Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54680.1
JCVISYN3A_0247

Ribosome biogenesis GTP-binding protein.
M. mycoides homolog: Q6MTV5.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 252
Unique PROST Go: 213
Unique BLAST Go: 24
Unique Foldseek Go: 0

Total Homologs: 2214
Unique PROST Homologs: 680
Unique BLAST Homologs: 511
Unique Foldseek Homologs: 50

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: engB; Probable GTP-binding protein EngB
Zhang et al. [4]: GO:0000917|barrier septum assembly
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A7NBT0 (Probable GTP-binding protein EngB) with a FATCAT P-Value: 0 and RMSD of 1.72 angstrom. The sequence alignment identity is 35.9%.
Structural alignment shown in left. Query protein AVX54680.1 colored as red in alignment, homolog A7NBT0 colored as blue. Query protein AVX54680.1 is also shown in right top, homolog A7NBT0 showed in right bottom. They are colored based on secondary structures. 

  AVX54680.1 M-IKQASFITSAANKSNWINDDVS-EICLIGRSNVGKSSFINSLTNNNKLAKISNTPGKTRLLNFFEI-NKGEYRLVDAPGYGYAKVDDNLKIQFAKMME 97
      A7NBT0 MNYSKAKYIMGAAKVSQ-LPEDTGVEVAFAGRSNAGKSSALNTLTDQKGLARVSKTPGRTQLINLFDLGNNN--RLVDLPGYGYAKVSESIKRQWQSEME 97

  AVX54680.1 EYFINRKNLKGVFLLLDLRH--KPSNDDIMMYQFLK-HYNIPVVIIGTKLDKLKKSEYIKNEKMIKETINFYQEDDFIK--ISNLDKTNIIKCYELIDKL 192
      A7NBT0 NYLTSRKCLNGIVLLVDSRHELKEF-DSLMIEMAISFDLNLHILL--TKADKLNNKERAQANRMI---------ESFLKTFVST-DKIS----YQLFSSL 180

  AVX54680.1 --LG-SK---------- 196
      A7NBT0 TKMGLDKFKEKLDTWYQ 197

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0000917 division septum assembly
1. PBF GO:0005886 plasma membrane
1. PBF GO:0003924 GTPase activity
1. PBF GO:0005737 cytoplasm
1. PBF GO:0046872 metal ion binding
1. PBF GO:0005525 GTP binding
3. BF GO:0043022 ribosome binding
3. BF GO:0000027 ribosomal large subunit assembly
3. BF GO:0070181 small ribosomal subunit rRNA binding
3. BF GO:0042254 ribosome biogenesis
3. BF GO:0042274 ribosomal small subunit biogenesis
3. BF GO:0019843 rRNA binding
4. PB GO:0000287 magnesium ion binding
4. PB GO:0005634 nucleus
4. PB GO:0016021 integral component of membrane
5. P GO:0007006 mitochondrial membrane organization
5. P GO:0019003 GDP binding
5. P GO:0001889 liver development
5. P GO:0070861 regulation of protein exit from endoplasmic reticulum
5. P GO:0005829 cytosol
5. P GO:0090162 establishment of epithelial cell polarity
5. P GO:0003400 regulation of COPII vesicle coating
5. P GO:0005047 signal recognition particle binding
5. P GO:2000171 negative regulation of dendrite development
5. P GO:0097178 ruffle assembly
5. P GO:0019882 antigen processing and presentation
5. P GO:0015031 protein transport
5. P GO:0032456 endocytic recycling
5. P GO:0005785 signal recognition particle receptor complex
5. P GO:0031338 regulation of vesicle fusion
5. P GO:0031901 early endosome membrane
5. P GO:1902850 microtubule cytoskeleton organization involved in mitosis
5. P GO:0006807 nitrogen compound metabolic process
5. P GO:0000281 mitotic cytokinesis
5. P GO:0012505 endomembrane system
5. P GO:1990027 S bouton
5. P GO:0043622 cortical microtubule organization
5. P GO:0051523 cell growth mode switching, monopolar to bipolar
5. P GO:0005802 trans-Golgi network
5. P GO:0005774 vacuolar membrane
5. P GO:0005930 axoneme
5. P GO:0097212 lysosomal membrane organization
5. P GO:0099175 regulation of postsynapse organization
5. P GO:0098993 anchored component of synaptic vesicle membrane
5. P GO:0060170 ciliary membrane
5. P GO:0030139 endocytic vesicle
5. P GO:0030137 COPI-coated vesicle
5. P GO:0070863 positive regulation of protein exit from endoplasmic reticulum
5. P GO:1902824 positive regulation of late endosome to lysosome transport
5. P GO:0032154 cleavage furrow
5. P GO:0006893 Golgi to plasma membrane transport
5. P GO:0048193 Golgi vesicle transport
5. P GO:0032011 ARF protein signal transduction
5. P GO:0098691 dopaminergic synapse
5. P GO:0000266 mitochondrial fission
5. P GO:0042073 intraciliary transport
5. P GO:0051258 protein polymerization
5. P GO:0035020 regulation of Rac protein signal transduction
5. P GO:0009404 toxin metabolic process
5. P GO:0044233 mitochondria-associated endoplasmic reticulum membrane
5. P GO:0010975 regulation of neuron projection development
5. P GO:0042147 retrograde transport, endosome to Golgi
5. P GO:0006471 protein ADP-ribosylation
5. P GO:0007224 smoothened signaling pathway
5. P GO:0031527 filopodium membrane
5. P GO:0015630 microtubule cytoskeleton
5. P GO:0062063 BBSome binding
5. P GO:0097284 hepatocyte apoptotic process
5. P GO:1903292 protein localization to Golgi membrane
5. P GO:0007021 tubulin complex assembly
5. P GO:1903725 regulation of phospholipid metabolic process
5. P GO:0090110 COPII-coated vesicle cargo loading
5. P GO:0006892 post-Golgi vesicle-mediated transport
5. P GO:0005819 spindle
5. P GO:0032794 GTPase activating protein binding
5. P GO:0048487 beta-tubulin binding
5. P GO:0046336 ethanolamine catabolic process
5. P GO:1903441 protein localization to ciliary membrane
5. P GO:0046711 GDP biosynthetic process
5. P GO:0032391 photoreceptor connecting cilium
5. P GO:0045176 apical protein localization
5. P GO:0090385 phagosome-lysosome fusion
5. P GO:0090117 endosome to lysosome transport of low-density lipoprotein particle
5. P GO:0016328 lateral plasma membrane
5. P GO:0060998 regulation of dendritic spine development
5. P GO:0007059 chromosome segregation
5. P GO:1901301 regulation of cargo loading into COPII-coated vesicle
5. P GO:0031113 regulation of microtubule polymerization
5. P GO:0061024 membrane organization
5. P GO:0033365 protein localization to organelle
5. P GO:0006904 vesicle docking involved in exocytosis
5. P GO:0051457 maintenance of protein location in nucleus
5. P GO:0002505 antigen processing and presentation of polysaccharide antigen via MHC class II
5. P GO:2000377 regulation of reactive oxygen species metabolic process
5. P GO:0099562 maintenance of postsynaptic density structure
5. P GO:0034260 negative regulation of GTPase activity
5. P GO:0030838 positive regulation of actin filament polymerization
5. P GO:1901303 negative regulation of cargo loading into COPII-coated vesicle
5. P GO:0098793 presynapse
5. P GO:0000139 Golgi membrane
5. P GO:0048227 plasma membrane to endosome transport
5. P GO:0045807 positive regulation of endocytosis
5. P GO:0046054 dGMP metabolic process
5. P GO:0070971 endoplasmic reticulum exit site
5. P GO:0051489 regulation of filopodium assembly
5. P GO:1990927 calcium ion regulated lysosome exocytosis
5. P GO:0042267 natural killer cell mediated cytotoxicity
5. P GO:0070142 synaptic vesicle budding
5. P GO:0034067 protein localization to Golgi apparatus
5. P GO:0004385 guanylate kinase activity
5. P GO:0032418 lysosome localization
5. P GO:0051233 spindle midzone
5. P GO:0034379 very-low-density lipoprotein particle assembly
5. P GO:0051549 positive regulation of keratinocyte migration
5. P GO:0031489 myosin V binding
5. P GO:0140220 pathogen-containing vacuole
5. P GO:0007264 small GTPase mediated signal transduction
5. P GO:0090354 regulation of auxin metabolic process
5. P GO:0061512 protein localization to cilium
5. P GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
5. P GO:0034143 regulation of toll-like receptor 4 signaling pathway
5. P GO:0090543 Flemming body
5. P GO:0031116 positive regulation of microtubule polymerization
5. P GO:0031584 activation of phospholipase D activity
5. P GO:1990386 mitotic cleavage furrow ingression
5. P GO:0046754 viral exocytosis
5. P GO:0120183 positive regulation of focal adhesion disassembly
5. P GO:0061909 autophagosome-lysosome fusion
5. P GO:0042461 photoreceptor cell development
5. P GO:1904748 regulation of apoptotic process involved in development
5. P GO:0043014 alpha-tubulin binding
5. P GO:0005876 spindle microtubule
5. P GO:0009792 embryo development ending in birth or egg hatching
5. P GO:0030127 COPII vesicle coat
5. P GO:0047485 protein N-terminus binding
5. P GO:0012507 ER to Golgi transport vesicle membrane
5. P GO:0003723 RNA binding
5. P GO:1903078 positive regulation of protein localization to plasma membrane
5. P GO:0032587 ruffle membrane
5. P GO:0002786 regulation of antibacterial peptide production
5. P GO:0007612 learning
5. P GO:1904115 axon cytoplasm
5. P GO:0036064 ciliary basal body
5. P GO:0005154 epidermal growth factor receptor binding
5. P GO:0016004 phospholipase activator activity
5. P GO:0010811 positive regulation of cell-substrate adhesion
5. P GO:0055108 Golgi to transport vesicle transport
5. P GO:0007269 neurotransmitter secretion
5. P GO:0098586 cellular response to virus
5. P GO:0050714 positive regulation of protein secretion
5. P GO:0005881 cytoplasmic microtubule
5. P GO:0046037 GMP metabolic process
5. P GO:0060271 cilium assembly
5. P GO:0048488 synaptic vesicle endocytosis
5. P GO:0097494 regulation of vesicle size
5. P GO:0005765 lysosomal membrane
5. P GO:0070830 bicellular tight junction assembly
5. P GO:0003925 G protein activity
5. P GO:0015870 acetylcholine transport
5. P GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
5. P GO:0048259 regulation of receptor-mediated endocytosis
5. P GO:0008270 zinc ion binding
5. P GO:0030866 cortical actin cytoskeleton organization
5. P GO:0048471 perinuclear region of cytoplasm
5. P GO:0005794 Golgi apparatus
5. P GO:0098978 glutamatergic synapse
5. P GO:0016192 vesicle-mediated transport
5. P GO:0060996 dendritic spine development
5. P GO:0002747 antigen processing and presentation following phagocytosis
5. P GO:0060292 long-term synaptic depression
5. P GO:0005813 centrosome
5. P GO:0007369 gastrulation
5. P GO:0007112 male meiosis cytokinesis
5. P GO:0030496 midbody
5. P GO:0051586 positive regulation of dopamine uptake involved in synaptic transmission
5. P GO:0016050 vesicle organization
5. P GO:1902953 positive regulation of ER to Golgi vesicle-mediated transport
5. P GO:0016151 nickel cation binding
5. P GO:0008047 enzyme activator activity
5. P GO:0009558 embryo sac cellularization
5. P GO:0060999 positive regulation of dendritic spine development
5. P GO:0033028 myeloid cell apoptotic process
5. P GO:0017157 regulation of exocytosis
5. P GO:0045956 positive regulation of calcium ion-dependent exocytosis
5. P GO:0098876 vesicle-mediated transport to the plasma membrane
5. P GO:1990090 cellular response to nerve growth factor stimulus
5. P GO:2000009 negative regulation of protein localization to cell surface
5. P GO:0050873 brown fat cell differentiation
5. P GO:0098693 regulation of synaptic vesicle cycle
5. P GO:0032580 Golgi cisterna membrane
5. P GO:0043001 Golgi to plasma membrane protein transport
5. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
5. P GO:0036010 protein localization to endosome
5. P GO:0006998 nuclear envelope organization
5. P GO:0051519 activation of bipolar cell growth
5. P GO:0007098 centrosome cycle
5. P GO:0097061 dendritic spine organization
5. P GO:0055038 recycling endosome membrane
5. P GO:0045047 protein targeting to ER
5. P GO:0005879 axonemal microtubule
5. P GO:0005768 endosome
5. P GO:1902307 positive regulation of sodium ion transmembrane transport
5. P GO:0030117 membrane coat
5. P GO:0030540 female genitalia development
5. P GO:0098974 postsynaptic actin cytoskeleton organization
5. P GO:0008089 anterograde axonal transport
5. P GO:0002090 regulation of receptor internalization
5. P GO:0005929 cilium
5. P GO:1905606 regulation of presynapse assembly
5. P GO:0030742 GTP-dependent protein binding
5. P GO:1990583 phospholipase D activator activity
5. P GO:0045196 establishment or maintenance of neuroblast polarity
5. P GO:0001778 plasma membrane repair
5. P GO:0036267 invasive filamentous growth
5. P GO:0006185 dGDP biosynthetic process
5. P GO:0031001 response to brefeldin A
5. P GO:0001726 ruffle
5. P GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
5. P GO:1902774 late endosome to lysosome transport
5. P GO:0031902 late endosome membrane
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0031996 thioesterase binding
5. P GO:0001822 kidney development
5. P GO:0034394 protein localization to cell surface
5. P GO:0101004 cytolytic granule membrane
5. P GO:0006886 intracellular protein transport
5. P GO:0030100 regulation of endocytosis
5. P GO:0010009 cytoplasmic side of endosome membrane
7. B GO:0000028 ribosomal small subunit assembly
7. B GO:0070129 regulation of mitochondrial translation
7. B GO:0044065 regulation of respiratory system process
7. B GO:0033234 negative regulation of protein sumoylation
7. B GO:0051168 nuclear export
7. B GO:1904816 positive regulation of protein localization to chromosome, telomeric region
7. B GO:0030488 tRNA methylation
7. B GO:0032168 hyphal septin ring
7. B GO:0070899 mitochondrial tRNA wobble uridine modification
7. B GO:0000399 cellular bud neck septin structure
7. B GO:0032211 negative regulation of telomere maintenance via telomerase
7. B GO:0006033 chitin localization
7. B GO:0005761 mitochondrial ribosome
7. B GO:0070783 growth of unicellular organism as a thread of attached cells
7. B GO:0000054 ribosomal subunit export from nucleus
7. B GO:0015030 Cajal body
7. B GO:0043024 ribosomal small subunit binding
7. B GO:0048825 cotyledon development
7. B GO:0002098 tRNA wobble uridine modification
7. B GO:1903059 regulation of protein lipidation
7. B GO:0097216 guanosine tetraphosphate binding
7. B GO:0006400 tRNA modification
7. B GO:0090070 positive regulation of ribosome biogenesis
7. B GO:0010077 maintenance of inflorescence meristem identity

Uniprot GO Annotations

GO Description
GO:0000917 division septum assembly
GO:0090529 cell septum assembly
GO:0046872 metal ion binding
GO:0051301 cell division
GO:0007049 cell cycle
GO:0000166 nucleotide binding
GO:0005525 GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF B6J2X4 Probable GTP-binding protein EngB 0.00e+00 9.65e-46 2.05e-35 0.9332
1. PBF Q5M5A9 Probable GTP-binding protein EngB 0.00e+00 9.15e-44 2.92e-59 0.9832
1. PBF Q5FPX9 Probable GTP-binding protein EngB 0.00e+00 2.78e-35 2.63e-23 0.8965
1. PBF Q04W49 Probable GTP-binding protein EngB 0.00e+00 1.24e-38 4.31e-23 0.8906
1. PBF A9IXE1 Probable GTP-binding protein EngB 0.00e+00 1.57e-40 6.30e-23 0.9051
1. PBF A6H1A5 Probable GTP-binding protein EngB 0.00e+00 3.13e-51 1.14e-32 0.9369
1. PBF Q8DDQ8 Probable GTP-binding protein EngB 0.00e+00 4.33e-42 5.85e-33 0.9248
1. PBF C1D5Q6 Probable GTP-binding protein EngB 0.00e+00 1.41e-29 5.96e-32 0.9143
1. PBF A8GM60 Probable GTP-binding protein EngB 0.00e+00 7.21e-29 9.81e-26 0.897
1. PBF Q48U21 Probable GTP-binding protein EngB 0.00e+00 7.22e-47 4.39e-61 0.9826
1. PBF Q2KD28 Probable GTP-binding protein EngB 0.00e+00 2.98e-43 9.15e-20 0.9146
1. PBF Q98QX1 Probable GTP-binding protein EngB 0.00e+00 1.06e-57 5.30e-30 0.9145
1. PBF Q3YVA8 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9221
1. PBF Q66GG3 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9294
