Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54663.1
JCVISYN3A_0214

Phosphatidylglycerophosphatase.
M. mycoides homolog: Q6MTZ1.
TIGRfam Classification: 3=Putative.
Category: Quasiessential.

Statistics

Total GO Annotation: 101
Unique PROST Go: 94
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 66
Unique PROST Homologs: 61
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: PAP2 superfamily protein
Zhang et al. [4]: GO:0046839|phospholipid dephosphorylation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q32ZL2 (Phospholipid phosphatase-related protein type 5) with a FATCAT P-Value: 2.3e-06 and RMSD of 2.92 angstrom. The sequence alignment identity is 16.0%.
Structural alignment shown in left. Query protein AVX54663.1 colored as red in alignment, homolog Q32ZL2 colored as blue. Query protein AVX54663.1 is also shown in right top, homolog Q32ZL2 showed in right bottom. They are colored based on secondary structures. 

  AVX54663.1 MKNKINHYYIYSGIVFIILISLFILGSVYDFKIASFKRAENLSLAVFISNLGVVIPSIP--LTIALIYLIKSLKLKNKLKINNIIETLI---YFIIPLVF 95
      Q32ZL2 ------------------------------------------------------MPLLPAALTSSMLYF--------QMVI--MAGTVMLAYYFEYTDTF 36

  AVX54663.1 IVFN---FF-----YEK------QS------IVYSIISNLLCLIII--SSLIYYFHI------NKE--IIS-D-----PDLSIYKSIIVL-ITIIGLL-- 156
      Q32ZL2 TV-NVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINP-L-VRRTVRFLGIYTFGLFAT 133

  AVX54663.1 -ILVNILK-LTFNRPRPTNLELYR-NWWNI---KWTSW----------------KHNSFPSGH----TYSATTLLFVLLLFNKINKK-T-----YLWISF 224
      Q32ZL2 DIFVNAGQVVTGNLA-PHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYL--TMYITNTIKAKGTRLAKPVLCLGL 230

  AVX54663.1 TWLIIIIVAMSRIV-LNKHFLTDVVFSMLLSFTILTTIL--IINQKKGKLFI----------------------------------------- 273
      Q32ZL2 MCL-AFLTGLNRVAEYRNHW-SDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT 321

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0016021 integral component of membrane
4. PB GO:0009103 lipopolysaccharide biosynthetic process
4. PB GO:0046839 phospholipid dephosphorylation
4. PB GO:0042392 sphingosine-1-phosphate phosphatase activity
4. PB GO:0046677 response to antibiotic
4. PB GO:0016787 hydrolase activity
4. PB GO:0009245 lipid A biosynthetic process
5. P GO:0060070 canonical Wnt signaling pathway
5. P GO:1990798 pancreas regeneration
5. P GO:0006672 ceramide metabolic process
5. P GO:0019991 septate junction assembly
5. P GO:0045140 inositol phosphoceramide synthase activity
5. P GO:0050821 protein stabilization
5. P GO:0006670 sphingosine metabolic process
5. P GO:0044328 canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration
5. P GO:0009055 electron transfer activity
5. P GO:0106235 ceramide-1-phosphate phosphatase activity
5. P GO:0009663 plasmodesma organization
5. P GO:0000810 diacylglycerol diphosphate phosphatase activity
5. P GO:0033188 sphingomyelin synthase activity
5. P GO:0050380 undecaprenyl-diphosphatase activity
5. P GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
5. P GO:0001702 gastrulation with mouth forming second
5. P GO:0001568 blood vessel development
5. P GO:0019992 diacylglycerol binding
5. P GO:0031901 early endosome membrane
5. P GO:0046335 ethanolamine biosynthetic process
5. P GO:0001933 negative regulation of protein phosphorylation
5. P GO:0030682 mitigation of host defenses by symbiont
5. P GO:0036115 fatty-acyl-CoA catabolic process
5. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
5. P GO:0030288 outer membrane-bounded periplasmic space
5. P GO:0005802 trans-Golgi network
5. P GO:0010181 FMN binding
5. P GO:0030148 sphingolipid biosynthetic process
5. P GO:0044330 canonical Wnt signaling pathway involved in positive regulation of wound healing
5. P GO:0008962 phosphatidylglycerophosphatase activity
5. P GO:0005178 integrin binding
5. P GO:0019915 lipid storage
5. P GO:0005901 caveola
5. P GO:0035233 germ cell repulsion
5. P GO:0060020 Bergmann glial cell differentiation
5. P GO:0007399 nervous system development
5. P GO:0006644 phospholipid metabolic process
5. P GO:0042577 lipid phosphatase activity
5. P GO:0016791 phosphatase activity
5. P GO:0005794 Golgi apparatus
5. P GO:0051091 positive regulation of DNA-binding transcription factor activity
5. P GO:0140042 lipid droplet formation
5. P GO:0008195 phosphatidate phosphatase activity
5. P GO:0009279 cell outer membrane
5. P GO:0010945 CoA pyrophosphatase activity
5. P GO:0010497 plasmodesmata-mediated intercellular transport
5. P GO:0034389 lipid droplet organization
5. P GO:0070916 inositol phosphoceramide synthase complex
5. P GO:1902068 regulation of sphingolipid mediated signaling pathway
5. P GO:0004142 diacylglycerol cholinephosphotransferase activity
5. P GO:0005887 integral component of plasma membrane
5. P GO:0005886 plasma membrane
5. P GO:0098609 cell-cell adhesion
5. P GO:1900481 negative regulation of diacylglycerol biosynthetic process
5. P GO:0051491 positive regulation of filopodium assembly
5. P GO:0030111 regulation of Wnt signaling pathway
5. P GO:0017129 triglyceride binding
5. P GO:0005918 septate junction
5. P GO:0019835 cytolysis
5. P GO:0006655 phosphatidylglycerol biosynthetic process
5. P GO:1900480 regulation of diacylglycerol biosynthetic process
5. P GO:0005635 nuclear envelope
5. P GO:0006673 inositol phosphoceramide metabolic process
5. P GO:0033631 cell-cell adhesion mediated by integrin
5. P GO:0046513 ceramide biosynthetic process
5. P GO:0000139 Golgi membrane
5. P GO:0020016 ciliary pocket
5. P GO:0003993 acid phosphatase activity
5. P GO:0010976 positive regulation of neuron projection development
5. P GO:0030091 protein repair
5. P GO:0070971 endoplasmic reticulum exit site
5. P GO:0003323 type B pancreatic cell development
5. P GO:0045824 negative regulation of innate immune response
5. P GO:0035234 ectopic germ cell programmed cell death
5. P GO:0044329 canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion
5. P GO:0007165 signal transduction
5. P GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
5. P GO:0045121 membrane raft
5. P GO:0007280 pole cell migration
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0016301 kinase activity
5. P GO:0007424 open tracheal system development
5. P GO:0009395 phospholipid catabolic process
5. P GO:1902806 regulation of cell cycle G1/S phase transition
5. P GO:0016020 membrane
5. P GO:0010832 negative regulation of myotube differentiation
5. P GO:0030173 integral component of Golgi membrane
5. P GO:0016323 basolateral plasma membrane
5. P GO:0031018 endocrine pancreas development
5. P GO:0008354 germ cell migration
5. P GO:0007229 integrin-mediated signaling pathway
5. P GO:0030176 integral component of endoplasmic reticulum membrane
5. P GO:0047493 ceramide cholinephosphotransferase activity
5. P GO:0034109 homotypic cell-cell adhesion

