Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54675.1
JCVISYN3A_0234
PTS glucose transporter subunit IIA.
M. mycoides homolog: Q6MTX1.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 30
Unique PROST Go: 7
Unique BLAST Go: 4
Unique Foldseek Go: 1
Total Homologs: 133
Unique PROST Homologs: 8
Unique BLAST Homologs: 5
Unique Foldseek Homologs: 43
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q8KA51
(PTS system glucose-specific EIIA component) with a FATCAT P-Value: 0 and RMSD of 1.33 angstrom. The sequence alignment identity is 34.8%.
Structural alignment shown in left. Query protein AVX54675.1 colored as red in alignment, homolog Q8KA51 colored as blue.
Query protein AVX54675.1 is also shown in right top, homolog Q8KA51 showed in right bottom. They are colored based on secondary structures.
AVX54675.1 M----WFFN-------KNLKVLAPCDGKIITLDEVEDDVFRERMLGDGFAIYPTSNDFHAPVS---GKLVTAFPTKHAFGIQTKNGVEILLHIGLDTVSL 86 Q8KA51 MSFFSGFFNKKKSKYSKKIDILAPLSGDIINIEDVPDVVFSKKIVGDGIAINPTGNKILAPINGTIGKILNSM---HAFSIISEEGVELFVHFGIDTVKL 97 AVX54675.1 DGNGFESYVIQD-QEVNAGDKLVTVDLQEVSKKVPSIKSPIIFTNNGGKTLEIVKMGEVKK--GDVVA---ILK---- 154 Q8KA51 RGEGF-KQIAQDNQKVKIGDTIILFDLNLLKEKARSILTPVVISN-----IE--KFKNIEKSSGTIIAGKTIIMSLYN 167
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0031234 | extrinsic component of cytoplasmic side of plasma membrane |
| 1. PBF | GO:0016301 | kinase activity |
| 1. PBF | GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system |
| 1. PBF | GO:0046872 | metal ion binding |
| 2. PF | GO:0004609 | phosphatidylserine decarboxylase activity |
| 3. BF | GO:0015572 | N-acetylglucosamine transmembrane transporter activity |
| 3. BF | GO:0015293 | symporter activity |
| 3. BF | GO:0006814 | sodium ion transport |
| 3. BF | GO:0016021 | integral component of membrane |
| 3. BF | GO:0008982 | protein-N(PI)-phosphohistidine-sugar phosphotransferase activity |
| 3. BF | GO:0090563 | protein-phosphocysteine-sugar phosphotransferase activity |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0005355 | glucose transmembrane transporter activity |
| 3. BF | GO:0090589 | protein-phosphocysteine-trehalose phosphotransferase system transporter activity |
| 3. BF | GO:0015771 | trehalose transport |
| 3. BF | GO:0034219 | carbohydrate transmembrane transport |
| 3. BF | GO:0019866 | organelle inner membrane |
| 4. PB | GO:0045912 | negative regulation of carbohydrate metabolic process |
| 5. P | GO:0006226 | dUMP biosynthetic process |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0006229 | dUTP biosynthetic process |
| 5. P | GO:0008829 | dCTP deaminase activity |
| 5. P | GO:0015949 | nucleobase-containing small molecule interconversion |
| 5. P | GO:0033973 | dCTP deaminase (dUMP-forming) activity |