1. PBF Q9PQM5 Probable GTP-binding protein EngB 0.00e+00 3.48e-26 5.38e-35 0.9192
1. PBF A8A6W6 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9069
1. PBF Q1LI69 Probable GTP-binding protein EngB 0.00e+00 6.49e-32 5.22e-27 0.867
1. PBF Q7VNY0 Probable GTP-binding protein EngB 0.00e+00 2.83e-48 2.95e-39 0.9221
1. PBF B2TVL1 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9224
1. PBF B9KIV1 Probable GTP-binding protein EngB 0.00e+00 1.79e-40 2.06e-25 0.9327
1. PBF Q5WEP2 Probable GTP-binding protein EngB 0.00e+00 7.31e-57 8.32e-48 0.9717
1. PBF A0AJ07 Probable GTP-binding protein EngB 0.00e+00 9.20e-59 8.72e-54 0.9752
1. PBF C6DJE1 Probable GTP-binding protein EngB 0.00e+00 3.74e-47 8.83e-39 0.9279
1. PBF B1JR12 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9251
1. PBF Q7MQ23 Probable GTP-binding protein EngB 0.00e+00 1.11e-41 6.04e-33 0.9187
1. PBF Q9ZG89 GTP-binding protein EngB 0.00e+00 6.97e-15 5.03e-30 0.9114
1. PBF B3QS35 Probable GTP-binding protein EngB 0.00e+00 2.57e-56 4.58e-34 0.9278
1. PBF Q604E1 Probable GTP-binding protein EngB 0.00e+00 1.05e-46 4.07e-40 0.9136
1. PBF B2G6R5 Probable GTP-binding protein EngB 0.00e+00 5.38e-56 1.01e-48 0.9716
1. PBF A1RE02 Probable GTP-binding protein EngB 0.00e+00 9.72e-37 3.31e-33 0.8944
1. PBF Q4A5B4 Probable GTP-binding protein EngB 0.00e+00 1.19e-55 1.69e-35 0.9262
1. PBF B8H1E7 Probable GTP-binding protein EngB 0.00e+00 6.97e-15 5.03e-30 0.9129
1. PBF Q12FG5 Probable GTP-binding protein EngB 0.00e+00 3.45e-22 7.53e-26 0.8945
1. PBF Q04XC3 Probable GTP-binding protein EngB 0.00e+00 1.24e-38 4.31e-23 0.8999
1. PBF A6U2E1 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9771
1. PBF Q2FG63 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9663
1. PBF Q4ZZT0 Probable GTP-binding protein EngB 0.00e+00 3.88e-42 3.83e-37 0.9137
1. PBF Q0TQK6 Probable GTP-binding protein EngB 0.00e+00 2.07e-53 1.88e-56 0.9248
1. PBF Q1R448 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.905
1. PBF A7FCP5 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9282
1. PBF A5N2K5 Probable GTP-binding protein EngB 0.00e+00 4.16e-58 9.11e-59 0.9612
1. PBF A5ITJ8 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9666
1. PBF Q2YTB6 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9661
1. PBF Q1QH69 Probable GTP-binding protein EngB 0.00e+00 4.29e-35 2.36e-24 0.9216
1. PBF B1YJV8 Probable GTP-binding protein EngB 0.00e+00 9.80e-54 5.57e-56 0.9782
1. PBF O05132 Probable GTP-binding protein EngB 0.00e+00 8.23e-43 9.34e-36 0.885
1. PBF Q30ZZ9 Probable GTP-binding protein EngB 0.00e+00 8.25e-28 1.53e-30 0.9009
1. PBF B7GH28 Probable GTP-binding protein EngB 0.00e+00 1.49e-55 1.71e-52 0.9704
1. PBF Q6G8Q2 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9664
1. PBF P57947 Probable GTP-binding protein EngB 0.00e+00 1.09e-47 5.16e-43 0.9247
1. PBF Q1RH06 Probable GTP-binding protein EngB 0.00e+00 6.61e-35 1.80e-25 0.8907
1. PBF Q5LDL2 Probable GTP-binding protein EngB 0.00e+00 1.50e-56 1.94e-30 0.9275
1. PBF Q1J740 Probable GTP-binding protein EngB 0.00e+00 3.98e-46 1.43e-61 0.983
1. PBF Q1QE34 Probable GTP-binding protein EngB 0.00e+00 4.73e-15 1.32e-33 0.8834
1. PBF Q5P7M2 Probable GTP-binding protein EngB 0.00e+00 3.11e-37 5.09e-33 0.9193
1. PBF C3MF47 Probable GTP-binding protein EngB 0.00e+00 9.96e-34 1.54e-23 0.9114
1. PBF Q7M7V3 Probable GTP-binding protein EngB 0.00e+00 3.83e-41 2.12e-25 0.8516
1. PBF Q0AWF4 Probable GTP-binding protein EngB 0.00e+00 1.38e-55 2.49e-43 0.945
1. PBF B2JI34 Probable GTP-binding protein EngB 0.00e+00 3.56e-36 8.95e-28 0.9073
1. PBF P64071 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9663
1. PBF A6TG68 Probable GTP-binding protein EngB 0.00e+00 6.97e-46 1.03e-37 0.9222
1. PBF Q8F9P7 Probable GTP-binding protein EngB 0.00e+00 6.20e-42 3.02e-21 0.897
1. PBF A9KBW2 Probable GTP-binding protein EngB 0.00e+00 9.65e-46 2.05e-35 0.933
1. PBF B7V729 Probable GTP-binding protein EngB 0.00e+00 1.83e-38 8.24e-37 0.8833
1. PBF Q39KD6 Probable GTP-binding protein EngB 0.00e+00 4.14e-39 3.98e-26 0.9112
1. PBF Q3JDM3 Probable GTP-binding protein EngB 0.00e+00 8.84e-48 4.68e-35 0.9231
1. PBF Q8Y6X3 Probable GTP-binding protein EngB 0.00e+00 4.55e-59 4.90e-54 0.9757
1. PBF A8FL71 Probable GTP-binding protein EngB 0.00e+00 4.77e-48 3.09e-29 0.8701
1. PBF Q83AV6 Probable GTP-binding protein EngB 0.00e+00 1.14e-45 3.61e-36 0.9324
1. PBF A5D451 Probable GTP-binding protein EngB 0.00e+00 8.95e-52 2.87e-56 0.9698
1. PBF B2UX10 Probable GTP-binding protein EngB 0.00e+00 2.81e-60 1.13e-59 0.9459
1. PBF C1DH55 Probable GTP-binding protein EngB 0.00e+00 2.93e-38 1.07e-36 0.9258
1. PBF Q3K0K1 Probable GTP-binding protein EngB 0.00e+00 4.83e-49 3.73e-62 0.9827
1. PBF Q03F28 Probable GTP-binding protein EngB 0.00e+00 2.15e-56 8.93e-48 0.9722
1. PBF Q2J2B7 Probable GTP-binding protein EngB 0.00e+00 5.08e-36 1.51e-23 0.9247
1. PBF Q6MEP0 Probable GTP-binding protein EngB 0.00e+00 3.05e-43 1.70e-30 0.9187
1. PBF Q21PP0 Probable GTP-binding protein EngB 0.00e+00 5.93e-42 1.89e-34 0.9103
1. PBF B3CL86 Probable GTP-binding protein EngB 0.00e+00 3.78e-54 2.26e-28 0.9012
1. PBF A3P082 Probable GTP-binding protein EngB 0.00e+00 1.40e-39 9.03e-28 0.9146
1. PBF C0MA50 Probable GTP-binding protein EngB 0.00e+00 1.64e-46 3.27e-63 0.9804
1. PBF A8ETG7 Probable GTP-binding protein EngB 0.00e+00 1.23e-42 5.10e-29 0.8385
1. PBF B8J030 Probable GTP-binding protein EngB 0.00e+00 1.04e-48 1.54e-29 0.9084
1. PBF Q8UIB4 Probable GTP-binding protein EngB 0.00e+00 3.07e-34 9.04e-23 0.8996
1. PBF Q0K651 Probable GTP-binding protein EngB 0.00e+00 3.29e-25 8.61e-26 0.8893
1. PBF A9NFM5 Probable GTP-binding protein EngB 0.00e+00 1.32e-53 1.01e-43 0.9339
1. PBF Q4UYM8 Probable GTP-binding protein EngB 0.00e+00 4.76e-45 2.59e-36 0.9209
1. PBF Q1JC92 Probable GTP-binding protein EngB 0.00e+00 1.19e-45 1.81e-61 0.9813
1. PBF Q4UNC2 Probable GTP-binding protein EngB 0.00e+00 3.34e-33 8.25e-25 0.8928
1. PBF C5CEL1 Probable GTP-binding protein EngB 0.00e+00 2.17e-51 1.17e-29 0.9405
1. PBF B7IDZ1 Probable GTP-binding protein EngB 0.00e+00 1.18e-47 8.07e-29 0.9058
1. PBF Q9X1H7 Probable GTP-binding protein EngB 0.00e+00 1.85e-52 1.79e-40 0.9401
1. PBF Q9K8F7 Probable GTP-binding protein EngB 0.00e+00 7.54e-55 3.22e-43 0.9715
1. PBF B4S284 Probable GTP-binding protein EngB 0.00e+00 8.31e-41 3.71e-36 0.9149
1. PBF B9J8E2 Probable GTP-binding protein EngB 0.00e+00 5.62e-31 7.49e-22 0.9217
1. PBF B6JP76 Probable GTP-binding protein EngB 0.00e+00 3.48e-47 5.34e-23 0.7939
1. PBF A4TSG6 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9267
1. PBF Q5QXJ0 Probable GTP-binding protein EngB 0.00e+00 1.87e-51 2.74e-34 0.9231
1. PBF Q1CN51 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9244
1. PBF C4K8N5 Probable GTP-binding protein EngB 0.00e+00 1.69e-51 1.02e-37 0.9152
1. PBF Q2Y797 Probable GTP-binding protein EngB 0.00e+00 1.85e-17 2.37e-30 0.9175
1. PBF Q4FV29 Probable GTP-binding protein EngB 0.00e+00 1.71e-11 1.70e-33 0.8774
1. PBF A1JHT4 Probable GTP-binding protein EngB 0.00e+00 1.61e-40 4.43e-36 0.9267
1. PBF B3R7D7 Probable GTP-binding protein EngB 0.00e+00 2.08e-22 1.89e-26 0.8736
1. PBF P0A6P8 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9214
1. PBF Q3B6D1 Probable GTP-binding protein EngB 0.00e+00 4.28e-41 6.23e-35 0.9403
1. PBF Q5HNN0 Probable GTP-binding protein EngB 0.00e+00 5.65e-57 2.13e-47 0.9768
1. PBF Q633X5 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9682
1. PBF Q5FKR5 Probable GTP-binding protein EngB 0.00e+00 1.20e-57 3.18e-46 0.9636
1. PBF B8EDT1 Probable GTP-binding protein EngB 0.00e+00 3.08e-36 3.89e-33 0.8948
1. PBF B9LZU0 Probable GTP-binding protein EngB 0.00e+00 6.25e-40 3.50e-48 0.9504
1. PBF A5VWQ6 Probable GTP-binding protein EngB 0.00e+00 1.28e-39 1.26e-35 0.9191
1. PBF A7Z7A9 Probable GTP-binding protein EngB 0.00e+00 9.36e-63 6.25e-51 0.9774
1. PBF A4YCD0 Probable GTP-binding protein EngB 0.00e+00 8.55e-36 1.26e-32 0.8947
1. PBF B5ZN41 Probable GTP-binding protein EngB 0.00e+00 1.97e-41 7.41e-20 0.9117
1. PBF Q9A088 Probable GTP-binding protein EngB 0.00e+00 4.91e-46 1.52e-61 0.9818
1. PBF Q1D7Z0 Probable GTP-binding protein EngB 0.00e+00 7.56e-50 1.68e-38 0.9279
1. PBF B7HQM9 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9678
1. PBF A6U5K8 Probable GTP-binding protein EngB 0.00e+00 1.22e-34 6.79e-23 0.9101
1. PBF Q0BU77 Probable GTP-binding protein EngB 0.00e+00 3.26e-19 6.48e-24 0.88
1. PBF A8Z2J4 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9668
1. PBF A3QJD3 Probable GTP-binding protein EngB 0.00e+00 1.03e-37 5.96e-31 0.9021
1. PBF B1LBK5 Probable GTP-binding protein EngB 0.00e+00 7.63e-54 4.89e-40 0.9346
1. PBF B7UNI7 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9078
1. PBF C3P9F4 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9673
1. PBF Q5GSS9 Probable GTP-binding protein EngB 0.00e+00 1.53e-55 1.43e-27 0.9263
1. PBF Q5HF99 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9662
1. PBF Q48PV6 Probable GTP-binding protein EngB 0.00e+00 2.52e-41 5.65e-37 0.9279
1. PBF Q0AJF3 Probable GTP-binding protein EngB 0.00e+00 8.72e-28 1.94e-26 0.9232
1. PBF Q8ZJS0 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9255
1. PBF B1JU53 Probable GTP-binding protein EngB 0.00e+00 7.95e-40 1.11e-27 0.9126
1. PBF B4TBT8 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9203
1. PBF Q4A7S3 Probable GTP-binding protein EngB 0.00e+00 9.48e-21 1.06e-23 0.858
1. PBF P47577 Probable GTP-binding protein EngB 0.00e+00 1.44e-59 8.26e-26 0.929
1. PBF Q1H4T4 Probable GTP-binding protein EngB 0.00e+00 7.91e-45 5.40e-28 0.9086
1. PBF Q49YA5 Probable GTP-binding protein EngB 0.00e+00 4.27e-52 1.11e-44 0.9636
1. PBF Q89AD0 Probable GTP-binding protein EngB 0.00e+00 4.26e-23 1.25e-23 0.9173
1. PBF B9JZK9 Probable GTP-binding protein EngB 0.00e+00 2.90e-33 1.22e-23 0.9009
1. PBF Q8XV43 Probable GTP-binding protein EngB 0.00e+00 1.50e-25 2.62e-24 0.868
1. PBF Q1C237 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9277
1. PBF Q13F29 Probable GTP-binding protein EngB 0.00e+00 2.98e-37 3.13e-23 0.9186
1. PBF A2RF16 Probable GTP-binding protein EngB 0.00e+00 3.98e-46 1.43e-61 0.9828
1. PBF C1CLR7 Probable GTP-binding protein EngB 0.00e+00 7.00e-52 8.58e-61 0.9671
1. PBF C1CSI8 Probable GTP-binding protein EngB 0.00e+00 3.87e-52 2.15e-61 0.9834
1. PBF B2UEI8 Probable GTP-binding protein EngB 0.00e+00 1.43e-24 1.75e-22 0.8697
1. PBF A7GTE8 Probable GTP-binding protein EngB 0.00e+00 1.20e-57 5.57e-55 0.9678
1. PBF B2TPB6 Probable GTP-binding protein EngB 0.00e+00 5.43e-60 6.29e-60 0.9423
1. PBF Q04H41 Probable GTP-binding protein EngB 0.00e+00 3.56e-58 3.23e-46 0.9642
1. PBF Q98D85 Probable GTP-binding protein EngB 0.00e+00 4.25e-45 1.10e-22 0.9151
1. PBF B8I8N7 Probable GTP-binding protein EngB 0.00e+00 2.12e-47 1.89e-41 0.9454
1. PBF Q5KWK2 Probable GTP-binding protein EngB 0.00e+00 1.87e-57 2.43e-54 0.9763
1. PBF C5D5L1 Probable GTP-binding protein EngB 0.00e+00 2.18e-55 1.45e-54 0.9765
1. PBF A8GLI8 Probable GTP-binding protein EngB 0.00e+00 4.74e-42 4.20e-37 0.9233
1. PBF Q3IJG3 Probable GTP-binding protein EngB 0.00e+00 1.55e-37 1.86e-31 0.9104
1. PBF B8D9L0 Probable GTP-binding protein EngB 0.00e+00 3.59e-53 3.78e-25 0.8857
1. PBF Q6HD57 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9683
1. PBF Q7W2C4 Probable GTP-binding protein EngB 0.00e+00 3.46e-46 1.09e-29 0.9192
1. PBF Q8P5E4 Probable GTP-binding protein EngB 0.00e+00 4.76e-45 2.59e-36 0.9221
1. PBF Q6F7Q4 Probable GTP-binding protein EngB 0.00e+00 3.20e-09 1.40e-34 0.9153
1. PBF B5E6L1 Probable GTP-binding protein EngB 0.00e+00 1.61e-51 2.08e-60 0.9812
1. PBF Q8EPM2 Probable GTP-binding protein EngB 0.00e+00 2.65e-61 3.83e-53 0.976
1. PBF A1BJ02 Probable GTP-binding protein EngB 0.00e+00 4.60e-49 2.74e-32 0.9371
1. PBF Q1JHC1 Probable GTP-binding protein EngB 0.00e+00 1.19e-45 1.81e-61 0.9826
1. PBF Q7VTA1 Probable GTP-binding protein EngB 0.00e+00 3.46e-46 1.09e-29 0.9185
1. PBF A5IMB8 Probable GTP-binding protein EngB 0.00e+00 1.51e-52 1.07e-39 0.9355
1. PBF B3EP28 Probable GTP-binding protein EngB 0.00e+00 4.66e-50 1.11e-36 0.942
1. PBF Q57HL3 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9151
1. PBF Q9PHL7 Probable GTP-binding protein EngB 0.00e+00 4.30e-47 3.51e-29 0.8445
1. PBF Q8D338 Probable GTP-binding protein EngB 0.00e+00 1.03e-46 3.72e-15 0.8921
1. PBF Q6NC42 Probable GTP-binding protein EngB 0.00e+00 3.79e-35 1.19e-23 0.9235
1. PBF Q31JM9 Probable GTP-binding protein EngB 0.00e+00 5.14e-39 8.24e-36 0.9246
1. PBF A9QYI0 Probable GTP-binding protein EngB 0.00e+00 2.37e-42 7.89e-36 0.9259
1. PBF C0R5M1 Probable GTP-binding protein EngB 0.00e+00 2.51e-51 4.08e-27 0.8952
1. PBF A4SCU1 Probable GTP-binding protein EngB 0.00e+00 1.41e-43 8.06e-33 0.9489
1. PBF C1CFF1 Probable GTP-binding protein EngB 0.00e+00 1.96e-51 1.60e-60 0.9821
1. PBF Q4QLH6 Probable GTP-binding protein EngB 0.00e+00 1.49e-48 3.69e-41 0.8981
1. PBF Q32A36 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9197
1. PBF Q03W10 Probable GTP-binding protein EngB 0.00e+00 1.66e-56 4.91e-49 0.9721
1. PBF Q8CS80 Probable GTP-binding protein EngB 0.00e+00 5.65e-57 2.13e-47 0.9637
1. PBF P46453 Probable GTP-binding protein EngB 0.00e+00 9.27e-48 7.45e-41 0.8979
1. PBF Q82S94 Probable GTP-binding protein EngB 0.00e+00 8.14e-25 3.17e-29 0.9249
1. PBF A8FPD5 Probable GTP-binding protein EngB 0.00e+00 9.32e-37 6.27e-33 0.894
1. PBF Q2SSN1 Probable GTP-binding protein EngB 0.00e+00 2.66e-101 2.49e-137 0.9994
1. PBF B1JFJ3 Probable GTP-binding protein EngB 0.00e+00 1.18e-41 2.15e-35 0.9166
1. PBF A9MYC7 Probable GTP-binding protein EngB 0.00e+00 1.37e-44 4.25e-38 0.9253
1. PBF A9NAD8 Probable GTP-binding protein EngB 0.00e+00 2.50e-45 3.31e-36 0.9339
1. PBF B0SC16 Probable GTP-binding protein EngB 0.00e+00 1.29e-42 4.53e-23 0.8805
1. PBF Q1IGY1 Probable GTP-binding protein EngB 0.00e+00 2.66e-43 1.49e-35 0.8973
1. PBF A4XNL3 Probable GTP-binding protein EngB 0.00e+00 5.01e-38 4.47e-35 0.9231
1. PBF C3L700 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9682
1. PBF Q64UN4 Probable GTP-binding protein EngB 0.00e+00 6.77e-57 1.92e-30 0.929
1. PBF C0Q3G7 Probable GTP-binding protein EngB 0.00e+00 2.55e-44 8.04e-38 0.9136
1. PBF Q11RJ8 Probable GTP-binding protein EngB 0.00e+00 4.62e-54 3.67e-32 0.9279
1. PBF Q89BP9 Probable GTP-binding protein EngB 0.00e+00 2.55e-36 3.71e-29 0.9182
1. PBF Q8RHK1 Probable GTP-binding protein EngB 0.00e+00 9.45e-57 1.68e-40 0.9397
1. PBF B3E2D1 Probable GTP-binding protein EngB 0.00e+00 2.03e-45 1.11e-41 0.9367
1. PBF A1VZ10 Probable GTP-binding protein EngB 0.00e+00 1.26e-47 5.88e-29 0.8707
1. PBF B1AIQ5 Probable GTP-binding protein EngB 0.00e+00 3.48e-26 5.38e-35 0.9196
1. PBF B3EGV8 Probable GTP-binding protein EngB 0.00e+00 7.02e-53 3.19e-31 0.9414
1. PBF P0DA92 Probable GTP-binding protein EngB 0.00e+00 5.39e-46 4.34e-61 0.9828
1. PBF A4SUZ2 Probable GTP-binding protein EngB 0.00e+00 2.66e-36 1.67e-24 0.9266
1. PBF Q3SMA6 Probable GTP-binding protein EngB 0.00e+00 7.14e-48 3.92e-33 0.9144
