	27-O-demethylrifamycin SV methyltransferase	4.63e-08	NA	NA	0.6598
6. F	A8AIB0	Ribosomal RNA large subunit methyltransferase I	6.03e-09	NA	NA	0.6775
6. F	B2VJC1	tRNA U34 carboxymethyltransferase	8.53e-06	NA	NA	0.5361
6. F	B7VM52	Ribosomal protein L11 methyltransferase	9.87e-08	NA	NA	0.6309
6. F	Q2RVT6	Ribosomal RNA small subunit methyltransferase H	1.60e-03	NA	NA	0.631
6. F	B3E5Z5	Ribosomal protein L11 methyltransferase	4.73e-08	NA	NA	0.6745
6. F	B4TE06	Ribosomal RNA large subunit methyltransferase I	7.36e-09	NA	NA	0.6729
7. B	Q59043	Putative ribosomal RNA large subunit methyltransferase MJ1649	9.61e-09	NA	0.007	NA