| 5. P | GO:0000166 | nucleotide binding |
| 6. F | GO:0006646 | phosphatidylethanolamine biosynthetic process |
| 7. B | GO:0090587 | protein-phosphocysteine-glucosamine phosphotransferase system transporter activity |
| 7. B | GO:0015764 | N-acetylglucosamine transport |
| 7. B | GO:0090586 | protein-phosphocysteine-N-acetylglucosamine phosphotransferase system transporter activity |
| 7. B | GO:0005887 | integral component of plasma membrane |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0008982 | protein-N(PI)-phosphohistidine-sugar phosphotransferase activity |
| GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system |
| GO:0103111 | D-glucosamine PTS permease activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q9WXI7 | PTS system glucose-specific EIIA component | 0.00e+00 | 5.88e-49 | 4.01e-30 | 0.9277 |
| 1. PBF | P60857 | PTS system glucose-specific EIIA component | 0.00e+00 | 6.55e-42 | 2.32e-35 | 0.9196 |
| 1. PBF | Q8KA51 | PTS system glucose-specific EIIA component | 0.00e+00 | 4.60e-40 | 7.24e-27 | 0.9184 |
| 1. PBF | P0A283 | PTS system glucose-specific EIIA component | 0.00e+00 | 2.70e-35 | 3.25e-28 | 0.9181 |
| 1. PBF | Q44840 | PTS system glucose-specific EIIA component | 0.00e+00 | 6.29e-17 | 6.90e-30 | 0.8815 |
| 1. PBF | Q5HPB5 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.21e-39 | 3.31e-36 | 0.9175 |
| 1. PBF | P45618 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.19e-80 | 4.27e-101 | 0.9791 |
| 1. PBF | Q8CP79 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.21e-39 | 3.31e-36 | 0.9178 |
| 1. PBF | P60856 | PTS system glucose-specific EIIA component | 0.00e+00 | 6.55e-42 | 2.32e-35 | 0.917 |
| 1. PBF | Q9KCQ4 | PTS system glucose-specific EIIA component | 0.00e+00 | 8.05e-29 | 9.73e-34 | 0.9253 |
| 1. PBF | Q93P61 | PTS system glucose-specific EIIA component | 0.00e+00 | 4.96e-43 | 9.71e-36 | 0.9161 |
| 1. PBF | Q5HFZ9 | PTS system glucose-specific EIIA component | 0.00e+00 | 4.96e-43 | 9.71e-36 | 0.9083 |
| 1. PBF | Q81JY0 | PTS system glucose-specific EIIA component | 0.00e+00 | 1.03e-38 | 1.99e-36 | 0.9164 |
| 1. PBF | P50829 | Putative phosphotransferase enzyme IIA component YpqE | 0.00e+00 | 3.87e-42 | 6.02e-32 | 0.9254 |
| 1. PBF | Q814U8 | PTS system glucose-specific EIIA component | 0.00e+00 | 8.56e-40 | 1.77e-36 | 0.9165 |
| 1. PBF | Q8NWR1 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.89e-43 | 4.59e-35 | 0.9167 |
| 1. PBF | P0A284 | PTS system glucose-specific EIIA component | 0.00e+00 | 2.70e-35 | 3.25e-28 | 0.9168 |
| 1. PBF | P69785 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.24e-35 | 1.18e-28 | 0.9204 |
| 1. PBF | Q89B05 | PTS system glucose-specific EIIA component | 0.00e+00 | 2.49e-35 | 2.16e-25 | 0.9207 |