1. PBF Q07W45 Probable GTP-binding protein EngB 0.00e+00 2.11e-36 4.64e-32 0.8949
1. PBF Q5FGZ3 Probable GTP-binding protein EngB 0.00e+00 5.22e-51 1.27e-31 0.879
1. PBF P64070 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9665
1. PBF A1S1P8 Probable GTP-binding protein EngB 0.00e+00 5.03e-39 1.06e-33 0.8924
1. PBF Q5HB81 Probable GTP-binding protein EngB 0.00e+00 4.89e-50 1.27e-31 0.8791
1. PBF A7HDS7 Probable GTP-binding protein EngB 0.00e+00 6.88e-43 1.34e-37 0.9314
1. PBF A5UIP2 Probable GTP-binding protein EngB 0.00e+00 9.27e-48 7.45e-41 0.8978
1. PBF Q9L6G1 Probable GTP-binding protein EngB 0.00e+00 1.42e-56 1.92e-59 0.9663
1. PBF B2SG30 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9169
1. PBF Q3KKA7 Probable GTP-binding protein EngB 0.00e+00 5.01e-38 8.60e-36 0.889
1. PBF Q68XW9 Probable GTP-binding protein EngB 0.00e+00 1.99e-28 3.20e-23 0.8882
1. PBF Q833M8 Probable GTP-binding protein EngB 0.00e+00 5.32e-59 2.32e-55 0.9784
1. PBF A6VLN4 Probable GTP-binding protein EngB 0.00e+00 7.30e-46 4.34e-38 0.9223
1. PBF Q8DZ11 Probable GTP-binding protein EngB 0.00e+00 4.83e-49 3.73e-62 0.9847
1. PBF Q6DB76 Probable GTP-binding protein EngB 0.00e+00 2.62e-47 4.60e-37 0.9316
1. PBF Q9KVN0 Probable GTP-binding protein EngB 0.00e+00 5.42e-34 4.90e-33 0.9226
1. PBF Q0ST57 Probable GTP-binding protein EngB 0.00e+00 1.59e-52 5.42e-56 0.9431
1. PBF B5FNZ2 Probable GTP-binding protein EngB 0.00e+00 9.73e-45 4.21e-38 0.9234
1. PBF Q5XCL9 Probable GTP-binding protein EngB 0.00e+00 3.98e-46 1.43e-61 0.9828
1. PBF Q8K9C9 Probable GTP-binding protein EngB 0.00e+00 5.25e-56 1.46e-28 0.892
1. PBF B6J4E1 Probable GTP-binding protein EngB 0.00e+00 2.33e-45 1.20e-35 0.933
1. PBF A6T3H0 Probable GTP-binding protein EngB 0.00e+00 3.22e-30 3.05e-25 0.9057
1. PBF Q0C548 Probable GTP-binding protein EngB 0.00e+00 1.96e-25 4.18e-30 0.9031
1. PBF B8ZLT0 Probable GTP-binding protein EngB 0.00e+00 3.87e-52 2.15e-61 0.9821
1. PBF Q9CGE5 Probable GTP-binding protein EngB 0.00e+00 4.86e-54 1.78e-59 0.9652
1. PBF B1XST2 Probable GTP-binding protein EngB 0.00e+00 1.33e-37 4.86e-24 0.9197
1. PBF A9ADM4 Probable GTP-binding protein EngB 0.00e+00 1.69e-41 2.68e-26 0.893
1. PBF Q817Q5 Probable GTP-binding protein EngB 0.00e+00 1.33e-58 5.45e-55 0.9687
1. PBF A5UCY6 Probable GTP-binding protein EngB 0.00e+00 4.28e-49 1.67e-41 0.9208
1. PBF Q4A9N9 Probable GTP-binding protein EngB 0.00e+00 1.79e-21 2.84e-23 0.8655
1. PBF Q83PF4 Probable GTP-binding protein EngB 0.00e+00 1.85e-42 4.48e-37 0.9212
1. PBF A8GQS1 Probable GTP-binding protein EngB 0.00e+00 2.20e-31 3.90e-24 0.8961
1. PBF B8DHJ0 Probable GTP-binding protein EngB 0.00e+00 8.08e-59 6.87e-54 0.9754
1. PBF Q0BJ15 Probable GTP-binding protein EngB 0.00e+00 5.25e-39 2.24e-27 0.9242
1. PBF Q12I30 Probable GTP-binding protein EngB 0.00e+00 2.49e-40 2.66e-32 0.8961
1. PBF B3QCI1 Probable GTP-binding protein EngB 0.00e+00 1.22e-34 1.19e-23 0.9212
1. PBF Q1JM76 Probable GTP-binding protein EngB 0.00e+00 1.19e-45 1.81e-61 0.9817
1. PBF Q1WUI3 Probable GTP-binding protein EngB 0.00e+00 1.97e-59 1.03e-46 0.9706
1. PBF Q73IC3 Probable GTP-binding protein EngB 0.00e+00 3.34e-52 2.01e-27 0.9042
1. PBF A7X395 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.966
1. PBF Q2YJR1 Probable GTP-binding protein EngB 0.00e+00 9.41e-14 1.38e-21 0.918
1. PBF Q92JC9 Probable GTP-binding protein EngB 0.00e+00 1.02e-31 4.27e-26 0.894
1. PBF Q7N9E9 Probable GTP-binding protein EngB 0.00e+00 5.25e-48 6.75e-35 0.9168
1. PBF A5F4I0 Probable GTP-binding protein EngB 0.00e+00 2.35e-34 5.23e-33 0.9238
1. PBF B8GTD2 Probable GTP-binding protein EngB 0.00e+00 8.10e-42 2.12e-39 0.9262
1. PBF P64068 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9251
1. PBF B4SC74 Probable GTP-binding protein EngB 0.00e+00 3.87e-52 1.89e-34 0.9438
1. PBF Q7NAR6 Probable GTP-binding protein EngB 0.00e+00 1.70e-53 2.95e-35 0.9103
1. PBF B9K8C0 Probable GTP-binding protein EngB 0.00e+00 1.22e-54 1.38e-41 0.9391
1. PBF Q8E8J7 Probable GTP-binding protein EngB 0.00e+00 6.13e-36 1.92e-34 0.8957
1. PBF P0DA93 Probable GTP-binding protein EngB 0.00e+00 5.39e-46 4.34e-61 0.9816
1. PBF B8FLF0 Probable GTP-binding protein EngB 0.00e+00 4.14e-39 7.06e-41 0.9449
1. PBF A3M990 Probable GTP-binding protein EngB 0.00e+00 2.30e-22 3.09e-35 0.9214
1. PBF Q1CR39 Probable GTP-binding protein EngB 0.00e+00 4.44e-48 8.25e-23 0.8094
1. PBF B0KG04 Probable GTP-binding protein EngB 0.00e+00 1.38e-41 5.84e-36 0.9164
1. PBF Q46WH5 Probable GTP-binding protein EngB 0.00e+00 7.35e-29 2.97e-27 0.8749
1. PBF A4JAS1 Probable GTP-binding protein EngB 0.00e+00 8.35e-38 9.62e-28 0.9128
1. PBF Q11LE3 Probable GTP-binding protein EngB 0.00e+00 5.00e-26 1.57e-22 0.907
1. PBF Q7MX68 Probable GTP-binding protein EngB 0.00e+00 1.78e-53 1.06e-32 0.9351
1. PBF A7NBT0 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9222
1. PBF A0Q6R7 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9212
1. PBF B3QQY9 Probable GTP-binding protein EngB 0.00e+00 5.94e-50 9.24e-36 0.9348
1. PBF B3ES13 Probable GTP-binding protein EngB 0.00e+00 5.06e-44 2.75e-37 0.9401
1. PBF Q4KKJ8 Probable GTP-binding protein EngB 0.00e+00 1.11e-40 1.01e-35 0.9038
1. PBF C3LPV3 Probable GTP-binding protein EngB 0.00e+00 5.42e-34 4.90e-33 0.9235
1. PBF B7HEA1 Probable GTP-binding protein EngB 0.00e+00 1.33e-58 5.45e-55 0.9688
1. PBF C4L968 Probable GTP-binding protein EngB 0.00e+00 1.93e-45 1.30e-35 0.9248
1. PBF Q0HD98 Probable GTP-binding protein EngB 0.00e+00 2.13e-35 6.75e-34 0.8933
1. PBF B0SJA9 Probable GTP-binding protein EngB 0.00e+00 1.29e-42 4.53e-23 0.8786
1. PBF Q9JY03 Probable GTP-binding protein EngB 0.00e+00 3.06e-44 2.01e-35 0.8848
1. PBF C5BJZ8 Probable GTP-binding protein EngB 0.00e+00 4.38e-41 8.99e-39 0.9085
1. PBF Q5E8S6 Probable GTP-binding protein EngB 0.00e+00 2.21e-39 8.73e-32 0.9129
1. PBF A5IXT1 Probable GTP-binding protein EngB 0.00e+00 1.78e-55 6.14e-25 0.8852
1. PBF B8D7W2 Probable GTP-binding protein EngB 0.00e+00 3.59e-53 3.78e-25 0.8845
1. PBF B8CY70 Probable GTP-binding protein EngB 0.00e+00 6.68e-53 1.45e-41 0.9597
1. PBF Q8X8H0 Probable GTP-binding protein EngB 0.00e+00 2.43e-43 1.09e-37 0.9207
1. PBF Q87TG0 Probable GTP-binding protein EngB 0.00e+00 1.08e-34 1.23e-32 0.9174
1. PBF C5BC84 Probable GTP-binding protein EngB 0.00e+00 4.95e-44 2.34e-36 0.9283
1. PBF Q92SF6 Probable GTP-binding protein EngB 0.00e+00 2.12e-34 6.79e-23 0.911
1. PBF C4Z1T3 Probable GTP-binding protein EngB 0.00e+00 3.13e-38 9.50e-44 0.9516
1. PBF Q6AJW0 Probable GTP-binding protein EngB 0.00e+00 2.14e-52 8.04e-29 0.9509
1. PBF B2SNS8 Probable GTP-binding protein EngB 0.00e+00 2.99e-44 2.79e-36 0.9191
1. PBF Q92BF6 Probable GTP-binding protein EngB 0.00e+00 6.22e-59 9.11e-54 0.9749
1. PBF B5XL04 Probable GTP-binding protein EngB 0.00e+00 1.19e-45 1.81e-61 0.9827
1. PBF Q8PPG1 Probable GTP-binding protein EngB 0.00e+00 3.79e-36 3.48e-36 0.9193
1. PBF P64073 Probable GTP-binding protein EngB 0.00e+00 1.61e-51 2.08e-60 0.982
1. PBF Q5M0S3 Probable GTP-binding protein EngB 0.00e+00 9.15e-44 2.92e-59 0.9833
1. PBF A0RJ86 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9686
1. PBF Q2SU58 Probable GTP-binding protein EngB 0.00e+00 2.07e-39 2.32e-28 0.9044
1. PBF A9VIU3 Probable GTP-binding protein EngB 0.00e+00 7.17e-58 9.81e-55 0.9685
1. PBF Q6G2G5 Probable GTP-binding protein EngB 0.00e+00 9.46e-40 8.39e-23 0.8967
1. PBF A6WUH1 Probable GTP-binding protein EngB 0.00e+00 3.08e-36 3.89e-33 0.8959
1. PBF P64066 Probable GTP-binding protein EngB 0.00e+00 9.41e-14 1.38e-21 0.9277
1. PBF Q600K7 Probable GTP-binding protein EngB 0.00e+00 5.98e-21 1.10e-23 0.8672
1. PBF A3CMV2 Probable GTP-binding protein EngB 0.00e+00 5.96e-56 2.37e-61 0.982
1. PBF P38424 Probable GTP-binding protein EngB 0.00e+00 2.86e-63 2.93e-54 0.9773
1. PBF A8FFV6 Probable GTP-binding protein EngB 0.00e+00 1.07e-62 1.01e-49 0.9722
1. PBF Q72BH2 Probable GTP-binding protein EngB 0.00e+00 1.26e-26 2.02e-33 0.8995
1. PBF Q8A8T4 Probable GTP-binding protein EngB 0.00e+00 2.18e-55 1.50e-29 0.9352
1. PBF B2RL89 Probable GTP-binding protein EngB 0.00e+00 1.78e-53 1.06e-32 0.9324
1. PBF Q3YS22 Probable GTP-binding protein EngB 0.00e+00 1.77e-44 1.13e-26 0.8771
1. PBF Q47IE9 Probable GTP-binding protein EngB 0.00e+00 3.38e-32 4.96e-34 0.908
1. PBF A8MIS4 Probable GTP-binding protein EngB 0.00e+00 7.39e-47 2.29e-52 0.9641
1. PBF Q2A3S7 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9215
1. PBF B5EZX3 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9215
1. PBF Q62GN6 Probable GTP-binding protein EngB 0.00e+00 1.40e-39 9.03e-28 0.9047
1. PBF Q07TY1 Probable GTP-binding protein EngB 0.00e+00 5.62e-31 4.12e-25 0.9246
1. PBF Q72ZV7 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9687
1. PBF Q9ZE46 Probable GTP-binding protein EngB 0.00e+00 7.99e-26 3.75e-24 0.883
1. PBF Q21TK4 Probable GTP-binding protein EngB 0.00e+00 1.00e-43 1.60e-26 0.8892
1. PBF Q8E4L9 Probable GTP-binding protein EngB 0.00e+00 5.06e-49 1.98e-61 0.9834
1. PBF Q1MM59 Probable GTP-binding protein EngB 0.00e+00 2.75e-41 6.74e-20 0.9075
1. PBF Q1BRX9 Probable GTP-binding protein EngB 0.00e+00 7.95e-40 1.11e-27 0.9145
1. PBF Q039K2 Probable GTP-binding protein EngB 0.00e+00 5.65e-54 5.73e-48 0.9757
1. PBF B3PN57 Probable GTP-binding protein EngB 0.00e+00 2.63e-51 4.50e-30 0.9269
1. PBF Q13TK1 Probable GTP-binding protein EngB 0.00e+00 9.27e-41 3.62e-28 0.8955
1. PBF B0TZB8 Probable GTP-binding protein EngB 0.00e+00 1.03e-50 5.55e-36 0.9208
1. PBF A1K9D3 Probable GTP-binding protein EngB 0.00e+00 2.36e-35 2.84e-31 0.9157
1. PBF Q21B49 Probable GTP-binding protein EngB 0.00e+00 5.19e-33 2.94e-23 0.9298
1. PBF Q5FAC6 Probable GTP-binding protein EngB 0.00e+00 9.01e-43 9.44e-36 0.9063
1. PBF P64067 Probable GTP-binding protein EngB 0.00e+00 9.41e-14 1.38e-21 0.9235
1. PBF A0Q2K7 Probable GTP-binding protein EngB 0.00e+00 8.53e-57 8.67e-58 0.9784
1. PBF Q6FZ15 Probable GTP-binding protein EngB 0.00e+00 2.66e-40 5.29e-22 0.9165
1. PBF B2A1E8 Probable GTP-binding protein EngB 0.00e+00 1.55e-52 1.14e-37 0.9424
1. PBF Q8XKK5 Probable GTP-binding protein EngB 0.00e+00 2.07e-53 1.88e-56 0.9238
1. PBF C0QLA5 Probable GTP-binding protein EngB 0.00e+00 5.37e-57 5.55e-39 0.9472
1. PBF Q1GAP7 Probable GTP-binding protein EngB 0.00e+00 2.25e-65 1.97e-48 0.9645
1. PBF B0KBA1 Probable GTP-binding protein EngB 0.00e+00 6.77e-57 5.82e-40 0.9409
1. PBF Q16AA3 Probable GTP-binding protein EngB 0.00e+00 1.01e-26 9.29e-29 0.9276
1. PBF B1MXT9 Probable GTP-binding protein EngB 0.00e+00 3.50e-59 1.04e-47 0.9726
1. PBF Q576T9 Probable GTP-binding protein EngB 0.00e+00 9.41e-14 1.38e-21 0.9278
1. PBF B9MDD6 Probable GTP-binding protein EngB 0.00e+00 2.11e-36 4.75e-24 0.8904
1. PBF O67679 Probable GTP-binding protein EngB 0.00e+00 3.04e-48 4.42e-32 0.8946
1. PBF A0K3Q6 Probable GTP-binding protein EngB 0.00e+00 7.95e-40 1.11e-27 0.9138
1. PBF B8CVL3 Probable GTP-binding protein EngB 0.00e+00 5.97e-35 1.14e-32 0.8879
1. PBF Q748I9 Probable GTP-binding protein EngB 0.00e+00 1.98e-42 7.35e-47 0.9523
1. PBF C1C8F9 Probable GTP-binding protein EngB 0.00e+00 1.61e-51 2.08e-60 0.9824
1. PBF Q2RP11 Probable GTP-binding protein EngB 0.00e+00 2.19e-18 1.26e-26 0.9038
1. PBF A5G964 Probable GTP-binding protein EngB 0.00e+00 1.69e-42 1.36e-47 0.94
1. PBF Q7WR92 Probable GTP-binding protein EngB 0.00e+00 3.46e-46 1.09e-29 0.9082
1. PBF Q9RNL6 GTP-binding protein EngB 0.00e+00 1.94e-32 2.55e-27 0.9139
1. PBF B2T719 Probable GTP-binding protein EngB 0.00e+00 1.54e-40 3.84e-30 0.9095
1. PBF Q02Z21 Probable GTP-binding protein EngB 0.00e+00 1.42e-56 1.92e-59 0.9656
1. PBF Q8KAK5 Probable GTP-binding protein EngB 0.00e+00 3.80e-49 1.84e-34 0.938
1. PBF Q31UD0 Probable GTP-binding protein EngB 0.00e+00 2.07e-42 2.27e-37 0.9223
1. PBF B8FVH0 Probable GTP-binding protein EngB 0.00e+00 2.25e-50 1.64e-49 0.947
1. PBF B4SZ98 Probable GTP-binding protein EngB 0.00e+00 9.73e-45 4.21e-38 0.9172
1. PBF Q5GVY6 Probable GTP-binding protein EngB 0.00e+00 2.99e-44 2.79e-36 0.9188
1. PBF B2GBC5 Probable GTP-binding protein EngB 0.00e+00 2.82e-58 6.93e-46 0.9648
1. PBF A8ZXG6 Probable GTP-binding protein EngB 0.00e+00 4.60e-57 2.18e-49 0.9481
1. PBF Q5X097 Probable GTP-binding protein EngB 0.00e+00 3.09e-54 1.92e-36 0.9274
1. PBF C4L4J3 Probable GTP-binding protein EngB 0.00e+00 3.84e-57 1.56e-56 0.9778
1. PBF Q14II7 Probable GTP-binding protein EngB 0.00e+00 4.40e-51 1.42e-36 0.9267
1. PBF Q38WS0 Probable GTP-binding protein EngB 0.00e+00 7.72e-52 1.47e-51 0.9671
1. PBF Q9HME0 Probable GTP-binding protein EngB 6.53e-13 5.97e-17 5.94e-09 0.7158
1. PBF Q72W11 Probable GTP-binding protein EngB 0.00e+00 6.20e-42 3.02e-21 0.8964
1. PBF Q1IRA2 Probable GTP-binding protein EngB 0.00e+00 5.57e-47 3.61e-30 0.9117
1. PBF A4J7L5 Probable GTP-binding protein EngB 0.00e+00 3.59e-53 1.31e-54 0.9817
1. PBF A8AXB8 Probable GTP-binding protein EngB 0.00e+00 5.66e-56 2.61e-64 0.9696
1. PBF A6L4J3 Probable GTP-binding protein EngB 0.00e+00 4.99e-58 4.81e-30 0.9328
1. PBF Q2NZ59 Probable GTP-binding protein EngB 0.00e+00 2.99e-44 2.79e-36 0.9206
1. PBF A8EXG4 Probable GTP-binding protein EngB 0.00e+00 4.99e-33 6.47e-24 0.9031
1. PBF Q03LM9 Probable GTP-binding protein EngB 0.00e+00 1.14e-44 1.46e-59 0.9831
1. PBF Q6KHV1 Probable GTP-binding protein EngB 0.00e+00 6.08e-50 6.86e-34 0.8898
1. PBF B9KG03 Probable GTP-binding protein EngB 0.00e+00 5.86e-45 4.92e-25 0.8386
1. PBF B2IR86 Probable GTP-binding protein EngB 0.00e+00 2.45e-48 1.88e-61 0.9815
1. PBF Q04JI0 Probable GTP-binding protein EngB 0.00e+00 1.61e-51 2.08e-60 0.9811
1. PBF Q8DUH9 Probable GTP-binding protein EngB 0.00e+00 9.40e-50 4.95e-59 0.9829
1. PBF Q5ZZ86 Probable GTP-binding protein EngB 0.00e+00 2.80e-54 1.96e-36 0.928
1. PBF Q7NPV7 Probable GTP-binding protein EngB 0.00e+00 2.21e-42 3.23e-32 0.9126
1. PBF Q0I1G1 Probable GTP-binding protein EngB 0.00e+00 8.53e-50 5.55e-37 0.9186
1. PBF Q3A0Y0 Probable GTP-binding protein EngB 0.00e+00 3.29e-45 2.05e-42 0.9513
1. PBF C1F4C3 Probable GTP-binding protein EngB 0.00e+00 7.91e-39 5.35e-28 0.867
1. PBF Q2GAU7 Probable GTP-binding protein EngB 0.00e+00 4.09e-29 5.61e-32 0.9302
1. PBF Q3APK7 Probable GTP-binding protein EngB 0.00e+00 9.65e-46 2.41e-31 0.948
1. PBF Q2ILB9 Probable GTP-binding protein EngB 0.00e+00 6.89e-45 1.46e-34 0.9337
1. PBF Q0VL48 Probable GTP-binding protein EngB 0.00e+00 1.01e-40 5.44e-40 0.9261
1. PBF Q2GGM7 Probable GTP-binding protein EngB 0.00e+00 5.64e-48 1.23e-27 0.8772
1. PBF Q5PKC6 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9262
1. PBF B4UHX9 Probable GTP-binding protein EngB 0.00e+00 3.19e-43 4.10e-35 0.9329
1. PBF B4S596 Probable GTP-binding protein EngB 0.00e+00 1.61e-53 7.84e-35 0.9321
1. PBF Q39YG6 Probable GTP-binding protein EngB 0.00e+00 8.67e-45 4.30e-46 0.9511
1. PBF B0TNM9 Probable GTP-binding protein EngB 0.00e+00 4.42e-33 4.32e-33 0.8861
1. PBF B2JYK5 Probable GTP-binding protein EngB 0.00e+00 1.26e-42 6.36e-36 0.9248