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF P43045 Uncharacterized protein MCAP_0865 5.55e-16 9.73e-17 NA 0.6753
4. PB Q2KA78 Lipid A 4'-phosphatase 2.69e-06 6.41e-27 0.006 NA
4. PB Q1WDN2 Lipid A 4'-phosphatase 2.43e-06 1.03e-17 0.001 NA
5. P Q1MA49 Lipid A 1-phosphatase 5.49e-06 5.30e-17 NA NA
5. P Q9LVZ6 Phosphatidylcholine:diacylglycerol cholinephosphotransferase 2 3.95e-04 6.82e-03 NA NA
5. P P0A925 Phosphatidylglycerophosphatase B 1.81e-05 8.07e-06 NA NA
5. P E9AFX2 Phosphatidylinositol:ceramide inositolphosphotransferase 3.01e-05 2.11e-04 NA NA
5. P Q58DI5 Phospholipid phosphatase 6 5.61e-05 5.33e-03 NA NA
5. P Q9V576 Putative phosphatidate phosphatase 2.34e-05 1.10e-02 NA NA
5. P Q04396 Lipid phosphate phosphatase 1 2.72e-06 7.65e-15 NA NA
5. P Q5FVJ3 Inactive phospholipid phosphatase 7 1.35e-05 2.66e-06 NA NA
5. P Q9A4T3 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 4.66e-05 2.69e-02 NA NA
5. P P67155 UPF0073 inner membrane protein YqfA 5.86e-06 2.10e-02 NA NA
5. P A0Q4N6 Lipid A 4'-phosphatase 3.23e-05 3.31e-15 NA NA
5. P P26975 Non-specific acid phosphatase 4.03e-04 4.63e-07 NA NA
5. P Q58076 Uncharacterized protein MJ0662 1.61e-05 1.23e-07 NA NA
5. P Q32ZL2 Phospholipid phosphatase-related protein type 5 2.30e-06 1.22e-02 NA NA
5. P Q5TZ07 Phospholipid phosphatase 6 2.20e-05 3.44e-02 NA NA
5. P P0A926 Phosphatidylglycerophosphatase B 1.80e-05 8.07e-06 NA NA
5. P Q3SZE3 Phospholipid phosphatase 3 1.95e-05 1.15e-06 NA NA
5. P P76445 Lipid A 1-diphosphate synthase 6.06e-06 3.37e-08 NA NA
5. P P28581 Major phosphate-irrepressible acid phosphatase 3.43e-04 3.40e-07 NA NA
5. P P0A924 Phosphatidylglycerophosphatase B 1.85e-05 8.07e-06 NA NA
5. P P67154 UPF0073 inner membrane protein YqfA 6.83e-06 2.10e-02 NA NA
5. P P14924 Acid phosphatase 1.56e-03 1.24e-02 NA NA
5. P Q8K593 Phospholipid phosphatase 2 2.22e-05 8.31e-03 NA NA
5. P P80143 Undecaprenyl-diphosphatase 5.45e-06 1.77e-06 NA NA
5. P Q6P0E8 Inactive phospholipid phosphatase 7 5.51e-05 6.86e-06 NA NA
5. P P67153 UPF0073 inner membrane protein YqfA 9.23e-06 2.10e-02 NA NA
5. P Q9XIG2 Protein PHLOEM UNLOADING MODULATOR 2.71e-05 3.06e-05 NA NA
5. P Q99JY8 Phospholipid phosphatase 3 1.99e-05 9.32e-07 NA NA
5. P Q8IY26 Phospholipid phosphatase 6 1.18e-04 1.84e-02 NA NA
5. P Q9DAX2 Phospholipid phosphatase 2 2.28e-05 4.41e-03 NA NA
5. P Q54PR7 PA-phosphatase related-family protein DDB_G0284367 3.31e-05 5.94e-03 NA NA
5. P Q38E54 Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase 8.06e-05 1.10e-02 NA NA
5. P Q06676 Acyl-coenzyme A diphosphatase YFT2 2.04e-04 1.43e-06 NA NA
5. P B3A0M0 Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase 1.04e-04 8.31e-03 NA NA
5. P Q7VSE8 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 7.01e-04 1.07e-02 NA NA
5. P Q7WD13 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.24e-04 1.99e-02 NA NA
5. P Q6GM05 Phospholipid phosphatase-related protein type 5 1.19e-05 3.20e-03 NA NA
5. P O24866 Lipid A 1-phosphatase 1.52e-04 9.44e-10 NA NA
5. P O34349 Phosphatidylglycerophosphatase B 6.31e-05 4.90e-08 NA NA
5. P Q6WAY2 Phospholipid phosphatase-related protein type 1 1.19e-04 1.17e-04 NA NA
5. P Q2K2U9 Lipid A 1-phosphatase 7.29e-06 1.16e-05 NA NA
5. P A4II83 Phospholipid phosphatase-related protein type 1 1.84e-04 4.87e-05 NA NA
5. P A4WF68 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.85e-04 4.99e-02 NA NA
5. P Q52KL1 Acyl-coenzyme A diphosphatase FITM2 3.94e-04 2.20e-02 NA NA
5. P Q6IQH6 Phospholipid phosphatase-related protein type 1 1.35e-05 1.74e-02 NA NA
5. P Q8BJ52 Phospholipid phosphatase-related protein type 5 1.49e-05 2.72e-03 NA NA
5. P P44570 Phosphatidylglycerophosphatase B 2.74e-05 9.34e-12 NA NA
5. P Q9ZN40 Lipid A 1-phosphatase 8.14e-06 8.06e-12 NA NA
5. P P67156 UPF0073 inner membrane protein YqfA 7.36e-06 2.10e-02 NA NA
5. P Q7W5H7 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 1.25e-04 1.99e-02 NA NA
5. P Q934J6 Non-specific acid phosphatase 8.55e-04 7.10e-06 NA NA
5. P P81310 Uncharacterized protein MJ0611.1 8.73e-06 2.77e-02 NA NA
5. P Q8BFZ2 Phospholipid phosphatase-related protein type 1 7.06e-05 4.50e-05 NA NA
5. P O05883 Methanethiol S-methyltransferase 1.04e-03 3.91e-03 NA NA
5. P Q91WB2 Inactive phospholipid phosphatase 7 1.82e-05 3.54e-06 NA NA
5. P P26976 Non-specific acid phosphatase 2.41e-03 9.61e-06 NA NA
5. P P36107 Inositol phosphorylceramide synthase catalytic subunit AUR1 8.37e-05 2.80e-03 NA NA
5. P P97544 Phospholipid phosphatase 3 1.94e-05 6.62e-07 NA NA
5. P O14495 Phospholipid phosphatase 3 1.27e-05 1.12e-06 NA NA
5. P Q8TBJ4 Phospholipid phosphatase-related protein type 1 1.28e-04 8.40e-05 NA NA
5. P Q8NBV4 Inactive phospholipid phosphatase 7 1.61e-05 1.09e-06 NA NA
7. B Q9SUW4 Probable lipid phosphate phosphatase beta 4.22e-06 NA 0.002 NA
7. B Q57819 Uncharacterized protein MJ0374 2.31e-05 NA 4.01e-04 NA