| 1. PBF | Q6G9D9 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.89e-43 | 4.59e-35 | 0.9167 |
| 1. PBF | P69784 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.24e-35 | 1.18e-28 | 0.9206 |
| 1. PBF | P45338 | PTS system glucose-specific EIIA component | 0.00e+00 | 4.15e-39 | 6.40e-28 | 0.9097 |
| 1. PBF | Q8CZD5 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.18e-46 | 1.83e-31 | 0.9203 |
| 1. PBF | Q6GGY5 | PTS system glucose-specific EIIA component | 0.00e+00 | 7.73e-43 | 1.18e-35 | 0.9174 |
| 3. BF | A6QDH3 | PTS system glucose-specific EIICBA component | 2.57e-09 | NA | 3.14e-29 | 0.9244 |
| 3. BF | Q57071 | PTS system glucose-specific EIICBA component | 1.01e-11 | NA | 1.53e-34 | 0.9661 |
| 3. BF | A7X6P1 | PTS system glucoside-specific EIICBA component | 1.12e-12 | NA | 5.43e-30 | 0.9569 |
| 3. BF | A7WXI2 | PTS system glucose-specific EIICBA component | 2.90e-09 | NA | 2.30e-29 | 0.9222 |
| 3. BF | Q8VRH0 | PTS system glucose-specific EIICBA component | 2.27e-13 | NA | 1.65e-35 | 0.9352 |
| 3. BF | A8Z0F5 | PTS system glucose-specific EIICBA component | 7.80e-09 | NA | 3.14e-29 | 0.9188 |
| 3. BF | Q45298 | PTS system glucose-specific EIIBCA component | 2.10e-10 | NA | 4.58e-22 | 0.8682 |
| 3. BF | Q7A807 | PTS system glucose-specific EIICBA component | 6.66e-10 | NA | 2.30e-29 | 0.9367 |
| 3. BF | A8Z3D6 | PTS system glucoside-specific EIICBA component | 1.71e-12 | NA | 1.20e-30 | 0.9353 |
| 3. BF | Q2FDW8 | PTS system glucoside-specific EIICBA component | 6.18e-12 | NA | 1.20e-30 | 0.9624 |
| 3. BF | P23936 | Lactose permease | 1.47e-11 | NA | 3.48e-20 | 0.9212 |
| 3. BF | P26207 | PTS system beta-glucoside-specific EIIBCA component | 3.10e-13 | NA | 3.51e-21 | 0.9552 |
| 3. BF | A6U4R9 | PTS system glucoside-specific EIICBA component | 1.65e-12 | NA | 9.58e-31 | 0.9566 |
| 3. BF | Q4L945 | PTS system glucose-specific EIICBA component | 3.40e-11 | NA | 4.85e-32 | 0.9337 |
| 3. BF | Q6GDR0 | PTS system glucoside-specific EIICBA component | 1.38e-12 | NA | 1.25e-30 | 0.9567 |
| 3. BF | P35595 | PTS system glucose-specific EIICBA component | 5.58e-11 | NA | 7.30e-33 | 0.9296 |
| 3. BF | Q9KF90 | PTS system beta-glucoside-specific EIIBCA component | 2.63e-10 | NA | 1.12e-28 | 0.9313 |
| 3. BF | Q2YUZ1 | PTS system glucose-specific EIICBA component | 2.05e-09 | NA | 6.18e-30 | 0.926 |
| 3. BF | Q5HL73 | PTS system glucose-specific EIICBA component | 1.87e-13 | NA | 1.65e-35 | 0.9498 |
| 3. BF | A5IVW5 | PTS system glucoside-specific EIICBA component | 1.48e-12 | NA | 9.58e-31 | 0.9629 |
| 3. BF | Q7CCJ4 | PTS system glucose-specific EIICBA component | 4.30e-13 | NA | 1.65e-35 | 0.9645 |
| 3. BF | Q7A3G4 | PTS system glucoside-specific EIICBA component | 1.43e-12 | NA | 5.43e-30 | 0.932 |