1. PBF B4RQ29 Probable GTP-binding protein EngB 0.00e+00 9.01e-43 9.44e-36 0.9001
1. PBF Q3SN20 Probable GTP-binding protein EngB 0.00e+00 2.62e-31 3.13e-25 0.9265
1. PBF Q0BM81 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9253
1. PBF Q65R06 Probable GTP-binding protein EngB 0.00e+00 7.93e-47 8.72e-44 0.9219
1. PBF Q04B34 Probable GTP-binding protein EngB 0.00e+00 2.25e-65 1.97e-48 0.964
1. PBF Q65GJ7 Probable GTP-binding protein EngB 0.00e+00 7.18e-62 6.31e-55 0.9749
1. PBF B7IIY0 Probable GTP-binding protein EngB 0.00e+00 2.91e-59 6.95e-56 0.9754
1. PBF A4IYA4 Probable GTP-binding protein EngB 0.00e+00 1.33e-51 1.36e-35 0.9208
1. PBF P64069 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9243
1. PBF Q81LC2 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9692
1. PBF P75303 Probable GTP-binding protein EngB 0.00e+00 3.24e-50 8.79e-28 0.9214
1. PBF Q88RK5 Probable GTP-binding protein EngB 0.00e+00 8.86e-40 1.13e-35 0.9144
1. PBF Q5X8V4 Probable GTP-binding protein EngB 0.00e+00 3.09e-54 1.92e-36 0.9271
1. PBF A9KHA0 Probable GTP-binding protein EngB 0.00e+00 2.17e-54 8.13e-39 0.9486
1. PBF A8YUS5 Probable GTP-binding protein EngB 0.00e+00 3.02e-64 2.91e-47 0.9622
1. PBF B9DNB9 Probable GTP-binding protein EngB 0.00e+00 6.95e-56 6.73e-48 0.9648
1. PBF A3CYM5 Probable GTP-binding protein EngB 0.00e+00 3.08e-36 3.89e-33 0.8943
1. PBF Q1MSA1 Probable GTP-binding protein EngB 0.00e+00 9.51e-45 7.66e-32 0.8798
1. PBF B0S273 Probable GTP-binding protein EngB 0.00e+00 1.54e-56 2.73e-39 0.957
1. PBF A1KS92 Probable GTP-binding protein EngB 0.00e+00 4.18e-43 1.25e-35 0.8858
1. PBF C3PMD9 Probable GTP-binding protein EngB 0.00e+00 5.40e-33 9.79e-25 0.8955
1. PBF Q87DM6 Probable GTP-binding protein EngB 0.00e+00 8.78e-49 1.64e-37 0.9213
1. PBF B1YRR0 Probable GTP-binding protein EngB 0.00e+00 2.99e-39 3.21e-27 0.9155
1. PBF A6VEW7 Probable GTP-binding protein EngB 0.00e+00 4.14e-39 2.54e-37 0.8864
1. PBF Q6F1A9 Probable GTP-binding protein EngB 0.00e+00 4.69e-73 1.08e-89 0.9716
1. PBF B7JQ62 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9687
1. PBF Q1GJX8 Probable GTP-binding protein EngB 0.00e+00 2.30e-26 6.23e-28 0.9376
1. PBF Q24SK9 Probable GTP-binding protein EngB 0.00e+00 2.25e-50 1.64e-49 0.9483
1. PBF B4TPL2 Probable GTP-binding protein EngB 0.00e+00 6.58e-45 1.02e-37 0.9249
1. PBF Q5PAH3 Probable GTP-binding protein EngB 0.00e+00 1.79e-40 2.06e-25 0.9303
1. PBF Q88VE3 Probable GTP-binding protein EngB 0.00e+00 4.74e-54 7.05e-52 0.9745
1. PBF A7ZU66 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9084
1. PBF Q73K17 Probable GTP-binding protein EngB 0.00e+00 2.04e-37 3.35e-32 0.918
1. PBF Q0A4P0 Probable GTP-binding protein EngB 0.00e+00 1.80e-47 9.14e-38 0.9231
1. PBF Q026Q1 Probable GTP-binding protein EngB 0.00e+00 6.08e-50 9.08e-36 0.9302
1. PBF Q5HVC1 Probable GTP-binding protein EngB 0.00e+00 3.56e-47 3.83e-29 0.844
1. PBF B5FFA6 Probable GTP-binding protein EngB 0.00e+00 2.80e-39 9.21e-32 0.9123
1. PBF Q6GG32 Probable GTP-binding protein EngB 0.00e+00 6.82e-55 3.54e-47 0.9663
1. PBF B8JEQ8 Probable GTP-binding protein EngB 0.00e+00 3.19e-43 4.10e-35 0.934
1. PBF B1IW48 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9199
1. PBF B2FTY5 Probable GTP-binding protein EngB 0.00e+00 2.12e-48 3.55e-38 0.9187
1. PBF B9E746 Probable GTP-binding protein EngB 0.00e+00 8.09e-56 6.05e-47 0.9726
1. PBF B5YZ00 Probable GTP-binding protein EngB 0.00e+00 2.43e-43 1.09e-37 0.9203
1. PBF B1LMP7 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9221
1. PBF Q5LW13 Probable GTP-binding protein EngB 0.00e+00 7.82e-24 5.05e-28 0.9371
1. PBF Q6MPP2 Probable GTP-binding protein EngB 0.00e+00 6.39e-36 5.19e-38 0.9171
1. PBF Q2SN75 Probable GTP-binding protein EngB 0.00e+00 6.94e-37 6.14e-34 0.9088
1. PBF A6LT31 Probable GTP-binding protein EngB 0.00e+00 3.27e-55 2.59e-57 0.9409
1. PBF Q2NQR6 Probable GTP-binding protein EngB 0.00e+00 1.23e-49 1.33e-39 0.9201
1. PBF Q6MTV5 Probable GTP-binding protein EngB 0.00e+00 5.20e-99 2.93e-138 0.998
1. PBF Q8RC22 Probable GTP-binding protein EngB 0.00e+00 4.01e-55 1.85e-43 0.9495
1. PBF B5EEM1 Probable GTP-binding protein EngB 0.00e+00 8.39e-33 1.79e-47 0.9495
1. PBF A8GUK6 Probable GTP-binding protein EngB 0.00e+00 6.61e-35 1.80e-25 0.8922
1. PBF A9M1V2 Probable GTP-binding protein EngB 0.00e+00 4.18e-43 1.25e-35 0.8851
1. PBF C0MEW6 Probable GTP-binding protein EngB 0.00e+00 1.13e-46 1.11e-64 0.9819
1. PBF Q160A3 Probable GTP-binding protein EngB 0.00e+00 1.72e-45 1.49e-35 0.9141
1. PBF A9KWY5 Probable GTP-binding protein EngB 0.00e+00 3.08e-36 3.89e-33 0.9001
1. PBF B6JJN9 Probable GTP-binding protein EngB 0.00e+00 2.41e-28 4.95e-27 0.907
1. PBF Q0TAJ6 Probable GTP-binding protein EngB 0.00e+00 1.20e-43 1.04e-37 0.9207
1. PBF A5CXJ4 Probable GTP-binding protein EngB 0.00e+00 1.18e-46 2.42e-38 0.9293
1. PBF Q48A63 Probable GTP-binding protein EngB 0.00e+00 6.36e-28 2.02e-33 0.9076
1. PBF A6LBY4 Probable GTP-binding protein EngB 0.00e+00 6.30e-58 2.79e-32 0.9385
1. PBF Q4L712 Probable GTP-binding protein EngB 0.00e+00 2.34e-54 1.24e-49 0.9656
1. PBF Q97FU0 Probable GTP-binding protein EngB 0.00e+00 2.80e-50 2.26e-57 0.9418
1. PBF Q17VE9 Probable GTP-binding protein EngB 1.95e-13 4.66e-48 1.96e-24 0.7728
1. PBF A6TM67 Probable GTP-binding protein EngB 0.00e+00 5.03e-46 2.79e-56 0.9737
1. PBF Q28UR1 Probable GTP-binding protein EngB 0.00e+00 2.97e-22 3.17e-26 0.9304
1. PBF Q5NH35 Probable GTP-binding protein EngB 0.00e+00 4.40e-51 1.42e-36 0.9214
1. PBF B9IZ44 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.968
1. PBF A0M537 Probable GTP-binding protein EngB 0.00e+00 1.61e-55 8.89e-37 0.9434
1. PBF Q9PDE9 Probable GTP-binding protein EngB 0.00e+00 1.71e-48 7.46e-37 0.9221
1. PBF Q9HT81 Probable GTP-binding protein EngB 0.00e+00 1.83e-38 8.60e-37 0.9142
1. PBF Q8EX09 Probable GTP-binding protein EngB 0.00e+00 3.50e-53 1.42e-34 0.9227
1. PBF A5VJ95 Probable GTP-binding protein EngB 0.00e+00 5.38e-56 1.01e-48 0.9699
1. PBF C6BUE5 Probable GTP-binding protein EngB 0.00e+00 4.91e-46 1.30e-34 0.8808
1. PBF Q8NW73 Probable GTP-binding protein EngB 0.00e+00 6.99e-55 3.66e-47 0.9665
1. PBF B0TFJ0 Probable GTP-binding protein EngB 0.00e+00 2.74e-46 1.25e-49 0.9526
1. PBF C5A033 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 0.9073
1. PBF A1SRG3 Probable GTP-binding protein EngB 0.00e+00 1.32e-40 1.70e-30 0.8806
1. PBF B3Q039 Probable GTP-binding protein EngB 0.00e+00 1.32e-40 6.46e-22 0.9125
1. PBF Q2LVW9 Probable GTP-binding protein EngB 0.00e+00 8.11e-51 2.22e-38 0.9391
1. PBF Q88AP4 Probable GTP-binding protein EngB 0.00e+00 1.89e-41 2.06e-36 0.9047
1. PBF C1ETR5 Probable GTP-binding protein EngB 0.00e+00 1.19e-59 1.04e-56 0.9683
1. PBF B8F8H7 Probable GTP-binding protein EngB 0.00e+00 3.48e-47 4.05e-40 0.9234
1. PBF Q6LLQ5 Probable GTP-binding protein EngB 0.00e+00 9.07e-30 3.53e-33 0.9236
1. PBF Q3BXK1 Probable GTP-binding protein EngB 0.00e+00 4.45e-45 2.70e-36 0.9208
1. PBF Q9JVW1 Probable GTP-binding protein EngB 0.00e+00 4.18e-43 1.25e-35 0.8852
1. PBF B3WE42 Probable GTP-binding protein EngB 0.00e+00 5.65e-54 5.73e-48 0.9749
1. PBF C3K6T0 Probable GTP-binding protein EngB 0.00e+00 1.65e-37 1.02e-35 0.9184
1. PBF B5ZB76 Probable GTP-binding protein EngB 0.00e+00 8.55e-29 2.52e-36 0.9278
1. PBF Q2GKS7 Probable GTP-binding protein EngB 0.00e+00 3.88e-54 1.22e-26 0.9057
1. PBF A1VDC5 Probable GTP-binding protein EngB 0.00e+00 6.60e-28 2.08e-33 0.8921
1. PBF Q1QSU7 Probable GTP-binding protein EngB 0.00e+00 8.52e-52 5.29e-40 0.9297
1. PBF Q67SJ6 Probable GTP-binding protein EngB 0.00e+00 9.89e-36 2.90e-44 0.9293
1. PBF Q0ASI7 Probable GTP-binding protein EngB 0.00e+00 3.75e-41 1.64e-29 0.901
1. PBF A4IRG9 Probable GTP-binding protein EngB 0.00e+00 1.07e-56 2.42e-53 0.9747
1. PBF Q042T8 Probable GTP-binding protein EngB 0.00e+00 1.26e-62 3.65e-50 0.9652
1. PBF Q1GN74 Probable GTP-binding protein EngB 0.00e+00 1.01e-24 1.18e-26 0.9226
1. PBF A4ST47 Probable GTP-binding protein EngB 0.00e+00 2.00e-40 3.35e-39 0.9287
1. PBF C6E8C5 Probable GTP-binding protein EngB 0.00e+00 4.42e-33 2.21e-46 0.9482
1. PBF A4WGC5 Probable GTP-binding protein EngB 0.00e+00 1.18e-46 1.93e-39 0.9195
1. PBF A5FIZ1 Probable GTP-binding protein EngB 0.00e+00 2.17e-43 1.01e-34 0.931
1. PBF A0KEY0 Probable GTP-binding protein EngB 0.00e+00 8.75e-44 1.56e-39 0.8983
1. PBF C4K1B9 Probable GTP-binding protein EngB 0.00e+00 1.76e-32 5.03e-24 0.8953
1. PBF A0L2Q8 Probable GTP-binding protein EngB 0.00e+00 2.13e-35 6.75e-34 0.8937
1. PBF A5I9U4 Probable GTP-binding protein EngB 0.00e+00 2.80e-54 1.96e-36 0.9278
1. PBF Q491W2 Probable GTP-binding protein EngB 0.00e+00 5.29e-55 7.85e-26 0.8806
1. PBF Q0HPI0 Probable GTP-binding protein EngB 0.00e+00 3.64e-35 5.87e-34 0.8931
1. PBF Q180E5 Probable GTP-binding protein EngB 0.00e+00 6.83e-51 2.21e-50 0.957
1. PBF A4G9Q7 Probable GTP-binding protein EngB 0.00e+00 2.10e-30 8.10e-26 0.8921
1. PBF P64072 Probable GTP-binding protein EngB 0.00e+00 1.61e-51 2.08e-60 0.981
1. PBF B9DU74 Probable GTP-binding protein EngB 0.00e+00 5.54e-44 1.54e-65 0.9825
1. PBF Q02DL7 Probable GTP-binding protein EngB 0.00e+00 1.00e-38 9.48e-37 0.9132
1. PBF A1AI47 Probable GTP-binding protein EngB 0.00e+00 9.36e-44 9.42e-38 0.9245
1. PBF B1ICY8 Probable GTP-binding protein EngB 0.00e+00 1.67e-52 3.18e-61 0.9821
1. PBF Q03QN8 Probable GTP-binding protein EngB 0.00e+00 5.47e-52 6.82e-43 0.9662
1. PBF B5XZJ3 Probable GTP-binding protein EngB 0.00e+00 2.56e-46 7.38e-38 0.9224
1. PBF Q8P1C8 Probable GTP-binding protein EngB 0.00e+00 1.93e-46 1.07e-61 0.9816
1. PBF Q71ZB0 Probable GTP-binding protein EngB 0.00e+00 8.08e-59 6.87e-54 0.9751
1. PBF A1AVN1 Probable GTP-binding protein EngB 0.00e+00 1.98e-44 3.18e-34 0.9283
1. PBF Q3IYY4 Probable GTP-binding protein EngB 0.00e+00 1.82e-22 1.70e-28 0.9187
1. PBF C1AB49 Probable GTP-binding protein EngB 0.00e+00 5.61e-43 3.52e-37 0.9268
1. PBF P57507 Probable GTP-binding protein EngB 0.00e+00 3.59e-53 3.78e-25 0.8589
1. PBF A1AU48 Probable GTP-binding protein EngB 0.00e+00 5.74e-52 1.63e-44 0.9417
1. PBF A9BHV0 Probable GTP-binding protein EngB 0.00e+00 2.39e-51 2.96e-34 0.9407
1. PBF A1UTM1 Probable GTP-binding protein EngB 0.00e+00 1.36e-37 2.45e-21 0.9193
1. PBF A6QHK7 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 0.9665
1. PBF Q1LTY0 Probable GTP-binding protein EngB 0.00e+00 1.32e-48 3.28e-20 0.9173
1. PBF Q3JMU4 Probable GTP-binding protein EngB 0.00e+00 1.40e-39 9.03e-28 0.9075
1. PBF Q63Q42 Probable GTP-binding protein EngB 0.00e+00 1.40e-39 9.03e-28 0.9079
1. PBF A8GYP3 Probable GTP-binding protein EngB 0.00e+00 1.50e-34 2.08e-32 0.8852
1. PBF B4E5Y9 Probable GTP-binding protein EngB 0.00e+00 7.95e-40 1.11e-27 0.9126
1. PBF C1KVK5 Probable GTP-binding protein EngB 0.00e+00 8.08e-59 6.87e-54 0.9753
1. PBF B0K530 Probable GTP-binding protein EngB 0.00e+00 6.77e-57 5.82e-40 0.9438
3. BF Q98RC1 GTPase Der 3.97e-07 NA 0.001 0.6313
3. BF C5D3F4 GTPase Der 2.30e-07 NA 0.001 0.6052
3. BF A0KUJ9 GTPase Der 1.92e-06 NA 0.001 0.6602
3. BF B5Z0Y0 GTPase Der 6.66e-07 NA 1.69e-05 0.6347
3. BF A0LJ92 GTPase Der 6.22e-07 NA 0.034 0.6667
3. BF B7UGV7 GTPase Der 5.41e-07 NA 1.63e-05 0.6759
3. BF Q7VM29 GTPase Der 2.84e-07 NA 5.29e-05 0.6955
3. BF Q8EC36 GTPase Der 1.92e-06 NA 0.002 0.6578
3. BF Q7N702 GTPase Der 4.07e-07 NA 0.005 0.6539
3. BF Q8A135 GTPase Der 6.40e-07 NA 0.005 0.6967
3. BF A6LEP5 GTPase Der 4.99e-07 NA 0.002 0.6944
3. BF A6KXK1 GTPase Der 5.10e-07 NA 0.031 0.6582
3. BF B1YR40 GTPase Der 6.74e-07 NA 5.17e-06 0.6622
3. BF A9WHH9 GTPase Der 9.26e-07 NA 3.63e-04 0.5912
3. BF A5N7W7 GTPase Der 5.25e-07 NA 1.13e-05 0.6587
3. BF Q0P5E7 GTP-binding protein 8 0.00e+00 NA 6.96e-22 0.8516
3. BF A1TM31 GTPase Der 6.38e-07 NA 0.001 0.6577
3. BF A2BPL9 GTPase Der 2.72e-07 NA 0.002 0.6241
3. BF Q8G2E8 GTPase Der 4.35e-06 NA 0.010 0.6656
3. BF A1JKS6 GTPase Der 3.96e-07 NA 0.001 0.6392
3. BF Q668A3 GTPase Der 1.28e-06 NA 0.002 0.6731
3. BF Q1B6C5 GTPase Era 3.19e-12 NA 0.002 0.7856
3. BF A8A317 GTPase Der 4.53e-07 NA 1.69e-05 0.6689
3. BF C3P591 GTPase Der 3.07e-07 NA 0.011 0.6032
3. BF Q0BND2 GTPase Der 1.15e-06 NA 1.05e-04 0.6568
3. BF B0RT56 GTPase Der 2.23e-07 NA 7.13e-05 0.6661
3. BF Q2JV46 GTPase Der 3.94e-07 NA 0.002 0.6102
3. BF Q8FF59 GTPase Der 5.88e-07 NA 1.63e-05 0.618
3. BF B5ZYX3 GTPase Der 5.63e-07 NA 5.99e-04 0.6246
3. BF B3Q9V3 GTPase Der 1.66e-04 NA 2.27e-05 0.6551
3. BF Q9PG37 GTPase Der 1.52e-07 NA 2.20e-05 0.6265
3. BF Q4L6I0 GTPase Der 4.67e-07 NA 0.001 0.6667
3. BF Q8P979 GTPase Der 1.11e-07 NA 7.13e-05 0.7035
3. BF B1AJ22 GTPase Der 2.96e-07 NA 1.35e-04 0.5883
3. BF Q6GGT6 GTPase Der 3.29e-07 NA 0.002 0.6108
3. BF Q5LR04 GTPase Der 3.19e-06 NA 0.002 0.6624
3. BF Q0HKV5 GTPase Der 1.60e-06 NA 0.001 0.6602
3. BF Q83C83 GTPase Der 7.96e-07 NA 1.15e-04 0.6597
3. BF A0RBV9 GTPase Der 2.68e-07 NA 0.011 0.6056
3. BF Q2W7M7 GTPase Der 2.30e-06 NA 0.003 0.6652
3. BF B4SSW8 GTPase Der 5.27e-07 NA 1.72e-05 0.6588
3. BF Q5NFD2 GTPase Der 1.05e-06 NA 4.43e-05 0.6406
3. BF A1UIQ1 GTPase Era 3.19e-12 NA 0.002 0.786
3. BF O84709 GTPase Der 2.49e-06 NA 2.55e-05 0.7338
3. BF Q48LZ0 GTPase Der 1.82e-06 NA 0.001 0.6632
3. BF Q92UK6 GTPase Der 5.40e-04 NA 2.82e-04 0.6622
3. BF B1JSA4 GTPase Der 1.38e-06 NA 0.002 0.6704
3. BF B0B8S9 GTPase Der 1.89e-06 NA 2.15e-05 0.733
3. BF Q603B5 GTPase Der 8.39e-07 NA 4.23e-07 0.6305
3. BF C0RH89 GTPase Der 6.88e-04 NA 0.009 0.6762
3. BF B1I766 GTPase Der 3.10e-07 NA 5.59e-06 0.6398
3. BF C3LT16 GTPase Der 1.11e-06 NA 1.71e-04 0.6757
3. BF B3EFY1 GTPase Der 3.86e-07 NA 1.85e-05 0.6646
3. BF P75309 GTPase Der 6.56e-07 NA 2.55e-04 0.6837
3. BF C5BES7 GTPase Der 5.21e-07 NA 8.20e-05 0.6695
3. BF Q1QD14 GTPase Der 1.07e-06 NA 0.011 0.6568
3. BF A6SZW6 GTPase Der 9.90e-07 NA 0.002 0.6708
3. BF A4SYD7 GTPase Der 7.38e-07 NA 0.007 0.642
3. BF A5IC36 GTPase Der 1.31e-06 NA 0.010 0.6448
3. BF Q2SRR7 GTPase Der 1.86e-07 NA 8.58e-11 0.6762
3. BF Q47WC5 GTPase Der 7.73e-07 NA 3.96e-04 0.6699
3. BF B1XAY6 GTPase Der 5.11e-07 NA 1.69e-05 0.6416
3. BF C1KWN7 GTPase Der 2.58e-07 NA 0.011 0.6194
3. BF B3QLF4 GTPase Der 6.17e-05 NA 0.001 0.6437
3. BF A5GJ79 GTPase Der 2.77e-07 NA 0.007 0.6041
3. BF C1CSX0 GTPase Der 3.76e-07 NA 5.59e-06 0.6384
3. BF Q9Z762 GTPase Der 2.63e-06 NA 5.24e-07 0.6959
3. BF B7M7L5 GTPase Der 3.14e-07 NA 1.69e-05 0.656
3. BF Q5PNI6 GTPase Der 7.33e-07 NA 9.72e-06 0.6175
3. BF Q986D9 GTPase Der 6.79e-04 NA 2.26e-04 0.6618
3. BF Q7VDI8 GTPase Der 4.11e-07 NA 0.005 0.6331
3. BF B8D8G4 GTPase Der 1.94e-07 NA 1.11e-06 0.6412
3. BF Q4UUM0 GTPase Der 2.79e-07 NA 7.13e-05 0.6674
3. BF Q030L6 GTPase Der 3.16e-07 NA 0.002 0.6454
3. BF Q64NV3 GTPase Der 5.65e-07 NA 0.036 0.7071
3. BF Q63DM8 GTPase Der 2.43e-07 NA 0.011 0.6135
3. BF B1XU78 GTPase Der 8.55e-07 NA 0.007 0.6981
3. BF Q5L8K8 GTPase Der 5.42e-07 NA 0.036 0.6987
3. BF A1TZQ4 GTPase Der 6.76e-07 NA 4.58e-05 0.6705
3. BF B9E1C8 GTPase Der 5.52e-05 NA 1.13e-05 0.6464
3. BF Q5P7B7 GTPase Der 4.90e-07 NA 3.00e-05 0.6244
3. BF Q8Y5W8 GTPase Der 3.79e-07 NA 0.011 0.6206
3. BF B2V5W6 GTPase Der 1.53e-07 NA 1.10e-05 0.6314
3. BF Q5ZV99 GTPase Der 1.41e-06 NA 0.003 0.6348
3. BF B4RV85 GTPase Der 1.51e-06 NA 0.002 0.6667
3. BF C4LC41 GTPase Der 6.91e-07 NA 0.003 0.6452
3. BF B1MYB5 GTPase Der 2.53e-07 NA 0.047 0.6673
3. BF C5CXH0 GTPase Der 3.88e-07 NA 0.008 0.6397
3. BF P50743 GTPase Der 2.46e-07 NA 9.53e-06 0.6107
3. BF Q8ZCT9 GTPase Der 1.33e-06 NA 0.002 0.672
3. BF A4XY28 GTPase Der 1.64e-06 NA 0.003 0.6919
3. BF B7VJU2 GTPase Der 1.39e-06 NA 2.02e-04 0.6795
3. BF P57812 GTPase Der 2.71e-07 NA 1.32e-04 0.7088
3. BF Q6HL51 GTPase Der 2.60e-07 NA 0.011 0.6388
3. BF A9KLK7 GTPase Der 3.52e-07 NA 1.72e-04 0.6467
3. BF A1KT93 GTPase Der 1.08e-06 NA 0.036 0.6456
3. BF Q9EWW8 GTPase Der 4.56e-07 NA 0.001 0.6544
3. BF A7ZPV4 GTPase Der 1.48e-06 NA 1.69e-05 0.6308
3. BF Q87S12 GTPase Der 5.39e-07 NA 0.004 0.6932
3. BF Q11KI3 GTPase Der 2.50e-06 NA 0.001 0.6615
3. BF A5I4V0 GTPase Der 4.59e-07 NA 1.07e-05 0.6294
3. BF B2SXS6 GTPase Der 2.76e-04 NA 1.99e-05 0.6417
3. BF B5FAX6 GTPase Der 3.91e-07 NA 5.59e-04 0.7
3. BF Q0SMZ9 GTPase Der 1.81e-07 NA 2.50e-04 0.6915
3. BF A7GN41 GTPase Der 2.53e-07 NA 7.03e-04 0.6127
3. BF A0AK49 GTPase Der 3.97e-07 NA 0.011 0.629
3. BF Q661B2 GTPase Der 5.60e-07 NA 0.002 0.6547
3. BF Q3SL66 GTPase Der 1.86e-06 NA 2.81e-04 0.6458
3. BF B7MYE6 GTPase Der 5.10e-07 NA 1.78e-05 0.6186
3. BF A8EZN9 GTPase Der 4.20e-04 NA 2.10e-08 0.6335
3. BF A3Q264 GTPase Era 2.80e-12 NA 0.002 0.7837
3. BF B3EMI7 GTPase Der 5.27e-07 NA 1.20e-05 0.6274
3. BF B9KZ43 GTPase Der 4.63e-07 NA 4.49e-04 0.603
3. BF Q3AZ65 GTPase Der 4.06e-07 NA 0.002 0.6124
3. BF O51881 GTPase Der 1.85e-07 NA 1.85e-07 0.6677
3. BF B1IWF0 GTPase Der 5.68e-07 NA 1.69e-05 0.6737
3. BF B2S9M3 GTPase Der 3.17e-06 NA 0.009 0.6818
3. BF B3QZ96 GTPase Der 2.45e-07 NA 5.54e-11 0.6607
3. BF Q3M929 GTPase Der 4.24e-07 NA 5.11e-06 0.5907
3. BF Q57EY6 GTPase Der 1.79e-06 NA 0.009 0.6773
3. BF Q03SA1 GTPase Der 3.44e-07 NA 0.042 0.6221
3. BF B0V4V6 GTPase Der 1.14e-06 NA 0.045 0.6501
3. BF Q4K6V3 GTPase Der 2.08e-06 NA 9.99e-06 0.6617
3. BF B2SF94 GTPase Der 7.04e-07 NA 3.82e-05 0.6724
3. BF Q6LU45 GTPase Der 3.06e-07 NA 2.93e-04 0.6957
3. BF Q7NS92 GTPase Der 8.19e-07 NA 2.56e-05 0.67
3. BF A8G3A3 GTPase Der 3.85e-07 NA 0.001 0.6707
3. BF Q7MNE7 GTPase Der 9.84e-07 NA 0.004 0.6601
3. BF Q5KXT0 GTPase Der 2.17e-07 NA 0.002 0.6504
3. BF A1WUL5 GTPase Der 3.39e-07 NA 0.008 0.6808
3. BF B7HHQ7 GTPase Der 3.71e-07 NA 0.011 0.5967
3. BF Q6D280 GTPase Der 6.18e-07 NA 8.31e-04 0.6157
3. BF Q8UD28 GTPase Der 9.51e-05 NA 0.019 0.6459
3. BF P47571 GTPase Der 8.50e-07 NA 1.30e-06 0.5929
3. BF Q73AZ1 GTPase Der 2.97e-07 NA 0.011 0.5911
3. BF Q46ZI7 GTPase Der 4.46e-07 NA 1.00e-04 0.6684
3. BF A6VV10 GTPase Der 4.95e-07 NA 1.24e-04 0.6642
3. BF A7MZE5 GTPase Der 5.21e-07 NA 6.60e-04 0.7021
3. BF Q3KKZ1 GTPase Der 4.18e-06 NA 2.72e-05 0.6383
3. BF Q1J8C9 GTPase Der 2.82e-07 NA 1.17e-05 0.654
3. BF Q725L9 GTPase Der 7.17e-07 NA 2.74e-06 0.6541
3. BF P64060 GTPase Der 2.05e-07 NA 0.002 0.6002
3. BF Q31CE7 GTPase Der 3.77e-07 NA 7.00e-04 0.6701
3. BF Q11QK1 GTPase Der 6.47e-07 NA 0.040 0.6497
3. BF Q1RK21 GTPase Der 7.88e-07 NA 4.15e-07 0.5878
3. BF Q7URJ8 GTPase Der 6.18e-07 NA 6.01e-07 0.6811
3. BF B0CK66 GTPase Der 9.55e-04 NA 0.004 0.6807
3. BF B4SED0 GTPase Der 4.17e-07 NA 1.18e-05 0.6332
3. BF B7JGY9 GTPase Der 2.64e-07 NA 0.011 0.5986
3. BF A3M215 GTPase Der 1.19e-06 NA 0.045 0.6511
3. BF A8GHW1 GTPase Der 1.61e-06 NA 4.54e-04 0.6173
3. BF Q8DF02 GTPase Der 1.38e-06 NA 0.004 0.6736
3. BF Q1CK87 GTPase Der 1.54e-06 NA 0.002 0.6596
3. BF A2RM49 GTPase Der 2.48e-07 NA 0.002 0.6179
3. BF B1X0B0 GTPase Der 3.66e-07 NA 7.27e-05 0.6516
3. BF C6C0G0 GTPase Der 1.59e-07 NA 0.007 0.7227
3. BF Q2IXA7 GTPase Der 1.00e-03 NA 1.53e-05 0.6538
3. BF Q4UMV9 GTPase Der 1.43e-07 NA 8.46e-07 0.6013
3. BF Q3BTW0 GTPase Der 3.01e-07 NA 6.32e-05 0.6901
3. BF A9N205 GTPase Der 4.33e-07 NA 8.36e-06 0.6173
3. BF Q9JZY1 GTPase Der 1.35e-06 NA 0.034 0.6506
3. BF A9BE09 GTPase Der 2.45e-07 NA 0.009 0.6219
3. BF A9AH00 GTPase Der 5.70e-07 NA 6.00e-05 0.6551
3. BF Q24VA2 GTPase Der 2.45e-07 NA 2.63e-09 0.6538
3. BF A1W581 GTPase Der 4.21e-07 NA 0.005 0.6854
3. BF B0BUT3 GTPase Der 4.80e-07 NA 1.14e-06 0.6343
3. BF A0KJ48 GTPase Der 1.46e-06 NA 1.64e-04 0.6711
3. BF C4ZD63 GTPase Der 5.01e-07 NA 7.28e-05 0.6611
3. BF Q9KTW7 GTPase Der 4.86e-07 NA 1.71e-04 0.7094
3. BF Q3ICZ9 GTPase Der 1.41e-06 NA 0.001 0.6667
3. BF Q119L7 GTPase Der 3.47e-07 NA 1.41e-04 0.6596
3. BF Q8Y026 GTPase Der 5.42e-07 NA 4.66e-04 0.6783
3. BF Q7WHN4 GTPase Der 6.37e-07 NA 2.88e-04 0.6659
3. BF P74120 GTPase Der 2.70e-07 NA 2.80e-06 0.671
3. BF Q0BEX1 GTPase Der 7.16e-07 NA 8.99e-06 0.6628
3. BF B4RKD2 GTPase Der 5.10e-07 NA 0.035 0.6726
3. BF Q1MDD6 GTPase Der 8.01e-07 NA 0.002 0.7055
3. BF A7MGU7 GTPase Der 4.18e-07 NA 7.89e-05 0.6705
3. BF C3MG60 GTPase Der 5.01e-04 NA 6.22e-04 0.6339
3. BF Q15R60 GTPase Der 1.44e-06 NA 0.002 0.6678
3. BF B6I583 GTPase Der 3.06e-07 NA 1.69e-05 0.6663
3. BF A9IK66 GTPase Der 1.14e-07 NA 0.004 0.6428
3. BF Q039G4 GTPase Der 2.07e-07 NA 0.019 0.6608
3. BF B6J7Q3 GTPase Der 7.93e-07 NA 1.15e-04 0.6579
3. BF A4G4K6 GTPase Der 7.10e-07 NA 0.003 0.6713
3. BF A9B567 GTPase Der 8.53e-04 NA 0.003 0.6481
3. BF B5BAY9 GTPase Der 3.81e-07 NA 9.72e-06 0.6673
3. BF A6TCD0 GTPase Der 5.31e-07 NA 3.95e-05 0.655
3. BF Q2K5L2 GTPase Der 3.42e-04 NA 5.77e-04 0.666
3. BF A4JEN6 GTPase Der 5.95e-07 NA 3.09e-05 0.6385
3. BF B0C1P2 GTPase Der 3.28e-07 NA 3.58e-05 0.6519
3. BF Q21W32 GTPase Der 3.69e-07 NA 0.010 0.6552
3. BF Q1D5X5 GTPase Der 5.94e-07 NA 7.55e-04 0.6301
3. BF B4S433 GTPase Der 4.16e-07 NA 2.07e-06 0.6374
3. BF A3PJF0 GTPase Der 3.26e-06 NA 0.013 0.6635
3. BF A7HYV8 GTPase Der 4.96e-06 NA 4.05e-04 0.6692
3. BF Q828Y7 GTPase Der 8.81e-07 NA 5.94e-04 0.6994
3. BF Q87B41 GTPase Der 1.38e-07 NA 2.55e-05 0.6826
3. BF Q02RV3 GTPase Der 1.57e-06 NA 0.003 0.6658
3. BF A7NAB1 GTPase Der 8.55e-07 NA 1.05e-04 0.6435
3. BF Q9PLM3 GTPase Der 3.22e-06 NA 1.11e-05 0.5648
3. BF B5E756 GTPase Der 3.01e-07 NA 5.59e-06 0.6408
3. BF C1EN01 GTPase Der 3.04e-07 NA 0.011 0.6055
3. BF A9R7Z8 GTPase Der 1.85e-06 NA 0.002 0.6713
3. BF C1A8T3 GTPase Der 3.91e-07 NA 0.010 0.6331
3. BF Q4ZX19 GTPase Der 1.38e-06 NA 0.001 0.674
3. BF Q5X522 GTPase Der 1.38e-06 NA 0.010 0.6351
3. BF B8D8C1 GTPase Der 2.17e-07 NA 1.15e-06 0.6411
3. BF Q07LA7 GTPase Der 1.54e-04 NA 1.39e-05 0.6755
3. BF A1BHZ8 GTPase Der 3.72e-07 NA 1.02e-04 0.6145
3. BF B5R578 GTPase Der 8.84e-07 NA 8.77e-06 0.6212
3. BF Q2Y6F9 GTPase Der 1.14e-06 NA 1.24e-05 0.6534
3. BF Q5L4W4 GTPase Der 1.27e-06 NA 2.61e-07 0.596
3. BF A3PBA9 GTPase Der 4.38e-07 NA 0.001 0.6713
3. BF A5IZG5 GTPase Der 1.80e-05 NA 7.52e-08 0.6372
3. BF A1URU0 GTPase Der 1.92e-06 NA 0.017 0.7001
3. BF B7UWJ2 GTPase Der 1.55e-06 NA 0.002 0.7005
3. BF Q12AC2 GTPase Der 4.04e-07 NA 0.004 0.6518
3. BF A4IXH0 GTPase Der 6.99e-07 NA 4.19e-05 0.7155
3. BF B0KPJ1 GTPase Der 2.22e-06 NA 6.15e-04 0.6636
3. BF A5VJK4 GTPase Der 2.78e-07 NA 0.004 0.6151
3. BF B2VE93 GTPase Der 4.20e-07 NA 3.00e-05 0.6271
3. BF Q8PKY6 GTPase Der 1.33e-07 NA 6.56e-05 0.6972
3. BF Q9ZCP6 GTPase Der 1.85e-07 NA 0.001 0.6431
3. BF Q135K8 GTPase Der 1.20e-03 NA 1.45e-05 0.6514
3. BF B0JFL6 GTPase Der 3.24e-07 NA 9.03e-08 0.6793
3. BF A4TMT3 GTPase Der 1.34e-06 NA 0.002 0.6707
3. BF B5RCY8 GTPase Der 6.30e-07 NA 8.29e-06 0.6333
3. BF Q89MZ0 GTPase Der 1.70e-04 NA 3.06e-06 0.6865
3. BF Q0AE46 GTPase Der 9.28e-07 NA 0.032 0.6277
3. BF A8HVL5 GTPase Der 3.31e-06 NA 0.022 0.6673
3. BF C3L9F4 GTPase Der 2.72e-07 NA 0.011 0.5982
3. BF Q38WW3 GTPase Der 2.48e-07 NA 0.001 0.6366
3. BF A3MK70 GTPase Der 2.88e-04 NA 5.22e-06 0.6397
3. BF A0Q534 GTPase Der 9.57e-07 NA 4.19e-05 0.6758
3. BF A0M5P1 GTPase Der 5.57e-07 NA 0.004 0.6419
3. BF B0VKR4 GTPase Der 7.52e-07 NA 0.045 0.6505
3. BF A6WQP3 GTPase Der 1.81e-06 NA 0.002 0.6695
3. BF Q2SDW8 GTPase Der 3.25e-04 NA 1.39e-04 0.661
3. BF Q7NBV2 GTPase Der 3.00e-06 NA 1.45e-07 0.551
3. BF B9DRF9 GTPase Era 3.49e-12 NA 1.29e-07 0.7531
3. BF Q2A515 GTPase Der 7.22e-07 NA 1.05e-04 0.6734
3. BF C3PPD1 GTPase Der 2.75e-07 NA 2.66e-06 0.6003
3. BF Q89A14 GTPase Der 4.74e-07 NA 1.69e-05 0.7106
3. BF Q5FKF4 GTPase Der 3.08e-07 NA 0.002 0.6582
3. BF Q1GHZ2 GTPase Der 5.76e-06 NA 0.001 0.6872
3. BF Q7W6Q0 GTPase Der 6.93e-07 NA 2.88e-04 0.667
3. BF C4XIQ6 GTPase Der 3.79e-07 NA 5.82e-04 0.6943
3. BF C4ZX86 GTPase Der 4.71e-07 NA 1.69e-05 0.6533
3. BF B3PVJ6 GTPase Der 6.79e-07 NA 5.35e-04 0.7026
3. BF Q4FTW3 GTPase Der 8.28e-07 NA 0.011 0.6649
3. BF Q7VWL4 GTPase Der 9.61e-07 NA 2.88e-04 0.6154
3. BF Q0AB37 GTPase Der 2.98e-07 NA 5.06e-06 0.6975
3. BF B2JIU7 GTPase Der 5.64e-07 NA 2.13e-05 0.6682
3. BF B2K9P6 GTPase Der 1.37e-06 NA 0.002 0.6721
3. BF B4T0P5 GTPase Der 4.82e-07 NA 9.72e-06 0.6684
3. BF A9KWW9 GTPase Der 1.89e-06 NA 0.002 0.6705
3. BF Q21KS9 GTPase Der 9.46e-07 NA 1.16e-05 0.6247
3. BF A1SU43 GTPase Der 9.76e-07 NA 5.88e-04 0.7003
3. BF A5VYT9 GTPase Der 3.72e-06 NA 5.30e-04 0.6642
3. BF A4WD89 GTPase Der 4.19e-07 NA 4.88e-04 0.6398
3. BF B7HL14 GTPase Der 2.96e-07 NA 0.011 0.6052
3. BF B1JDV4 GTPase Der 1.77e-06 NA 5.06e-04 0.6219
3. BF Q8Z4P6 GTPase Der 4.40e-07 NA 9.01e-06 0.6548
3. BF Q7MT48 GTPase Der 5.28e-07 NA 0.002 0.6367
3. BF B8DBY9 GTPase Der 2.66e-07 NA 0.011 0.6216
3. BF Q92GU2 GTPase Der 3.01e-07 NA 7.92e-07 0.5818
3. BF P0A6P6 GTPase Der 6.07e-07 NA 1.69e-05 0.6524
3. BF Q5E768 GTPase Der 3.37e-07 NA 5.59e-04 0.7014
3. BF A8MH56 GTPase Der 3.75e-07 NA 7.96e-04 0.6324
3. BF C4K2K1 GTPase Der 2.46e-07 NA 7.49e-07 0.6005
3. BF A5IT03 GTPase Der 3.46e-07 NA 0.002 0.6018
3. BF A8Z454 GTPase Der 2.62e-07 NA 3.57e-04 0.6144
3. BF Q0T208 GTPase Der 5.94e-07 NA 1.67e-05 0.6192
3. BF A5VNV9 GTPase Der 9.38e-04 NA 0.009 0.6907
3. BF B8F4X7 GTPase Der 5.41e-07 NA 1.70e-06 0.6744
3. BF A2S2A6 GTPase Der 3.00e-04 NA 5.22e-06 0.6388
3. BF B0BAF8 GTPase Der 3.62e-06 NA 2.15e-05 0.7327
3. BF Q1QTK4 GTPase Der 2.51e-07 NA 0.004 0.6596
3. BF Q46H20 GTPase Der 2.89e-07 NA 0.012 0.6443
3. BF B9JZQ5 GTPase Der 1.42e-04 NA 0.001 0.615
3. BF Q0C441 GTPase Der 2.22e-03 NA 9.60e-05 0.6479
3. BF A2C0J7 GTPase Der 2.52e-07 NA 0.012 0.617
3. BF B1JT88 GTPase Der 6.54e-07 NA 8.82e-06 0.6586
3. BF A1K3Z3 GTPase Der 6.01e-07 NA 2.31e-05 0.6611
3. BF B9IVM6 GTPase Der 2.16e-07 NA 0.011 0.6076
3. BF A7IIE4 GTPase Der 4.21e-06 NA 0.019 0.6187
3. BF Q88PJ3 GTPase Der 1.96e-06 NA 6.38e-04 0.6229
3. BF A9M8F4 GTPase Der 1.82e-06 NA 0.010 0.7085
3. BF B2I7V0 GTPase Der 1.48e-07 NA 2.55e-05 0.6824
3. BF C5BLV6 GTPase Der 1.68e-06 NA 5.32e-04 0.6996
3. BF Q1IEH7 GTPase Der 1.56e-06 NA 4.13e-04 0.6363
3. BF A9VMB3 GTPase Der 3.62e-07 NA 0.019 0.5974
3. BF Q3J2Y1 GTPase Der 3.24e-06 NA 0.013 0.664
3. BF B2TXT6 GTPase Der 4.17e-07 NA 1.82e-05 0.6816
3. BF Q5WWG8 GTPase Der 1.41e-06 NA 0.015 0.6399
3. BF A4J3P1 GTPase Der 2.80e-07 NA 4.16e-08 0.6533
3. BF A4SNZ8 GTPase Der 2.39e-06 NA 3.51e-04 0.638
3. BF Q63US9 GTPase Der 7.67e-07 NA 5.22e-06 0.6381
3. BF Q8NQK6 GTPase Der 1.13e-06 NA 0.002 0.6821
3. BF Q1WTQ4 GTPase Der 2.04e-07 NA 8.50e-05 0.6449
3. BF B3DXK2 GTPase Der 7.12e-07 NA 0.010 0.6851
3. BF B2I3F0 GTPase Der 6.79e-07 NA 0.045 0.6508
3. BF B8HQE1 GTPase Der 3.35e-07 NA 6.52e-06 0.6249
3. BF Q31KP9 GTPase Der 2.73e-07 NA 0.005 0.6547
3. BF A2SHB1 GTPase Der 7.98e-07 NA 0.002 0.6349
3. BF B2A4M9 GTPase Der 2.68e-07 NA 1.67e-04 0.6644
3. BF Q886Y6 GTPase Der 1.63e-06 NA 4.49e-04 0.6579
3. BF A3MZC1 GTPase Der 6.95e-07 NA 1.23e-05 0.661
3. BF C0QT02 GTPase Der 1.05e-04 NA 2.37e-04 0.5993
3. BF A4YUE1 GTPase Der 6.40e-06 NA 0.002 0.661
3. BF Q13X32 GTPase Der 3.07e-04 NA 2.07e-05 0.6413
3. BF Q39FR3 GTPase Der 5.26e-07 NA 5.32e-06 0.6571
3. BF C1C8U6 GTPase Der 3.18e-07 NA 5.59e-06 0.6071
3. BF A8GPH5 GTPase Der 1.70e-07 NA 1.32e-06 0.6125
3. BF Q65I15 GTPase Der 2.02e-07 NA 4.06e-05 0.6437
3. BF B1XLH8 GTPase Der 2.51e-07 NA 4.93e-07 0.6564
3. BF B2J1L2 GTPase Der 5.93e-07 NA 3.24e-05 0.6167
3. BF Q71Y78 GTPase Der 2.82e-07 NA 0.011 0.6128
3. BF B4EAW5 GTPase Der 5.91e-07 NA 2.95e-05 0.6544
3. BF Q12PT0 GTPase Der 2.00e-06 NA 3.13e-04 0.6652
3. BF B5YFX9 GTPase Der 2.46e-07 NA 7.83e-06 0.6153
3. BF B1XXK9 GTPase Der 5.86e-07 NA 6.23e-04 0.6822
3. BF A8GT93 GTPase Der 2.89e-07 NA 1.45e-06 0.64
3. BF P64064 GTPase Der 2.70e-07 NA 2.80e-05 0.6685
3. BF Q6MB45 GTPase Der 1.13e-06 NA 1.59e-05 0.6824
3. BF Q47BS0 GTPase Der 6.36e-07 NA 8.15e-05 0.6304
3. BF A8LHW1 GTPase Der 3.30e-06 NA 0.003 0.6828
3. BF Q14GT5 GTPase Der 6.68e-07 NA 4.43e-05 0.6714
3. BF B7H065 GTPase Der 8.07e-05 NA 0.045 0.6618
3. BF A7FFZ3 GTPase Der 1.42e-06 NA 0.002 0.6714
3. BF B8GTN1 GTPase Der 6.25e-07 NA 0.007 0.6581
3. BF A4XHX9 GTPase Der 3.45e-07 NA 2.29e-04 0.6462
3. BF P64059 GTPase Der 2.83e-07 NA 0.002 0.6395
3. BF Q8G6A8 GTPase Der 3.26e-07 NA 0.001 0.724
3. BF B0U489 GTPase Der 1.19e-07 NA 2.80e-05 0.6895
3. BF Q8KBK3 GTPase Der 5.04e-07 NA 1.88e-04 0.6424
3. BF A2BV51 GTPase Der 2.80e-07 NA 0.006 0.6682
3. BF B3PDM5 GTPase Der 1.51e-06 NA 6.48e-04 0.6465
3. BF A9KFU3 GTPase Der 9.06e-07 NA 1.15e-04 0.6401
3. BF A3D6V5 GTPase Der 1.88e-06 NA 0.002 0.6706
3. BF A8YV35 GTPase Der 2.54e-07 NA 0.014 0.6591
3. BF B6IZN3 GTPase Der 6.84e-07 NA 1.14e-04 0.6506
3. BF P44536 GTPase Der 3.87e-07 NA 0.004 0.6759
3. BF B3R1J8 GTPase Der 7.78e-07 NA 1.22e-04 0.6784
3. BF Q9JV01 GTPase Der 9.75e-07 NA 0.035 0.6627
3. BF A8AD75 GTPase Der 5.41e-07 NA 7.27e-06 0.6215
3. BF A8Z608 GTPase Der 4.12e-07 NA 0.001 0.5937
3. BF P64062 GTPase Der 2.65e-07 NA 5.59e-06 0.6362
3. BF B7N699 GTPase Der 4.85e-07 NA 1.78e-05 0.6191
3. BF Q88VZ6 GTPase Der 2.04e-07 NA 0.002 0.6189
3. BF B8CKR5 GTPase Der 2.03e-06 NA 0.001 0.6603
3. BF B7JC34 GTPase Der 1.49e-07 NA 1.37e-06 0.6817
3. BF B2FNR1 GTPase Der 7.57e-07 NA 2.08e-05 0.6588
3. BF Q8DS90 GTPase Der 3.46e-07 NA 0.008 0.6711
3. BF Q67NS9 GTPase Der 9.13e-07 NA 4.62e-05 0.6726
3. BF A1S859 GTPase Der 1.62e-06 NA 0.001 0.6615
3. BF P64063 GTPase Der 2.58e-07 NA 5.59e-06 0.6077
3. BF O51461 GTPase Der 7.84e-07 NA 4.98e-05 0.6966
3. BF Q68W59 GTPase Der 9.63e-08 NA 1.89e-05 0.654
3. BF B5EJF7 GTPase Der 1.24e-07 NA 1.37e-06 0.6948
3. BF Q1QMP4 GTPase Der 1.88e-06 NA 1.23e-04 0.6679
3. BF Q8YFH2 GTPase Der 1.50e-06 NA 0.009 0.6821
3. BF Q0TEX4 GTPase Der 6.35e-07 NA 1.63e-05 0.6187
3. BF C4K4J2 GTPase Der 1.06e-06 NA 5.09e-04 0.6831
3. BF Q2RIV4 GTPase Der 2.77e-07 NA 1.15e-06 0.6098
3. BF A5WGA8 GTPase Der 4.39e-07 NA 0.003 0.6729
3. BF B9MFY0 GTPase Der 6.07e-07 NA 0.006 0.7075
3. BF A7X2I1 GTPase Der 3.00e-07 NA 0.002 0.6109
3. BF A9NDV6 GTPase Der 4.93e-07 NA 1.15e-04 0.6579
3. BF B0S1N2 GTPase Der 3.44e-07 NA 4.82e-06 0.6445
3. BF Q92A71 GTPase Der 3.48e-07 NA 0.042 0.6247
3. BF Q6N586 GTPase Der 4.20e-06 NA 2.27e-05 0.693
3. BF B7LCQ1 GTPase Der 6.15e-07 NA 1.69e-05 0.625
3. BF A5FIR0 GTPase Der 4.43e-07 NA 0.008 0.6876
3. BF Q8FTK5 GTPase Der 1.68e-06 NA 1.43e-04 0.6361
3. BF A1R5C7 GTPase Der 8.30e-07 NA 4.17e-04 0.6963
3. BF B6EGZ1 GTPase Der 3.75e-07 NA 2.09e-04 0.7004