| 3. BF | P20166 | PTS system glucose-specific EIICBA component | 3.01e-09 | NA | 1.89e-33 | 0.9328 |
| 3. BF | Q99R97 | PTS system glucoside-specific EIICBA component | 4.80e-11 | NA | 5.43e-30 | 0.9293 |
| 3. BF | Q46072 | PTS system mannose-specific EIIBCA component | 4.93e-10 | NA | 2.67e-22 | 0.8618 |
| 3. BF | Q8NUS2 | PTS system glucoside-specific EIICBA component | 4.09e-12 | NA | 1.20e-30 | 0.9571 |
| 3. BF | P40739 | PTS system beta-glucoside-specific EIIBCA component | 4.56e-11 | NA | 2.58e-25 | 0.945 |
| 3. BF | P22733 | Lactose permease | 3.35e-11 | NA | 1.85e-18 | 0.9141 |
| 3. BF | P39816 | Putative PTS system glucosamine-specific EIICBA component | 1.18e-06 | NA | 8.07e-32 | 0.9546 |
| 3. BF | Q2YWC1 | PTS system glucoside-specific EIICBA component | 6.91e-13 | NA | 2.64e-30 | 0.934 |
| 3. BF | P75569 | PTS system glucose-specific EIICBA component | 2.65e-07 | NA | 2.49e-14 | 0.8953 |
| 3. BF | P43470 | PTS system sucrose-specific EIIBCA component | 2.25e-11 | NA | 1.01e-18 | 0.9497 |
| 3. BF | Q53922 | PTS system glucoside-specific EIICBA component | 1.40e-11 | NA | 1.29e-31 | 0.9533 |
| 3. BF | Q6GKB7 | PTS system glucose-specific EIICBA component | 2.11e-08 | NA | 3.05e-29 | 0.9178 |
| 3. BF | P42015 | PTS system glucose-specific EIICBA component (Fragment) | 0.00e+00 | NA | 7.29e-40 | 0.9441 |
| 3. BF | Q4A0C4 | PTS system glucose-specific EIICBA component | 1.37e-13 | NA | 1.60e-30 | 0.9681 |
| 3. BF | P47315 | PTS system glucose-specific EIICBA component | 1.04e-06 | NA | 6.59e-16 | 0.8952 |
| 3. BF | P45604 | PTS system N-acetylglucosamine-specific EIICBA component | 7.01e-12 | NA | 9.24e-26 | 0.9166 |
| 3. BF | Q2FK73 | PTS system glucose-specific EIICBA component | 7.64e-10 | NA | 3.14e-29 | 0.9284 |
| 3. BF | Q6G6D6 | PTS system glucoside-specific EIICBA component | 4.26e-12 | NA | 1.20e-30 | 0.957 |
| 3. BF | A6TXX3 | PTS system glucose-specific EIICBA component | 1.60e-09 | NA | 2.30e-29 | 0.926 |
| 3. BF | A6QK27 | PTS system glucoside-specific EIICBA component | 1.58e-10 | NA | 1.20e-30 | 0.9625 |
| 3. BF | Q5HD13 | PTS system glucoside-specific EIICBA component | 5.23e-11 | NA | 1.20e-30 | 0.9361 |
| 3. BF | Q5HJI3 | PTS system glucose-specific EIICBA component | 3.22e-09 | NA | 3.14e-29 | 0.9243 |
| 3. BF | P12655 | PTS system sucrose-specific EIIBCA component | 1.78e-11 | NA | 1.15e-24 | 0.9444 |
| 3. BF | Q6GCT7 | PTS system glucose-specific EIICBA component | 7.01e-09 | NA | 3.14e-29 | 0.9204 |
| 3. BF | P43466 | Raffinose carrier protein | 3.02e-09 | NA | 2.66e-19 | 0.89 |
| 3. BF | Q8NYM1 | PTS system glucose-specific EIICBA component | 6.63e-09 | NA | 3.14e-29 | 0.9185 |
| 3. BF | Q48624 | Lactose permease | 3.27e-08 | NA | 1.18e-14 | 0.8937 |
| 3. BF | Q7WTB2 | Lactose permease | 5.25e-07 | NA | 1.08e-18 | 0.8525 |