3. BF Q49XS9 GTPase Der 5.09e-07 NA 0.001 0.6072
3. BF A6WW65 GTPase Der 2.38e-06 NA 0.008 0.7128
3. BF Q6MTJ6 GTPase Der 1.88e-07 NA 1.79e-10 0.6469
3. BF Q1C5J2 GTPase Der 1.79e-06 NA 0.002 0.6737
3. BF A1WE12 GTPase Der 1.50e-06 NA 0.001 0.6143
3. BF B8CWY9 GTPase Der 3.50e-07 NA 1.93e-04 0.6279
3. BF A3NA49 GTPase Der 6.66e-07 NA 5.22e-06 0.6272
3. BF B7MHZ6 GTPase Der 4.36e-07 NA 1.78e-05 0.6238
3. BF Q256C5 GTPase Der 7.24e-07 NA 1.90e-07 0.7216
3. BF Q2P2T5 GTPase Der 1.28e-07 NA 1.07e-05 0.6952
3. BF A3DE77 GTPase Der 6.48e-05 NA 1.37e-04 0.5566
3. BF Q03WN4 GTPase Der 3.16e-07 NA 0.002 0.6395
3. BF A6V0W4 GTPase Der 1.46e-06 NA 0.002 0.6888
3. BF Q821L7 GTPase Der 1.08e-06 NA 3.63e-07 0.7174
3. BF Q9HXJ8 GTPase Der 1.63e-06 NA 0.002 0.6226
3. BF Q3K7C0 GTPase Der 2.31e-06 NA 4.41e-04 0.6252
3. BF A5F3E6 GTPase Der 5.42e-07 NA 1.71e-04 0.7045
3. BF Q6F1R7 GTPase Der 1.18e-07 NA 2.79e-08 0.6844
3. BF B7LKC7 GTPase Der 5.31e-07 NA 1.67e-05 0.6357
3. BF A4VNW7 GTPase Der 2.09e-06 NA 0.008 0.6919
3. BF O87407 GTPase Der 4.38e-07 NA 0.035 0.6563
3. BF B2U9V3 GTPase Der 2.14e-04 NA 5.17e-04 0.6827
3. BF Q3SR12 GTPase Der 1.99e-06 NA 3.29e-04 0.6655
3. BF Q8CP62 GTPase Der 3.92e-07 NA 3.63e-04 0.6272
3. BF Q3AI13 GTPase Der 2.73e-07 NA 0.001 0.6126
3. BF Q1MS56 GTPase Der 4.52e-07 NA 5.34e-04 0.6331
3. BF Q81FR5 GTPase Der 2.56e-07 NA 0.011 0.6122
3. BF B7NQW0 GTPase Der 4.63e-07 NA 1.63e-05 0.6196
3. BF B7IP82 GTPase Der 3.29e-07 NA 0.019 0.6127
3. BF O67800 GTPase Era 8.71e-11 NA 2.74e-04 0.7666
3. BF A0K7T2 GTPase Der 4.58e-07 NA 8.82e-06 0.654
3. BF C1CFT0 GTPase Der 2.73e-07 NA 5.59e-06 0.6371
3. BF B2G718 GTPase Der 2.89e-07 NA 0.004 0.6213
3. BF Q3AAU6 GTPase Der 3.11e-07 NA 3.89e-04 0.652
3. BF B9J7W1 GTPase Der 7.24e-07 NA 1.63e-04 0.7042
3. BF B9E6L5 GTPase Der 2.81e-07 NA 0.004 0.5848
3. BF A5EI59 GTPase Der 7.27e-04 NA 2.21e-04 0.6503
3. BF B8FM51 GTPase Der 5.13e-07 NA 2.26e-08 0.6116
3. BF A6LSI6 GTPase Der 8.58e-07 NA 2.26e-04 0.6461
3. BF A4Y8T6 GTPase Der 1.96e-06 NA 0.002 0.6697
3. BF B0BTQ8 GTPase Der 5.60e-07 NA 1.04e-05 0.6631
3. BF Q1BGX0 GTPase Der 6.12e-07 NA 8.82e-06 0.6627
3. BF B2GC35 GTPase Der 3.77e-07 NA 0.006 0.6698
3. BF A8AVL8 GTPase Der 2.78e-07 NA 2.55e-04 0.6172
3. BF Q1LLJ5 GTPase Der 3.57e-07 NA 4.45e-04 0.6607
3. BF A3NVW6 GTPase Der 3.16e-04 NA 5.22e-06 0.6388
3. BF A8GXR7 GTPase Der 6.51e-07 NA 1.99e-07 0.5623
3. BF Q57LJ0 GTPase Der 4.32e-07 NA 8.93e-06 0.6331
3. BF B3H0R7 GTPase Der 2.69e-07 NA 1.21e-05 0.7018
3. BF A4SDB8 GTPase Der 2.79e-07 NA 6.98e-05 0.6429
3. BF Q2YM98 GTPase Der 7.41e-04 NA 0.009 0.6819
3. BF P57662 GTPase Der 4.54e-07 NA 1.11e-06 0.6762
3. BF Q3B5U3 GTPase Der 3.27e-07 NA 8.13e-06 0.6349
4. PB A7H4G2 Probable GTP-binding protein EngB 0.00e+00 4.96e-47 3.50e-28 NA
4. PB P0C0C0 GTPase Era (Fragment) 1.89e-15 2.63e-03 4.19e-07 NA
4. PB O26087 Probable GTP-binding protein EngB 0.00e+00 1.18e-47 8.52e-23 NA
4. PB P0A6P7 Probable GTP-binding protein EngB 0.00e+00 7.19e-43 1.04e-37 NA
4. PB Q2FXQ8 Probable GTP-binding protein EngB 0.00e+00 5.03e-55 3.04e-47 NA
4. PB Q8TYT5 Probable GTP-binding protein EngB 4.91e-13 3.70e-09 5.32e-14 NA
4. PB Q9V288 Probable GTP-binding protein EngB 5.84e-14 8.91e-32 4.14e-12 NA
4. PB Q5UZW0 Probable GTP-binding protein EngB 3.34e-13 4.16e-18 5.33e-10 NA
4. PB B9LNM9 Probable GTP-binding protein EngB 2.31e-13 1.39e-16 4.15e-07 NA
4. PB Q57768 Probable GTP-binding protein EngB 2.22e-16 1.65e-32 1.25e-12 NA
4. PB Q8PTK0 Probable GTP-binding protein EngB 1.08e-14 9.63e-22 1.50e-05 NA
4. PB O57939 Probable GTP-binding protein EngB 1.11e-16 5.48e-28 6.65e-14 NA
4. PB Q18FK7 Probable GTP-binding protein EngB 2.22e-15 3.82e-16 4.19e-10 NA
4. PB Q3IU04 Probable GTP-binding protein EngB 9.20e-14 1.36e-17 1.10e-10 NA
4. PB Q6LXQ9 Probable GTP-binding protein EngB 5.11e-14 2.28e-27 9.45e-10 NA
4. PB B0R871 Probable GTP-binding protein EngB 7.07e-14 5.97e-17 5.94e-09 NA
4. PB O28943 Probable GTP-binding protein EngB 3.66e-13 1.19e-11 0.015 NA
4. PB Q9ZJ42 Probable GTP-binding protein EngB 7.46e-14 1.36e-46 5.57e-23 NA
4. PB B5Z9J7 Probable GTP-binding protein EngB 2.85e-13 6.98e-48 4.95e-22 NA
4. PB Q46B95 Probable GTP-binding protein EngB 2.73e-13 8.01e-22 1.06e-08 NA
4. PB A6USY3 Probable GTP-binding protein EngB 4.57e-14 5.22e-25 1.23e-07 NA
4. PB B2UVY4 Probable GTP-binding protein EngB 0.00e+00 7.57e-47 1.26e-23 NA
4. PB Q7VGJ2 Probable GTP-binding protein EngB 1.11e-15 7.88e-37 4.54e-21 NA
5. P P0C950 Small COPII coat GTPase SAR1 7.02e-08 3.25e-06 NA NA
5. P P84085 ADP-ribosylation factor 5 4.50e-08 5.75e-07 NA NA
5. P B7ZTR0 Ciliogenesis and planar polarity effector 2 3.34e-06 1.03e-03 NA NA
5. P P65218 Guanylate kinase 3.31e-02 3.18e-03 NA NA
5. P Q8BSL7 ADP-ribosylation factor 2 3.28e-08 4.12e-09 NA NA
5. P P0DH91 ADP-ribosylation factor 2-B 4.75e-08 6.07e-08 NA NA
5. P Q5BGB9 Small COPII coat GTPase sar1 6.66e-08 2.21e-06 NA NA
5. P Q8NV88 Urease accessory protein UreG 1.15e-03 6.39e-03 NA NA
5. P P49703 ADP-ribosylation factor-like protein 4D 1.21e-07 1.07e-06 NA NA
5. P Q0BHN8 Urease accessory protein UreG 1.51e-03 5.54e-04 NA NA
5. P Q39T72 Guanylate kinase 6.54e-02 3.71e-03 NA NA
5. P Q68VY3 Guanylate kinase 8.26e-02 4.96e-02 NA NA
5. P B0UBI3 Urease accessory protein UreG 1.25e-03 4.76e-04 NA NA
5. P Q21SY6 Urease accessory protein UreG 2.69e-03 8.95e-04 NA NA
5. P Q9Y6B6 GTP-binding protein SAR1b 1.11e-07 6.14e-07 NA NA
5. P P0C0M9 Guanylate kinase 4.50e-02 1.83e-02 NA NA
5. P Q1LPS6 Urease accessory protein UreG 3.00e-03 6.34e-05 NA NA
5. P C3MGH8 Urease accessory protein UreG 1.71e-03 2.43e-02 NA NA
5. P Q4L5R1 Guanylate kinase 2.66e-02 1.60e-02 NA NA
5. P A4VQW0 Urease accessory protein UreG 2.01e-03 9.83e-03 NA NA
5. P Q5L9N9 Guanylate kinase 4.66e-02 6.44e-03 NA NA
5. P Q9FAS2 Urease accessory protein UreG 1.38e-03 2.06e-03 NA NA
5. P P9WKE9 Guanylate kinase 9.16e-02 1.16e-03 NA NA
5. P Q9CB01 Ras-related protein RABF1 1.59e-05 3.98e-03 NA NA
5. P Q1GNB4 Guanylate kinase 4.75e-02 4.23e-02 NA NA
5. P Q8PH65 Guanylate kinase 3.77e-02 1.04e-02 NA NA
5. P B7I8T8 Urease accessory protein UreG 1.00e-03 1.14e-02 NA NA
5. P Q9RYK0 Urease accessory protein UreG 1.37e-03 5.90e-03 NA NA
5. P Q2W9C3 Guanylate kinase 1.16e-01 1.50e-02 NA NA
5. P Q54YV7 ADP-ribosylation factor L 8.80e-09 1.68e-09 NA NA
5. P P78976 Small COPII coat GTPase sar1 6.06e-08 2.38e-05 NA NA
5. P Q6FD79 Urease accessory protein UreG 1.18e-03 1.01e-02 NA NA
5. P Q5ZHW4 Ras-related protein Rab-5B 7.91e-08 2.19e-02 NA NA
5. P Q9AQT0 Urease accessory protein UreG 1.58e-03 1.70e-03 NA NA
5. P P42871 Urease accessory protein UreG 4.29e-04 1.05e-03 NA NA
5. P Q5HLV8 Urease accessory protein UreG 9.87e-04 1.46e-03 NA NA
5. P Q07QT9 Urease accessory protein UreG 2.14e-03 1.21e-04 NA NA
5. P Q86JP5 Ras-related protein RabR 7.37e-05 2.93e-02 NA NA
5. P Q3JBT3 Guanylate kinase 4.38e-02 1.22e-02 NA NA
5. P Q2YXF9 Guanylate kinase 5.61e-02 1.21e-02 NA NA
5. P Q12IL8 Guanylate kinase 2.13e-02 1.60e-02 NA NA
5. P Q54RX9 Putative ras-related protein Rab-5B 1.01e-05 9.00e-03 NA NA
5. P B2UW65 Urease accessory protein UreG 2.51e-03 1.86e-03 NA NA
5. P Q8VY57 ADP-ribosylation factor-like protein 8a 5.26e-08 5.86e-08 NA NA
5. P P61212 ADP-ribosylation factor-like protein 1 2.67e-08 2.04e-09 NA NA
5. P A8G4K3 Urease accessory protein UreG 3.18e-03 3.91e-03 NA NA
5. P Q1MTE5 ADP-ribosylation factor-like protein 3 1.16e-08 4.27e-07 NA NA
5. P Q6CB54 Small COPII coat GTPase SAR1 1.82e-08 3.80e-05 NA NA
5. P A4QA26 Urease accessory protein UreG 9.75e-04 9.34e-05 NA NA
5. P Q99RX9 Urease accessory protein UreG 1.00e-03 4.55e-03 NA NA
5. P Q55AD9 ADP-ribosylation factor-like protein 5 1.28e-08 2.50e-07 NA NA
5. P Q9NVJ2 ADP-ribosylation factor-like protein 8B 5.59e-08 1.38e-09 NA NA
5. P Q6GHM6 Guanylate kinase 4.33e-02 1.21e-02 NA NA
5. P Q9KG56 Urease accessory protein UreG 2.03e-03 3.21e-03 NA NA
5. P Q1QKV7 Guanylate kinase 3.86e-02 7.96e-03 NA NA
5. P Q09066 Urease accessory protein UreG 2.51e-03 1.67e-03 NA NA
5. P P51822 ADP-ribosylation factor 1 3.36e-08 2.19e-08 NA NA
5. P G3MZQ6 GTPase IMAP family member GIMD1 2.34e-09 4.60e-05 NA NA
5. P Q83GE3 Guanylate kinase 1.81e-01 1.79e-02 NA NA
5. P Q9L638 Urease accessory protein UreG 3.09e-03 2.17e-02 NA NA
5. P Q7WZE5 Guanylate kinase 3.34e-02 1.88e-02 NA NA
5. P P52884 GTP-binding protein SAR2 4.11e-08 3.04e-03 NA NA
5. P B3PXA8 Urease accessory protein UreG 1.76e-03 5.12e-03 NA NA
5. P P61207 ADP-ribosylation factor 3 4.52e-08 3.11e-08 NA NA
5. P Q3T0T7 GTP-binding protein SAR1b 4.32e-06 7.24e-07 NA NA
5. P B0TT74 Urease accessory protein UreG 1.27e-03 3.51e-03 NA NA
5. P Q7VUD5 Urease accessory protein UreG 2.69e-03 1.90e-05 NA NA
5. P P42877 Urease accessory protein UreG 1.27e-03 4.60e-03 NA NA
5. P Q20Z78 Urease accessory protein UreG 1.20e-03 1.40e-04 NA NA
5. P A6VD02 Urease accessory protein UreG 1.19e-03 9.55e-04 NA NA
5. P Q2G273 Urease accessory protein UreG 1.26e-03 4.55e-03 NA NA
5. P C3K4L3 Urease accessory protein UreG 1.27e-03 1.60e-02 NA NA
5. P A6VTW1 Urease accessory protein UreG 2.02e-03 1.18e-02 NA NA
5. P Q8YI01 Urease accessory protein UreG 2 6.26e-04 9.00e-03 NA NA
5. P Q2GHE0 Guanylate kinase 4.80e-02 1.11e-02 NA NA
5. P B7GXU0 Urease accessory protein UreG 1.20e-03 1.14e-02 NA NA
5. P P52885 GTP-binding protein SAR1 3.43e-08 1.39e-06 NA NA
5. P Q1IBN6 Urease accessory protein UreG 1.63e-03 4.94e-03 NA NA
5. P Q9CCQ7 Guanylate kinase 7.05e-02 1.86e-02 NA NA
5. P P39110 GTP-binding protein CIN4 2.09e-10 4.19e-10 NA NA
5. P Q9KNM4 Guanylate kinase 3.58e-02 3.61e-02 NA NA
5. P Q9FCD5 Urease accessory protein UreG 4.07e-03 1.29e-04 NA NA
5. P Q7RVM2 ADP-ribosylation factor 4.85e-08 4.10e-08 NA NA
5. P Q007T5 ADP-ribosylation factor 6 3.21e-08 3.06e-07 NA NA
5. P Q7VRS8 Urease accessory protein UreG 1.06e-03 2.56e-03 NA NA
5. P Q9VHV5 ADP-ribosylation factor-like protein 8 9.08e-08 7.04e-08 NA NA
5. P Q13BD7 Urease accessory protein UreG 2.09e-03 2.34e-04 NA NA
5. P A6UC29 Urease accessory protein UreG 1.83e-03 1.36e-02 NA NA
5. P Q755D7 Small COPII coat GTPase SAR1 6.07e-08 2.55e-06 NA NA
5. P A0K573 Urease accessory protein UreG 1.50e-03 5.33e-04 NA NA
5. P Q9NXU5 ADP-ribosylation factor-like protein 15 3.14e-07 2.19e-06 NA NA
5. P Q0KCP3 Urease accessory protein UreG 3.20e-03 1.99e-04 NA NA
5. P B0BRT8 Urease accessory protein UreG 2.62e-03 4.98e-03 NA NA
5. P O48649 ADP-ribosylation factor 1 4.78e-08 2.02e-07 NA NA
5. P Q2G9M5 Guanylate kinase 5.75e-02 7.21e-04 NA NA
5. P A4YF54 Urease accessory protein UreG 1.69e-03 8.54e-03 NA NA
5. P Q9ZMB7 Guanylate kinase 5.32e-02 2.47e-02 NA NA
5. P Q5E731 Urease accessory protein UreG 1.39e-03 1.48e-03 NA NA
5. P P51824 ADP-ribosylation factor 1 6.19e-08 4.68e-03 NA NA
5. P Q0IIM2 ADP-ribosylation factor-like protein 6 3.54e-08 1.47e-05 NA NA
5. P Q67PR9 Guanylate kinase 3.36e-02 4.45e-04 NA NA
5. P A1D4D1 Small COPII coat GTPase sar1 5.74e-08 1.67e-06 NA NA
5. P P76556 Probable acetate kinase EutP 2.55e-08 1.47e-04 NA NA
5. P Q2YMJ2 Guanylate kinase 3.30e-02 3.18e-03 NA NA
5. P B1MB87 Urease accessory protein UreG 4.24e-03 2.25e-02 NA NA
5. P P56559 ADP-ribosylation factor-like protein 4C 4.83e-08 7.70e-04 NA NA
5. P Q06396 ADP-ribosylation factor 1 4.56e-08 6.73e-08 NA NA
5. P Q9RP19 Urease accessory protein UreG 1.53e-03 2.25e-02 NA NA
5. P Q9KXS0 Guanylate kinase 6.25e-02 4.94e-03 NA NA
5. P P61206 ADP-ribosylation factor 3 5.00e-08 3.11e-08 NA NA
5. P Q5FJH2 Guanylate kinase 3.24e-02 6.62e-03 NA NA
5. P P20606 Small COPII coat GTPase SAR1 3.06e-08 2.36e-06 NA NA
5. P Q1MCW4 Urease accessory protein UreG 1.69e-03 3.67e-03 NA NA
5. P Q1DB04 Mutual gliding-motility protein MglA 5.99e-08 7.54e-08 NA NA
5. P A9W297 Urease accessory protein UreG 2 6.54e-04 1.70e-03 NA NA
5. P Q9Y7Z2 ADP-ribosylation factor 6 5.73e-08 8.80e-10 NA NA
5. P Q54JJ3 ADP-ribosylation factor H 4.23e-08 9.72e-09 NA NA
5. P P36397 ADP-ribosylation factor 1 2.29e-08 7.80e-08 NA NA
5. P Q98PN5 Guanylate kinase 2.86e-02 9.16e-03 NA NA
5. P C5C8U6 Urease accessory protein UreG 9.42e-04 1.26e-02 NA NA
5. P P0DJR0 GTPase IMAP family member GIMD1 2.41e-09 2.04e-05 NA NA
5. P A1VKW0 Urease accessory protein UreG 2.46e-03 7.74e-05 NA NA
5. P Q66JN8 Ciliogenesis and planar polarity effector 2 1.19e-03 1.50e-02 NA NA
5. P A4XQ16 Urease accessory protein UreG 1.33e-03 4.09e-03 NA NA
5. P Q972W3 Urease accessory protein UreG 5.68e-03 1.68e-02 NA NA
5. P Q5LYX1 Guanylate kinase 3.79e-02 2.08e-02 NA NA
5. P Q6T311 ADP-ribosylation factor-like protein 9 2.69e-08 2.31e-07 NA NA
5. P P60555 Guanylate kinase 4.64e-02 1.42e-02 NA NA
5. P Q4A0J8 Urease accessory protein UreG 1.34e-03 9.73e-04 NA NA
5. P Q58DI9 ADP-ribosylation factor-like protein 11 5.82e-09 1.41e-04 NA NA
5. P Q2SYG0 Urease accessory protein UreG 2.49e-03 1.24e-04 NA NA
5. P Q4P0I7 Small COPII coat GTPase SAR1 5.76e-08 1.16e-05 NA NA
5. P A6QJD3 Urease accessory protein UreG 1.19e-03 4.55e-03 NA NA
5. P P0CT16 Small COPII coat GTPase SAR1 7.30e-08 1.38e-05 NA NA
5. P B1YUF6 Urease accessory protein UreG 2.30e-03 5.14e-04 NA NA
5. P B4RSY2 Urease accessory protein UreG 9.12e-04 7.16e-03 NA NA
5. P Q60Z38 ADP-ribosylation factor-like protein 6 1.69e-08 6.60e-06 NA NA
5. P P61204 ADP-ribosylation factor 3 4.46e-08 3.11e-08 NA NA
5. P Q62HR7 Urease accessory protein UreG 1.60e-03 3.01e-04 NA NA
5. P Q9X6M5 Guanylate kinase 3.89e-02 3.29e-02 NA NA
5. P Q2YDM1 ADP-ribosylation factor-like protein 1 2.48e-08 2.07e-09 NA NA
5. P Q5M1G3 Urease accessory protein UreG 1.35e-03 2.60e-02 NA NA
5. P Q9XUC2 Intraflagellar transport associated protein 2 7.74e-07 7.11e-06 NA NA
5. P Q39IL2 Guanylate kinase 5.60e-02 3.42e-03 NA NA
5. P A4WR79 Urease accessory protein UreG 1.62e-03 1.98e-02 NA NA
5. P A5W4B2 Urease accessory protein UreG 1.23e-03 1.73e-03 NA NA
5. P Q66HA6 ADP-ribosylation factor-like protein 8B 5.80e-08 1.38e-09 NA NA
5. P Q4WJS7 Small COPII coat GTPase sar1 3.71e-08 1.20e-06 NA NA
5. P Q13795 ADP-ribosylation factor-related protein 1 5.33e-08 2.99e-03 NA NA
5. P Q9K9Y2 Guanylate kinase 2.84e-02 4.72e-03 NA NA
5. P Q182S8 Guanylate kinase 4.39e-02 1.80e-02 NA NA
5. P Q57I92 Guanylate kinase 3.98e-02 3.26e-02 NA NA
5. P Q5LSP9 Urease accessory protein UreG 1.85e-03 5.95e-03 NA NA
5. P P0DB94 Guanylate kinase 3.44e-02 4.23e-02 NA NA
5. P Q61LA8 ADP-ribosylation factor 1-like 2 6.66e-08 1.29e-07 NA NA
5. P Q5YTM7 Guanylate kinase 7.68e-02 1.85e-02 NA NA
5. P Q1JAJ4 Guanylate kinase 3.75e-02 4.23e-02 NA NA
5. P P84077 ADP-ribosylation factor 1 3.73e-08 9.61e-09 NA NA
5. P Q52NJ3 GTP-binding protein SAR1a 3.18e-06 6.64e-07 NA NA
5. P P40617 ADP-ribosylation factor-like protein 4A 4.14e-08 8.54e-04 NA NA
5. P Q80ZU0 ADP-ribosylation factor-like protein 5A 2.06e-08 1.19e-08 NA NA
5. P B5FBC3 Urease accessory protein UreG 1.37e-03 1.13e-03 NA NA
5. P B1Z8R3 Urease accessory protein UreG 2 5.60e-04 2.68e-03 NA NA
5. P Q2G1U0 Guanylate kinase 5.54e-02 1.00e-02 NA NA
5. P A1V1G3 Urease accessory protein UreG 1.59e-03 3.01e-04 NA NA
5. P Q83HT8 Guanylate kinase 1.97e-01 1.79e-02 NA NA
5. P Q492F1 Urease accessory protein UreG 1.07e-03 1.44e-03 NA NA
5. P P75678 Uncharacterized protein YkfA 1.07e-11 2.25e-02 NA NA
5. P B8IJ81 Urease accessory protein UreG 1.33e-03 1.13e-03 NA NA
5. P P61020 Ras-related protein Rab-5B 7.80e-08 1.44e-02 NA NA
5. P A3NCM0 Urease accessory protein UreG 1.58e-03 3.01e-04 NA NA
5. P P84082 ADP-ribosylation factor 2 3.63e-08 4.12e-09 NA NA
5. P Q1AVZ3 Guanylate kinase 3.14e-02 8.17e-03 NA NA
5. P Q6G053 Guanylate kinase 5.64e-02 6.09e-04 NA NA
5. P P60554 Guanylate kinase 5.93e-02 3.24e-02 NA NA
5. P Q5H3S2 Guanylate kinase 3.75e-02 2.95e-02 NA NA
5. P P61208 ADP-ribosylation factor-like protein 4C 4.80e-08 7.70e-04 NA NA
5. P B1M3X4 Urease accessory protein UreG 1 1.55e-03 1.27e-05 NA NA
5. P Q03287 Urease accessory protein UreG 1.35e-03 1.89e-03 NA NA
5. P Q5REU3 ADP-ribosylation factor-like protein 4D 1.12e-07 1.07e-06 NA NA
5. P Q8MXQ2 Ras-related protein Rab-32C 5.58e-08 1.77e-02 NA NA
5. P Q7VKP3 Guanylate kinase 5.48e-02 3.24e-02 NA NA
5. P Q5R6E7 ADP-ribosylation factor-like protein 8B 9.50e-08 3.32e-09 NA NA
5. P Q895Q5 Guanylate kinase 2.74e-02 3.77e-03 NA NA
5. P Q3ZAF9 Guanylate kinase 4.97e-02 1.77e-02 NA NA
5. P A1SYY4 Urease accessory protein UreG 9.15e-04 4.68e-03 NA NA
5. P Q71YI9 Guanylate kinase 2.60e-02 1.88e-02 NA NA
5. P Q5FS85 Guanylate kinase 4.19e-02 1.09e-02 NA NA
5. P P0CR30 Small COPII coat GTPase SAR1 4.75e-08 9.52e-05 NA NA
5. P Q8FT45 Guanylate kinase 4.58e-02 4.16e-02 NA NA
5. P Q8SQH8 ADP-ribosylation factor 7.36e-10 1.28e-06 NA NA
5. P P37996 ADP-ribosylation factor-like protein 3 1.64e-08 3.34e-07 NA NA
5. P Q2TA37 ADP-ribosylation factor-like protein 2 2.84e-08 2.19e-06 NA NA
5. P B1VHT5 Urease accessory protein UreG 1.35e-03 2.85e-03 NA NA
5. P Q1G9H8 Guanylate kinase 2.84e-02 2.43e-02 NA NA
5. P P61213 ADP-ribosylation factor-like protein 4A 4.45e-08 9.03e-04 NA NA
5. P A1KBB1 Urease accessory protein UreG 1.23e-03 3.15e-03 NA NA
5. P Q5L0S8 Guanylate kinase 3.41e-02 1.18e-02 NA NA
5. P Q93PJ0 Urease accessory protein UreG 2.31e-03 2.21e-04 NA NA
5. P O26859 Uncharacterized protein MTH_765 2.02e-10 1.49e-07 NA NA
5. P P44396 Urease accessory protein UreG 1.33e-03 3.65e-05 NA NA
5. P Q9D0J4 ADP-ribosylation factor-like protein 2 2.35e-08 3.70e-06 NA NA
5. P Q9X215 Guanylate kinase 3.38e-02 1.15e-02 NA NA
5. P Q9CEE3 Guanylate kinase 3.36e-02 2.17e-02 NA NA
5. P A3MMV5 Urease accessory protein UreG 1.57e-03 3.01e-04 NA NA
5. P P49076 ADP-ribosylation factor 4.49e-08 5.79e-08 NA NA
5. P Q8NX22 Guanylate kinase 5.47e-02 1.00e-02 NA NA
5. P Q9CZT8 Ras-related protein Rab-3B 5.88e-08 4.72e-02 NA NA
5. P P62332 ADP-ribosylation factor 6 2.95e-08 3.06e-07 NA NA
5. P P99176 Guanylate kinase 5.37e-02 9.08e-03 NA NA
5. P P60552 Guanylate kinase 2.87e-02 4.34e-02 NA NA
5. P B2JF70 Urease accessory protein UreG 2.19e-03 4.67e-04 NA NA
5. P Q47G58 Urease accessory protein UreG 9.96e-04 4.05e-03 NA NA
5. P Q15Z10 Guanylate kinase 7.14e-02 1.77e-02 NA NA
5. P Q3MD38 Guanylate kinase 4.67e-02 6.98e-03 NA NA
5. P Q7CX57 Urease accessory protein UreG 1.64e-03 8.95e-04 NA NA
5. P Q07403 Urease accessory protein UreG 7.51e-04 1.83e-03 NA NA
5. P Q9CQW2 ADP-ribosylation factor-like protein 8B 7.53e-08 1.38e-09 NA NA
5. P Q3KIV1 Urease accessory protein UreG 1.30e-03 1.16e-02 NA NA
5. P Q8Z0I7 Guanylate kinase 4.84e-02 3.58e-03 NA NA
5. P P36057 Signal recognition particle receptor subunit beta 6.59e-08 2.60e-04 NA NA
5. P Q88J00 Urease accessory protein UreG 1.23e-03 3.33e-03 NA NA
5. P Q6NZW8 ADP-ribosylation factor-like protein 8B-A 8.07e-08 2.51e-09 NA NA
5. P Q5GS56 Guanylate kinase 2.76e-02 3.61e-02 NA NA
5. P A1JKE2 Urease accessory protein UreG 4.13e-04 6.26e-04 NA NA
5. P Q2S8R2 Guanylate kinase 6.56e-02 1.56e-02 NA NA
5. P Q8R9S6 Guanylate kinase 3.14e-02 2.10e-02 NA NA
5. P P56103 Guanylate kinase 7.82e-02 3.16e-02 NA NA
5. P Q6CWR7 Small COPII coat GTPase SAR1 4.63e-08 6.07e-06 NA NA
5. P B5XU24 Urease accessory protein UreG 1.12e-03 1.32e-04 NA NA
5. P Q9BU20 Ciliogenesis and planar polarity effector 2 1.57e-06 1.76e-02 NA NA
5. P Q59S78 Small COPII coat GTPase SAR1 3.09e-08 1.93e-03 NA NA
5. P Q3YRE2 Guanylate kinase 4.12e-02 4.92e-02 NA NA
5. P Q58330 Uncharacterized protein MJ0920 2.22e-12 6.76e-19 NA NA
5. P A8ET01 Urease accessory protein UreG 3.98e-03 4.33e-05 NA NA
5. P Q8DMQ4 Urease accessory protein UreG 1.72e-03 3.71e-04 NA NA
5. P Q144E7 Urease accessory protein UreG 2.72e-03 2.63e-03 NA NA
5. P P38116 ADP-ribosylation factor-like protein 1 4.18e-08 9.47e-08 NA NA
5. P P51646 ADP-ribosylation factor-like protein 5A 1.97e-08 1.39e-08 NA NA
5. P Q9D4P0 ADP-ribosylation factor-like protein 5B 1.23e-08 1.31e-06 NA NA
5. P Q96BM9 ADP-ribosylation factor-like protein 8A 9.91e-08 2.61e-09 NA NA
5. P Q8RPX7 Urease accessory protein UreG 1.66e-03 7.23e-03 NA NA
5. P Q8D2E8 Guanylate kinase 5.69e-02 3.16e-02 NA NA
5. P Q5PYH3 GTP-binding protein SAR1b 8.72e-08 9.84e-07 NA NA
5. P Q4FMR1 Guanylate kinase 6.27e-02 1.09e-02 NA NA
5. P Q8G813 Guanylate kinase 1.20e-02 7.75e-03 NA NA
5. P Q9P6I5 Guanylate kinase 3.76e-02 8.85e-03 NA NA
5. P P47758 Signal recognition particle receptor subunit beta 2.31e-06 1.86e-04 NA NA
5. P Q0CUN7 Small COPII coat GTPase sar1 3.70e-08 5.58e-06 NA NA
5. P A5VNL6 Urease accessory protein UreG 1 1.49e-03 3.07e-03 NA NA
5. P Q819T6 Guanylate kinase 6.97e-02 3.03e-02 NA NA
5. P P40616 ADP-ribosylation factor-like protein 1 2.46e-08 3.74e-09 NA NA
5. P Q1JKP6 Guanylate kinase 3.67e-02 4.23e-02 NA NA
5. P A3PL34 Urease accessory protein UreG 1.35e-03 1.44e-02 NA NA
5. P Q73HV1 Guanylate kinase 2.62e-02 8.25e-03 NA NA
5. P Q48S18 Guanylate kinase 3.68e-02 4.23e-02 NA NA
5. P Q1B9F6 Guanylate kinase 5.91e-02 1.83e-03 NA NA
5. P Q1GXB9 Guanylate kinase 8.42e-02 1.71e-02 NA NA
5. P Q63055 ADP-ribosylation factor-related protein 1 3.49e-08 7.16e-03 NA NA
5. P Q2IX83 Guanylate kinase 1.12e-01 5.69e-03 NA NA
5. P P0CT17 Small COPII coat GTPase SAR1 4.01e-08 1.38e-05 NA NA
5. P Q62I00 Guanylate kinase 5.79e-02 1.44e-03 NA NA
5. P Q0A5V3 Guanylate kinase 1.16e-01 3.26e-02 NA NA
5. P P40940 ADP-ribosylation factor 3 5.02e-08 8.24e-09 NA NA
5. P A8HN58 Intraflagellar transport protein 27 1.45e-07 2.51e-02 NA NA
5. P B0VSB5 Urease accessory protein UreG 9.96e-04 1.14e-02 NA NA
5. P A2CDZ5 Urease accessory protein UreG 2.43e-03 1.00e-05 NA NA
5. P Q9ZMZ7 Urease accessory protein UreG 2.51e-03 1.86e-03 NA NA
5. P P62331 ADP-ribosylation factor 6 3.49e-08 3.06e-07 NA NA
5. P Q6P068 ADP-ribosylation factor-like protein 5C 8.09e-09 3.58e-05 NA NA
5. P Q3JPS9 Guanylate kinase 5.48e-02 1.44e-03 NA NA
5. P Q8VEH3 ADP-ribosylation factor-like protein 8A 7.58e-08 1.06e-09 NA NA
5. P Q55057 Urease accessory protein UreG 1.35e-03 2.60e-02 NA NA
5. P Q1JFN7 Guanylate kinase 3.76e-02 4.23e-02 NA NA
5. P Q9UYR9 GPN-loop GTPase PAB0955 3.42e-07 4.23e-02 NA NA
5. P P0C951 Small COPII coat GTPase SAR1 5.82e-08 3.39e-06 NA NA
5. P Q97PA3 Guanylate kinase 3.57e-02 7.89e-03 NA NA
5. P Q8GAU4 Guanylate kinase 7.40e-02 1.26e-02 NA NA
5. P Q0P5N6 ADP-ribosylation factor-like protein 16 9.54e-09 1.19e-07 NA NA
5. P Q636F5 Guanylate kinase 2.95e-02 5.59e-03 NA NA
5. P Q57EQ3 Guanylate kinase 4.33e-02 3.18e-03 NA NA
5. P Q5E9I6 ADP-ribosylation factor 3 5.51e-08 3.11e-08 NA NA
5. P Q7MPW9 Guanylate kinase 2.80e-02 2.33e-02 NA NA
5. P A6SZ10 Urease accessory protein UreG 1.41e-03 4.25e-04 NA NA
5. P Q65JT0 Guanylate kinase 3.05e-02 9.24e-03 NA NA
5. P Q54R04 ADP-ribosylation factor-like protein 8 6.43e-08 4.76e-08 NA NA
5. P Q64520 Guanylate kinase 6.25e-02 3.83e-02 NA NA
5. P P40945 ADP-ribosylation factor 2 4.44e-08 1.01e-07 NA NA
5. P Q8NQ42 Guanylate kinase 6.08e-02 4.72e-02 NA NA
5. P Q02FC5 Urease accessory protein UreG 1.18e-03 8.23e-04 NA NA
5. P A3N2R0 Urease accessory protein UreG 2.64e-03 4.36e-03 NA NA
5. P Q110R6 Guanylate kinase 3.92e-02 3.38e-02 NA NA
5. P O04266 GTP-binding protein SAR1A 3.85e-08 3.72e-05 NA NA
5. P Q5HZY2 GTP-binding protein SAR1b 6.92e-08 3.08e-06 NA NA
5. P P91924 ADP-ribosylation factor 1.18e-08 1.89e-07 NA NA
5. P Q5M9P8 ADP-ribosylation factor-like protein 6 4.54e-08 1.65e-05 NA NA
5. P Q8W4C8 ADP-ribosylation factor-like protein 8c 2.91e-08 1.29e-09 NA NA
5. P P65217 Guanylate kinase 3.38e-02 3.18e-03 NA NA
5. P Q5HDR5 Urease accessory protein UreG 1.47e-03 4.55e-03 NA NA
5. P B2HVS4 Urease accessory protein UreG 9.64e-04 1.14e-02 NA NA
5. P Q0AC95 Urease accessory protein UreG 1.05e-03 1.28e-02 NA NA
5. P P18085 ADP-ribosylation factor 4 1.94e-08 4.20e-06 NA NA
5. P Q5HPY1 Guanylate kinase 4.39e-02 1.58e-02 NA NA
5. P Q4JVH4 Guanylate kinase 5.25e-02 3.45e-03 NA NA
5. P Q8XXT4 Urease accessory protein UreG 1.45e-03 2.39e-04 NA NA
5. P P49702 ADP-ribosylation factor 5 1.85e-08 1.25e-06 NA NA
5. P Q72DM9 Guanylate kinase 9.75e-02 7.10e-03 NA NA
5. P Q32LJ2 ADP-ribosylation factor-related protein 1 3.39e-08 5.02e-03 NA NA
5. P Q2YQD6 Urease accessory protein UreG 2 7.10e-04 9.00e-03 NA NA
5. P A9KJR6 Urease accessory protein UreG 9.84e-04 6.88e-04 NA NA
5. P Q627K4 ADP-ribosylation factor-like protein 2 7.67e-09 4.77e-07 NA NA
5. P P26991 ADP-ribosylation factor 6.33e-08 2.92e-04 NA NA
5. P Q827Q3 Guanylate kinase 5.23e-02 5.21e-03 NA NA
5. P Q4R5P2 ADP-ribosylation factor 1 2.15e-08 9.61e-09 NA NA
5. P P9WKE8 Guanylate kinase 5.92e-02 1.16e-03 NA NA
5. P Q1CV86 Urease accessory protein UreG 2.50e-03 1.67e-03 NA NA
5. P Q57CE5 Urease accessory protein UreG 2 5.09e-04 9.00e-03 NA NA
5. P Q8DNR5 Guanylate kinase 3.72e-02 4.09e-03 NA NA
5. P Q3J158 Urease accessory protein UreG 1.37e-03 9.16e-03 NA NA
5. P Q117Z7 Urease accessory protein UreG 5.39e-04 2.85e-02 NA NA
5. P P0C583 Small COPII coat GTPase sar1 4.78e-08 9.71e-05 NA NA
5. P Q75A26 ADP-ribosylation factor 3.43e-08 3.46e-07 NA NA
5. P Q75ZQ3 Urease accessory protein UreG 4.94e-04 1.45e-03 NA NA
5. P Q8MQT8 GTP-binding protein Sar1 8.15e-09 8.73e-07 NA NA
5. P C1DMZ7 Urease accessory protein UreG 1.33e-03 1.39e-03 NA NA
5. P Q13V49 Guanylate kinase 6.94e-02 4.16e-03 NA NA
5. P Q6P8C8 ADP-ribosylation factor-like protein 8A 9.67e-08 1.29e-09 NA NA
5. P Q98CZ5 Urease accessory protein UreG 1.57e-03 4.88e-02 NA NA
5. P P40994 ADP-ribosylation factor 3 4.94e-08 3.82e-04 NA NA
5. P O04834 GTP-binding protein SAR1A 5.09e-08 2.23e-04 NA NA
5. P Q5NQE8 Guanylate kinase 5.49e-02 1.32e-03 NA NA
5. P Q6GA04 Guanylate kinase 5.56e-02 1.00e-02 NA NA
5. P Q89MV4 Guanylate kinase 3.70e-02 1.32e-02 NA NA
5. P Q56561 Urease accessory protein UreG 1.27e-03 1.83e-02 NA NA
5. P A1A4Y4 Immunity-related GTPase family M protein 2.76e-07 3.57e-09 NA NA
5. P Q9NR31 GTP-binding protein SAR1a 8.21e-08 5.88e-07 NA NA
5. P Q8K9C7 Guanylate kinase 2.76e-02 2.88e-02 NA NA
5. P P61214 ADP-ribosylation factor-like protein 4A 4.39e-08 9.03e-04 NA NA
5. P Q6N223 Urease accessory protein UreG 1.18e-03 2.34e-04 NA NA
5. P P62824 Ras-related protein Rab-3C 7.62e-08 4.45e-02 NA NA
5. P P0CR31 Small COPII coat GTPase SAR1 6.83e-08 9.52e-05 NA NA
5. P Q7NRL1 Guanylate kinase 3.75e-02 2.62e-02 NA NA
5. P Q8DDV6 Guanylate kinase 3.08e-02 2.33e-02 NA NA
5. P B1J819 Urease accessory protein UreG 1.23e-03 2.73e-03 NA NA
5. P Q5HTT7 Guanylate kinase 3.46e-02 9.32e-03 NA NA
5. P Q46YE8 Guanylate kinase 5.01e-02 2.17e-02 NA NA
5. P P38763 Uncharacterized protein YHR022C 8.44e-04 9.47e-08 NA NA
5. P P0A4R8 Urease accessory protein UreG 2.91e-03 1.96e-05 NA NA
5. P Q559R0 GTP-binding protein Sar1A 2.00e-08 3.46e-07 NA NA
5. P Q2J0B6 Urease accessory protein UreG 1.81e-03 6.44e-04 NA NA
5. P Q54HK2 ADP-ribosylation factor F 1.21e-08 8.26e-08 NA NA
5. P Q5R5P7 ADP-ribosylation factor 3 5.33e-08 3.11e-08 NA NA
5. P Q4A6S7 Guanylate kinase 3.15e-02 4.30e-02 NA NA
5. P P84080 ADP-ribosylation factor 1 4.18e-08 9.61e-09 NA NA
5. P Q8SS09 Small COPII coat GTPase SAR1 1.12e-07 1.33e-07 NA NA
5. P Q0S0L7 Guanylate kinase 5.13e-02 1.34e-02 NA NA
5. P Q01475 Small COPII coat GTPase sar1 3.95e-08 1.65e-05 NA NA
5. P Q9PNB8 Guanylate kinase 3.62e-02 1.02e-02 NA NA
5. P Q58735 Uncharacterized protein MJ1339 3.33e-10 1.20e-07 NA NA
5. P Q9H0F7 ADP-ribosylation factor-like protein 6 5.88e-08 4.33e-05 NA NA
5. P P0DB95 Guanylate kinase 3.95e-02 4.23e-02 NA NA
5. P O45379 ADP-ribosylation factor-like protein 3 1.15e-08 1.93e-06 NA NA
5. P Q96361 ADP-ribosylation factor 1 4.83e-08 8.24e-09 NA NA
5. P Q135N9 Guanylate kinase 1.23e-01 4.05e-03 NA NA
5. P Q1J5I6 Guanylate kinase 3.63e-02 4.23e-02 NA NA
5. P Q54Y14 GTP-binding protein Sar1B 4.54e-08 6.96e-06 NA NA
5. P A9BUC1 Urease accessory protein UreG 2.24e-03 5.65e-04 NA NA
5. P Q03ME0 Urease accessory protein UreG 1.35e-03 2.60e-02 NA NA
5. P P62330 ADP-ribosylation factor 6 3.09e-08 3.06e-07 NA NA
5. P Q28RI9 Urease accessory protein UreG 1.29e-03 3.97e-04 NA NA
5. P B1W5H1 Urease accessory protein UreG 1 4.22e-03 1.02e-02 NA NA
5. P P60556 Guanylate kinase 1.35e-01 9.83e-03 NA NA
5. P A9M617 Urease accessory protein UreG 2 6.90e-04 9.00e-03 NA NA
5. P P84084 ADP-ribosylation factor 5 4.84e-08 5.75e-07 NA NA
5. P Q826R7 Urease accessory protein UreG 3.90e-03 7.28e-04 NA NA
5. P Q9HUS0 Urease accessory protein UreG 1.17e-03 8.23e-04 NA NA
5. P Q2KA85 Guanylate kinase 4.32e-02 4.13e-03 NA NA
5. P Q1BYH5 Urease accessory protein UreG 1.51e-03 5.33e-04 NA NA
5. P Q3IRZ3 Urease accessory protein UreG 2.97e-03 1.37e-02 NA NA
5. P Q92QZ2 Guanylate kinase 4.57e-02 2.21e-03 NA NA
5. P Q732K0 Guanylate kinase 2.96e-02 5.59e-03 NA NA
5. P O34328 Guanylate kinase 3.09e-02 1.76e-02 NA NA
5. P Q6BVA7 Small COPII coat GTPase SAR1 4.02e-08 1.46e-03 NA NA
5. P B0KUZ3 Urease accessory protein UreG 1.22e-03 3.33e-03 NA NA
5. P Q9XDM6 Propanediol utilization protein PduV 1.33e-08 1.18e-06 NA NA
5. P O88848 ADP-ribosylation factor-like protein 6 3.37e-08 3.61e-05 NA NA
5. P Q6GNL4 Ciliogenesis and planar polarity effector 2 2.50e-06 5.81e-04 NA NA
5. P B7V1V6 Urease accessory protein UreG 1.14e-03 8.23e-04 NA NA
5. P Q3BPS0 Guanylate kinase 3.35e-02 9.41e-03 NA NA
5. P Q1MJ02 Guanylate kinase 4.15e-02 6.33e-03 NA NA
5. P Q9P4C8 Small COPII coat GTPase SAR1 4.35e-08 3.76e-05 NA NA
5. P Q99PE9 ADP-ribosylation factor-like protein 4D 1.31e-07 2.29e-06 NA NA
5. P Q7WI80 Guanylate kinase 4.20e-02 2.70e-03 NA NA
5. P Q3SZF2 ADP-ribosylation factor 4 1.68e-08 1.87e-07 NA NA
5. P Q0RM12 Urease accessory protein UreG 4.35e-03 4.16e-03 NA NA
5. P Q1GH67 Guanylate kinase 6.18e-02 1.25e-02 NA NA
5. P P34727 ADP-ribosylation factor 5.91e-08 2.96e-07 NA NA
5. P Q2L090 Guanylate kinase 3.40e-02 1.23e-03 NA NA
5. P Q52NJ4 ADP-ribosylation factor-like protein 3 1.61e-06 2.68e-07 NA NA
5. P Q47R17 Guanylate kinase 5.69e-02 4.68e-03 NA NA
5. P A8ISN6 ADP-ribosylation factor-like protein 3 7.91e-09 1.87e-07 NA NA
5. P Q8QHI3 ADP-ribosylation factor-like protein 3 1.23e-08 1.51e-07 NA NA
5. P Q0VC18 ADP-ribosylation factor-like protein 4D 9.78e-08 6.74e-06 NA NA
5. P B1ZHN6 Urease accessory protein UreG 1 1.53e-03 5.68e-05 NA NA
5. P P51821 ADP-ribosylation factor 1 3.49e-08 9.58e-08 NA NA