| 3. BF | A5IP58 | PTS system glucose-specific EIICBA component | 6.79e-11 | NA | 2.30e-29 | 0.9187 |
| 3. BF | Q99X32 | PTS system glucose-specific EIICBA component | 4.61e-09 | NA | 2.30e-29 | 0.9203 |
| 4. PB | P69783 | PTS system glucose-specific EIIA component | 0.00e+00 | 3.24e-35 | 1.18e-28 | NA |
| 5. P | Q72W72 | dCTP deaminase, dUMP-forming | 7.95e-01 | 1.44e-02 | NA | NA |
| 5. P | Q04WA6 | dCTP deaminase, dUMP-forming | 7.80e-01 | 1.16e-02 | NA | NA |
| 5. P | Q58269 | Uncharacterized protein MJ0859 | 2.24e-01 | 8.65e-04 | NA | NA |
| 5. P | Q04X69 | dCTP deaminase, dUMP-forming | 7.84e-01 | 1.16e-02 | NA | NA |
| 5. P | Q2NFH1 | dCTP deaminase, dUMP-forming | 7.81e-01 | 3.48e-02 | NA | NA |
| 5. P | B8DUY2 | dCTP deaminase, dUMP-forming | 7.87e-01 | 2.93e-02 | NA | NA |
| 5. P | Q58227 | Putative archaetidylserine decarboxylase proenzyme | 2.86e-06 | 7.82e-03 | NA | NA |
| 5. P | Q8F9W5 | dCTP deaminase, dUMP-forming | 7.77e-01 | 1.44e-02 | NA | NA |
| 6. F | Q3ST95 | Phosphatidylserine decarboxylase proenzyme | 1.75e-06 | NA | NA | 0.5437 |
| 6. F | B6JHT1 | Phosphatidylserine decarboxylase proenzyme | 1.21e-06 | NA | NA | 0.5213 |
| 6. F | Q9JZP0 | Phosphatidylserine decarboxylase proenzyme | 9.31e-06 | NA | NA | 0.5558 |
| 6. F | Q50967 | Phosphatidylserine decarboxylase proenzyme | 1.20e-05 | NA | NA | 0.5178 |
| 6. F | Q139C9 | Phosphatidylserine decarboxylase proenzyme | 2.52e-06 | NA | NA | 0.5104 |
| 6. F | Q1LPX5 | Phosphatidylserine decarboxylase proenzyme | 1.99e-06 | NA | NA | 0.6044 |
| 6. F | B3ESH0 | Phosphatidylserine decarboxylase proenzyme | 2.08e-06 | NA | NA | 0.5766 |
| 6. F | Q0SES0 | Phosphatidylserine decarboxylase proenzyme | 2.01e-06 | NA | NA | 0.5912 |
| 6. F | Q9X5E3 | Phosphatidylserine decarboxylase proenzyme | 3.58e-06 | NA | NA | 0.5445 |
| 6. F | Q89NP2 | Phosphatidylserine decarboxylase proenzyme | 2.83e-06 | NA | NA | 0.5411 |
| 6. F | Q2IUP7 | Phosphatidylserine decarboxylase proenzyme | 3.23e-06 | NA | NA | 0.5249 |
| 6. F | Q3SHE5 | Phosphatidylserine decarboxylase proenzyme | 1.42e-06 | NA | NA | 0.5353 |
| 6. F | Q3B2G7 | Phosphatidylserine decarboxylase proenzyme | 2.13e-06 | NA | NA | 0.5694 |
| 6. F | Q5NXP3 | Phosphatidylserine decarboxylase proenzyme | 1.16e-06 | NA | NA | 0.5638 |
| 6. F | A4F743 | Phosphatidylserine decarboxylase proenzyme | 4.91e-06 | NA | NA | 0.5672 |
| 6. F | A6LF25 | Phosphatidylserine decarboxylase proenzyme | 2.07e-06 | NA | NA | 0.539 |
| 6. F | A1UAG5 | Phosphatidylserine decarboxylase proenzyme | 3.20e-06 | NA | NA | 0.6083 |
| 6. F | Q984W0 | Phosphatidylserine decarboxylase proenzyme | 3.64e-06 | NA | NA | 0.5088 |
| 6. F | A3PU20 | Phosphatidylserine decarboxylase proenzyme | 3.21e-06 | NA | NA | 0.602 |
| 6. F | Q1QN82 | Phosphatidylserine decarboxylase proenzyme | 1.63e-06 | NA | NA | 0.5501 |
| 6. F | Q64YG8 | Phosphatidylserine decarboxylase proenzyme | 1.86e-06 | NA | NA | 0.5648 |
| 6. F | Q62IM1 | Phosphatidylserine decarboxylase proenzyme | 1.58e-06 | NA | NA | 0.6026 |
| 6. F | Q1MQ97 | Phosphatidylserine decarboxylase proenzyme | 6.52e-07 | NA | NA | 0.5901 |
| 6. F | Q1BEG9 | Phosphatidylserine decarboxylase proenzyme | 3.11e-06 | NA | NA | 0.6064 |
| 6. F | B2JDN8 | Phosphatidylserine decarboxylase proenzyme | 1.78e-06 | NA | NA | 0.597 |
| 6. F | Q5YNV8 | Phosphatidylserine decarboxylase proenzyme | 3.42e-06 | NA | NA | 0.5959 |
| 6. F | A9IRR6 | Phosphatidylserine decarboxylase proenzyme | 1.08e-05 | NA | NA | 0.5309 |
| 6. F | Q8A5K8 | Phosphatidylserine decarboxylase proenzyme | 2.05e-06 | NA | NA | 0.5734 |
| 6. F | A4YWZ6 | Phosphatidylserine decarboxylase proenzyme | 1.15e-06 | NA | NA | 0.5479 |
| 6. F | Q2SZP7 | Phosphatidylserine decarboxylase proenzyme | 1.67e-06 | NA | NA | 0.6038 |
| 6. F | Q473V4 | Phosphatidylserine decarboxylase proenzyme | 2.06e-06 | NA | NA | 0.606 |
| 6. F | Q4FMX4 | Phosphatidylserine decarboxylase proenzyme | 3.28e-06 | NA | NA | 0.5273 |
| 6. F | A7IPD6 | Phosphatidylserine decarboxylase proenzyme | 2.22e-06 | NA | NA | 0.537 |
| 6. F | A6L1J5 | Phosphatidylserine decarboxylase proenzyme | 5.54e-06 | NA | NA | 0.5449 |
| 6. F | Q142I5 | Phosphatidylserine decarboxylase proenzyme | 1.83e-06 | NA | NA | 0.5895 |
| 6. F | A4SXR2 | Phosphatidylserine decarboxylase proenzyme | 2.11e-06 | NA | NA | 0.5877 |
| 6. F | B2HQP4 | Phosphatidylserine decarboxylase proenzyme | 4.64e-06 | NA | NA | 0.5492 |
| 6. F | B4S5J9 | Phosphatidylserine decarboxylase proenzyme | 2.45e-06 | NA | NA | 0.5434 |
| 6. F | A9M4G3 | Phosphatidylserine decarboxylase proenzyme | 1.63e-05 | NA | NA | 0.5481 |
| 6. F | Q8RGF2 | Phosphatidylserine decarboxylase proenzyme | 5.18e-05 | NA | NA | 0.5291 |
| 6. F | B1YTR9 | Phosphatidylserine decarboxylase proenzyme | 1.40e-06 | NA | NA | 0.5723 |
| 6. F | B4E5N4 | Phosphatidylserine decarboxylase proenzyme | 1.48e-06 | NA | NA | 0.6086 |
| 6. F | C1B0C2 | Phosphatidylserine decarboxylase proenzyme | 2.22e-06 | NA | NA | 0.5964 |
| 7. B | Q2FV87 | PTS system glucoside-specific EIICBA component | 4.56e-12 | NA | 1.20e-30 | NA |
| 7. B | P09323 | PTS system N-acetylglucosamine-specific EIICBA component | 5.32e-12 | NA | 6.04e-24 | NA |
| 7. B | O32292 | Putative phosphotransferase enzyme IIA component YyzE | 2.57e-07 | NA | 3.64e-09 | NA |
| 7. B | P08722 | PTS system beta-glucoside-specific EIIBCA component | 2.35e-10 | NA | 9.68e-25 | NA |
| 7. B | Q2G1G8 | PTS system glucose-specific EIICBA component | 1.36e-09 | NA | 3.14e-29 | NA |