5. P Q25761 ADP-ribosylation factor 1 5.06e-08 8.45e-08 NA NA
5. P Q88C87 Guanylate kinase 2.78e-02 1.91e-02 NA NA
5. P Q88WL7 Guanylate kinase 3.56e-02 2.05e-02 NA NA
5. P Q2JWN7 Urease accessory protein UreG 1.88e-03 2.88e-03 NA NA
5. P A6TE45 Urease accessory protein UreG 1.15e-03 1.32e-04 NA NA
5. P O54424 Urease accessory protein UreG 2.62e-03 3.21e-03 NA NA
5. P Q7W6B2 Guanylate kinase 3.93e-02 2.70e-03 NA NA
5. P A7HHN3 Urease accessory protein UreG 4.00e-03 2.37e-02 NA NA
5. P Q3J773 Urease accessory protein UreG 2.43e-03 5.44e-04 NA NA
5. P A3NYD2 Urease accessory protein UreG 1.58e-03 3.01e-04 NA NA
5. P Q82ZD5 Guanylate kinase 3.68e-02 7.42e-03 NA NA
5. P Q06206 Urease accessory protein UreG 1.16e-03 6.27e-03 NA NA
5. P Q28PK5 Guanylate kinase 1.16e-01 1.73e-02 NA NA
5. P Q6P3A9 ADP-ribosylation factor-like protein 11 6.70e-09 2.26e-06 NA NA
5. P B2GI03 Urease accessory protein UreG 1.08e-03 2.61e-03 NA NA
5. P O13950 Signal recognition particle receptor subunit beta 1.56e-08 1.15e-06 NA NA
5. P Q9Y689 ADP-ribosylation factor-like protein 5A 1.86e-08 1.90e-08 NA NA
5. P Q5RCF1 ADP-ribosylation factor 4 1.40e-08 4.20e-06 NA NA
5. P A3PCN5 Urease accessory protein UreG 3.20e-03 3.81e-03 NA NA
5. P B9KK42 Urease accessory protein UreG 1.35e-03 7.16e-03 NA NA
5. P P0A4R7 Urease accessory protein UreG 2.87e-03 1.96e-05 NA NA
5. P P18319 Urease accessory protein UreG 1.14e-03 1.32e-04 NA NA
5. P Q4UY41 Guanylate kinase 3.81e-02 2.14e-02 NA NA
5. P P0C856 Urease accessory protein UreG 1 1.77e-03 3.15e-03 NA NA
5. P Q9Y5M8 Signal recognition particle receptor subunit beta 3.03e-06 3.20e-05 NA NA
5. P Q1BY73 Guanylate kinase 4.01e-02 1.65e-03 NA NA
5. P Q1ZXA5 ADP-ribosylation factor-like protein DDB_G0292332 1.10e-08 1.03e-09 NA NA
5. P Q93Y31 ADP-ribosylation factor-like protein 8b 4.85e-08 1.98e-07 NA NA
5. P A7X5M7 Urease accessory protein UreG 9.42e-04 4.55e-03 NA NA
5. P Q0AXK8 Guanylate kinase 1.69e-02 5.25e-03 NA NA
5. P Q1RK99 Guanylate kinase 2.22e-02 1.39e-02 NA NA
5. P Q5M604 Urease accessory protein UreG 1.35e-03 2.60e-02 NA NA
5. P Q54XX1 Signal recognition particle receptor subunit beta 5.49e-06 5.21e-03 NA NA
5. P Q8CNC6 Urease accessory protein UreG 1.25e-03 7.56e-04 NA NA
5. P P22274 ADP-ribosylation factor 2.30e-08 4.59e-09 NA NA
5. P Q0HZX1 Guanylate kinase 2.26e-02 4.55e-03 NA NA
5. P Q24TX4 Guanylate kinase 2.46e-02 1.52e-02 NA NA
5. P A3M3F5 Urease accessory protein UreG 1.01e-03 1.14e-02 NA NA
5. P F4IZ82 ADP-ribosylation factor-like protein 8d 2.49e-07 1.91e-07 NA NA
5. P P25160 ADP-ribosylation factor-like protein 1 4.36e-08 1.23e-09 NA NA
5. P P61210 ADP-ribosylation factor 1 1.33e-08 9.16e-08 NA NA
5. P P65223 Guanylate kinase 3.73e-02 4.23e-02 NA NA
5. P Q2SY72 Guanylate kinase 4.03e-02 1.20e-02 NA NA
5. P A5EJY3 Urease accessory protein UreG 2 1.50e-03 1.10e-03 NA NA
5. P Q17VS2 Urease accessory protein UreG 2.56e-03 1.63e-03 NA NA
5. P Q10943 ADP-ribosylation factor 1-like 2 5.58e-08 8.55e-08 NA NA
5. P Q8ER28 Guanylate kinase 2.89e-02 3.13e-02 NA NA
5. P A8LRR5 Urease accessory protein UreG 9.19e-04 5.79e-03 NA NA
5. P A4SY41 Urease accessory protein UreG 2.67e-03 9.82e-04 NA NA
5. P A9M7V8 Urease accessory protein UreG 1 1.65e-03 3.15e-03 NA NA
5. P Q5LS25 Guanylate kinase 5.64e-02 1.88e-03 NA NA
5. P Q2K522 Urease accessory protein UreG 1.72e-03 1.06e-02 NA NA
5. P Q3AVR7 Urease accessory protein UreG 2.53e-03 3.24e-03 NA NA
5. P B0CJQ0 Urease accessory protein UreG 1.76e-03 3.15e-03 NA NA
5. P C5BBR3 Urease accessory protein UreG 3.59e-04 4.64e-03 NA NA
5. P Q7VXZ3 Guanylate kinase 3.21e-02 2.70e-03 NA NA
5. P Q3AWM1 Guanylate kinase 4.33e-02 2.23e-02 NA NA
5. P Q166A7 Guanylate kinase 5.07e-02 2.11e-03 NA NA
5. P P84081 ADP-ribosylation factor 2 3.55e-08 4.12e-09 NA NA
5. P Q23445 GTP-binding protein SAR1 8.13e-08 1.18e-03 NA NA
5. P Q8UGD7 Guanylate kinase 5.95e-02 4.60e-03 NA NA
5. P Q9WUL7 ADP-ribosylation factor-like protein 3 7.15e-09 4.27e-07 NA NA
5. P P61750 ADP-ribosylation factor 4 1.69e-08 1.17e-06 NA NA
5. P E9PW74 GTPase IMAP family member GIMD1 5.41e-09 8.00e-04 NA NA
5. P C4LF59 Urease accessory protein UreG 1.39e-03 5.97e-04 NA NA
5. P B9J8L8 Urease accessory protein UreG 8.45e-04 2.37e-02 NA NA
5. P Q2TBW6 ADP-ribosylation factor-like protein 3 1.46e-08 9.05e-08 NA NA
5. P Q5E8P5 Guanylate kinase 3.52e-02 4.16e-03 NA NA
5. P Q4ZMY9 Urease accessory protein UreG 1.07e-03 2.08e-02 NA NA
5. P Q6GEE1 Urease accessory protein UreG 1.29e-03 4.55e-03 NA NA
5. P A4T7D7 Urease accessory protein UreG 1.02e-03 2.73e-03 NA NA
5. P O00909 ADP-ribosylation factor 1 6.18e-08 2.04e-07 NA NA
5. P Q3T0D7 GTP-binding protein SAR1a 1.99e-06 6.64e-07 NA NA
5. P Q30PL1 Guanylate kinase 7.01e-02 3.32e-02 NA NA
5. P Q5R4G5 ADP-ribosylation factor-like protein 6 2.96e-08 4.20e-05 NA NA
5. P P0CM16 ADP-ribosylation factor 4.87e-08 4.72e-07 NA NA
5. P A0L6F5 Urease accessory protein UreG 2.03e-03 2.39e-04 NA NA
5. P Q11EW1 Urease accessory protein UreG 8.60e-04 6.27e-03 NA NA
5. P Q8BGR6 ADP-ribosylation factor-like protein 15 3.61e-07 1.75e-06 NA NA
5. P A1CRG9 Small COPII coat GTPase sar1 3.69e-08 1.66e-06 NA NA
5. P Q12DU6 Urease accessory protein UreG 2.38e-03 4.16e-05 NA NA
5. P Q3SRZ7 Guanylate kinase 1.04e-01 4.76e-03 NA NA
5. P Q2JQ59 Guanylate kinase 6.79e-02 3.32e-02 NA NA
5. P Q2RXB1 Guanylate kinase 3.85e-02 1.93e-02 NA NA
5. P B2U7M8 Urease accessory protein UreG 2.09e-03 2.10e-04 NA NA
5. P Q2GLF7 Guanylate kinase 4.85e-02 2.01e-02 NA NA
5. P Q49WZ1 Guanylate kinase 4.55e-02 1.37e-02 NA NA
5. P Q7KQL3 ADP-ribosylation factor 1 4.75e-08 7.29e-08 NA NA
5. P Q7MAK5 Guanylate kinase 2.14e-02 1.33e-02 NA NA
5. P Q5R548 GTP-binding protein SAR1a 2.32e-06 5.88e-07 NA NA
5. P A2BQW2 Urease accessory protein UreG 3.15e-03 5.49e-04 NA NA
5. P A9W6X0 Urease accessory protein UreG 1 1.53e-03 1.83e-05 NA NA
5. P P62823 Ras-related protein Rab-3C 8.26e-08 4.45e-02 NA NA
5. P Q31B55 Urease accessory protein UreG 2.99e-03 2.17e-03 NA NA
5. P P84078 ADP-ribosylation factor 1 5.28e-08 9.61e-09 NA NA
5. P Q6KH87 Guanylate kinase 1.10e-02 4.27e-02 NA NA
5. P Q0HE40 Guanylate kinase 1.88e-02 5.79e-03 NA NA
5. P B5YUX6 Urease accessory protein UreG 1.09e-03 2.41e-05 NA NA
5. P A5DR82 Small COPII coat GTPase SAR1 4.65e-08 7.08e-04 NA NA
5. P P11076 ADP-ribosylation factor 1 3.07e-08 5.35e-08 NA NA
5. P Q11HG8 Guanylate kinase 3.48e-02 1.00e-03 NA NA
5. P P69993 Urease accessory protein UreG 6.69e-04 1.74e-03 NA NA
5. P Q5HGM3 Guanylate kinase 5.77e-02 1.00e-02 NA NA
5. P Q9A7N9 Guanylate kinase 5.18e-02 3.35e-02 NA NA
5. P Q1LQ34 Guanylate kinase 5.93e-02 1.83e-02 NA NA
5. P A5IV74 Urease accessory protein UreG 1.20e-03 4.55e-03 NA NA
5. P O48920 ADP-ribosylation factor 3.96e-08 3.96e-08 NA NA
5. P O08697 ADP-ribosylation factor-like protein 2 2.02e-08 5.02e-06 NA NA
5. P Q8DVK6 Guanylate kinase 3.83e-02 8.92e-03 NA NA
5. P Q8BXL7 ADP-ribosylation factor-related protein 1 3.75e-08 7.16e-03 NA NA
5. P Q21TP7 Guanylate kinase 7.37e-02 3.99e-02 NA NA
5. P Q2P6N0 Guanylate kinase 3.74e-02 2.95e-02 NA NA
5. P B1JX26 Urease accessory protein UreG 2.33e-03 6.09e-04 NA NA
5. P P51645 ADP-ribosylation factor 6 2.96e-08 1.49e-08 NA NA
5. P P65219 Guanylate kinase 4.45e-02 9.08e-03 NA NA
5. P Q02804 ADP-ribosylation factor-like protein 3 5.06e-05 1.20e-06 NA NA
5. P Q559X6 Ras-related protein Rab-2B 7.07e-06 1.43e-02 NA NA
5. P P52131 Uncharacterized protein YfjP 8.39e-12 7.42e-03 NA NA
5. P Q7UP92 Guanylate kinase 4.44e-02 1.42e-02 NA NA
5. P Q215S7 Guanylate kinase 1.05e-01 6.73e-03 NA NA
5. P Q7U3I9 Urease accessory protein UreG 1.77e-03 7.49e-04 NA NA
5. P Q8X9U4 Urease accessory protein UreG 1.11e-03 2.41e-05 NA NA
5. P Q2YYV2 Urease accessory protein UreG 1.43e-03 4.68e-03 NA NA
5. P Q89AC8 Guanylate kinase 5.40e-02 8.47e-03 NA NA
5. P Q01474 GTP-binding protein SAR1B 4.36e-08 1.04e-04 NA NA
5. P Q1CUI1 Guanylate kinase 7.94e-02 3.77e-02 NA NA
5. P Q2LQ62 Guanylate kinase 9.65e-02 2.33e-02 NA NA
5. P Q7V3V8 Urease accessory protein UreG 2.03e-03 1.34e-04 NA NA
5. P P0CM17 ADP-ribosylation factor 4.28e-08 4.72e-07 NA NA
5. P Q6G729 Urease accessory protein UreG 1.01e-03 6.39e-03 NA NA
5. P Q0AQC4 Guanylate kinase 5.13e-02 3.49e-02 NA NA
5. P A6NH57 Putative ADP-ribosylation factor-like protein 5C 2.33e-08 1.31e-06 NA NA
5. P Q5M3I4 Guanylate kinase 3.81e-02 2.08e-02 NA NA
5. P A8L7B6 Urease accessory protein UreG 5.85e-03 3.03e-02 NA NA
5. P A2SDI6 Urease accessory protein UreG 2.05e-03 7.03e-06 NA NA
5. P Q733J9 Urease accessory protein UreG 9.76e-04 2.80e-02 NA NA
5. P Q5R579 ADP-ribosylation factor-related protein 1 4.88e-08 2.99e-03 NA NA
5. P Q7A427 Urease accessory protein UreG 1.18e-03 4.55e-03 NA NA
5. P Q1LTY3 Guanylate kinase 8.33e-02 6.16e-03 NA NA
5. P Q7CNT4 Urease accessory protein UreG 1 1.78e-03 3.15e-03 NA NA
5. P Q9LQC8 ADP-ribosylation factor 2-A 4.36e-08 6.07e-08 NA NA
5. P Q81WG7 Guanylate kinase 2.94e-02 5.59e-03 NA NA
5. P C5CY05 Urease accessory protein UreG 1.72e-03 9.49e-03 NA NA
5. P P26990 ADP-ribosylation factor 6 3.12e-08 2.31e-07 NA NA
5. P Q9QVY3 GTP-binding protein SAR1b 2.88e-06 6.21e-07 NA NA
5. P P10948 Ras-related protein Rab-3B 6.52e-08 4.76e-02 NA NA
5. P Q2YPD2 Urease accessory protein UreG 1 1.78e-03 3.15e-03 NA NA
5. P Q19705 ADP-ribosylation factor-like protein 2 8.24e-09 3.46e-07 NA NA
5. P Q0UKC0 Small COPII coat GTPase SAR1 4.57e-08 4.09e-04 NA NA
5. P Q09767 ADP-ribosylation factor-like protein alp41 1.23e-08 1.30e-05 NA NA
5. P Q2KJ96 ADP-ribosylation factor-like protein 5A 1.86e-08 3.00e-08 NA NA
5. P Q54V47 ADP-ribosylation factor J 1.73e-08 1.14e-07 NA NA
5. P Q3J2A5 Guanylate kinase 5.66e-02 2.37e-02 NA NA
5. P Q48DC7 Urease accessory protein UreG 1.09e-03 2.08e-02 NA NA
5. P Q5WFK3 Guanylate kinase 3.12e-02 1.09e-02 NA NA
5. P Q088T7 Guanylate kinase 2.16e-02 4.88e-02 NA NA
5. P B1M9D7 Urease accessory protein UreG 2 7.10e-04 2.83e-03 NA NA
5. P Q5RFN0 ADP-ribosylation factor-like protein 15 3.26e-07 7.18e-06 NA NA
5. P B5Z671 Urease accessory protein UreG 2.49e-03 1.67e-03 NA NA
5. P A4WEJ8 Urease accessory protein UreG 1.14e-03 4.16e-03 NA NA
5. P A6U417 Urease accessory protein UreG 1.03e-03 4.55e-03 NA NA
5. P A1B1B6 Urease accessory protein UreG 1.14e-03 2.03e-02 NA NA
5. P Q46IY9 Urease accessory protein UreG 1.68e-03 3.07e-03 NA NA
5. P Q06849 ADP-ribosylation factor-like protein 2 1.18e-08 3.78e-06 NA NA
5. P Q63RV7 Guanylate kinase 5.85e-02 1.44e-03 NA NA
5. P Q1MRL0 Guanylate kinase 3.05e-02 2.36e-03 NA NA
5. P P40946 ADP-ribosylation factor 6 4.07e-08 1.58e-07 NA NA
5. P Q5ZKQ8 ADP-ribosylation factor-like protein 8A 7.87e-08 4.76e-09 NA NA
5. P Q79VJ1 Urease accessory protein UreG 9.80e-04 1.16e-04 NA NA
5. P P51644 ADP-ribosylation factor 4 2.11e-08 3.82e-07 NA NA
5. P Q3AGD6 Urease accessory protein UreG 2.95e-03 1.13e-04 NA NA
5. P P0A209 Probable acetate kinase EutP 4.29e-08 1.58e-05 NA NA
5. P B0BMZ3 GTPase IMAP family member GIMD1 2.27e-09 2.25e-03 NA NA
5. P P61211 ADP-ribosylation factor-like protein 1 2.68e-08 2.04e-09 NA NA
5. P Q2Y9M4 Urease accessory protein UreG 2.26e-03 9.25e-05 NA NA
5. P Q2FEK0 Urease accessory protein UreG 9.78e-04 4.55e-03 NA NA
5. P A2C4R6 Urease accessory protein UreG 1.25e-03 8.00e-04 NA NA
5. P Q3T0M9 ADP-ribosylation factor-like protein 4A 3.95e-08 9.03e-04 NA NA
5. P Q12DV7 Guanylate kinase 6.42e-02 4.53e-02 NA NA
5. P Q1H0F5 Urease accessory protein UreG 1.14e-03 1.14e-02 NA NA
5. P B5FYQ0 ADP-ribosylation factor-like protein 3 1.48e-08 4.05e-08 NA NA
5. P Q94231 ADP-ribosylation factor 1-like 1 4.66e-08 2.03e-06 NA NA
5. P P57509 Guanylate kinase 3.92e-02 2.43e-02 NA NA
5. P P34212 ADP-ribosylation factor-like protein 5 2.79e-08 3.87e-08 NA NA
5. P Q4R4S4 ADP-ribosylation factor-like protein 8B 6.19e-08 8.17e-10 NA NA
5. P P61021 Ras-related protein Rab-5B 8.14e-08 1.44e-02 NA NA
5. P P61205 ADP-ribosylation factor 3 3.81e-08 3.11e-08 NA NA
5. P P51823 ADP-ribosylation factor 2 1.53e-08 1.00e-07 NA NA
5. P O23778 ADP-ribosylation factor 1 1.22e-08 1.43e-07 NA NA
5. P A5EDB2 Urease accessory protein UreG 1 7.37e-04 2.88e-03 NA NA
5. P B1XYX6 Urease accessory protein UreG 2.71e-03 2.34e-03 NA NA
5. P Q64PY1 Guanylate kinase 4.56e-02 6.44e-03 NA NA
5. P Q9CQC9 GTP-binding protein SAR1b 1.17e-07 6.21e-07 NA NA
5. P Q92MY5 Urease accessory protein UreG 8.34e-04 1.05e-02 NA NA
5. P Q4QN12 Urease accessory protein UreG 1.53e-03 3.07e-05 NA NA
5. P P84079 ADP-ribosylation factor 1 4.47e-08 9.61e-09 NA NA
5. P Q473Q6 Urease accessory protein UreG 1.71e-03 1.56e-04 NA NA
5. P Q5L5M1 Guanylate kinase 3.04e-02 4.06e-02 NA NA
5. P Q39IW6 Urease accessory protein UreG 1.55e-03 7.08e-04 NA NA
5. P Q63RL0 Urease accessory protein UreG 1.56e-03 3.01e-04 NA NA
5. P Q4QJK3 Guanylate kinase 5.67e-02 1.79e-02 NA NA
5. P B3Q6Q0 Urease accessory protein UreG 1.20e-03 2.34e-04 NA NA
5. P P19146 ADP-ribosylation factor 2 1.01e-08 2.02e-08 NA NA
5. P Q4FZX7 Signal recognition particle receptor subunit beta 3.61e-06 5.70e-06 NA NA
5. P P0A208 Probable acetate kinase EutP 3.43e-08 1.58e-05 NA NA
5. P A8Z390 Urease accessory protein UreG 1.01e-03 4.55e-03 NA NA
5. P B8EPU6 Urease accessory protein UreG 1.41e-03 2.43e-02 NA NA
5. P Q5XAP1 Guanylate kinase 3.72e-02 4.23e-02 NA NA
5. P Q20758 ADP-ribosylation factor-like protein 1 5.66e-08 5.66e-08 NA NA
5. P Q96KC2 ADP-ribosylation factor-like protein 5B 1.14e-08 1.31e-06 NA NA
5. P Q6FUZ9 Small COPII coat GTPase SAR1 3.92e-08 4.08e-05 NA NA
5. P B6JPH1 Urease accessory protein UreG 2.00e-03 1.98e-03 NA NA
5. P A4JC39 Urease accessory protein UreG 2.30e-03 1.44e-03 NA NA
5. P A8APV3 Urease accessory protein UreG 1.13e-03 1.84e-04 NA NA
5. P Q8G2P5 Urease accessory protein UreG 1 1.77e-03 3.15e-03 NA NA
5. P Q7N4Y4 Urease accessory protein UreG 3.13e-04 8.46e-04 NA NA
5. P Q8Y672 Guanylate kinase 2.68e-02 1.88e-02 NA NA
5. P Q7TN89 GTPase ERas 6.42e-06 1.04e-03 NA NA
5. P Q3AC14 Guanylate kinase 2.61e-02 3.27e-03 NA NA
5. P A5VRB1 Urease accessory protein UreG 2 6.48e-04 9.00e-03 NA NA
5. P Q3SLI4 Guanylate kinase 4.68e-02 3.49e-02 NA NA
5. P Q3JPJ3 Urease accessory protein UreG 1.54e-03 6.75e-04 NA NA
5. P Q2FHM9 Guanylate kinase 5.18e-02 1.00e-02 NA NA
5. P O04267 GTP-binding protein SAR1B 4.67e-08 1.23e-03 NA NA
5. P Q6HEU4 Guanylate kinase 2.99e-02 5.59e-03 NA NA
5. P Q7Z444 GTPase ERas 1.04e-05 4.88e-02 NA NA
5. P Q877B9 Small COPII coat GTPase sar1 3.82e-08 4.33e-06 NA NA
5. P P61209 ADP-ribosylation factor 1 3.72e-08 9.16e-08 NA NA
5. P P36404 ADP-ribosylation factor-like protein 2 2.47e-08 3.36e-06 NA NA
5. P P61751 ADP-ribosylation factor 4 2.15e-08 1.17e-06 NA NA
5. P Q2HA55 Small COPII coat GTPase SAR1 4.61e-08 5.46e-05 NA NA
5. P Q2SDP8 Urease accessory protein UreG 1.18e-03 5.44e-04 NA NA
5. P Q4KJ34 Urease accessory protein UreG 1.06e-03 1.37e-02 NA NA
5. P C1D603 Urease accessory protein UreG 5.24e-04 7.56e-04 NA NA
5. P Q18EB7 Urease accessory protein UreG 3.11e-03 4.84e-05 NA NA
5. P P84083 ADP-ribosylation factor 5 2.47e-08 5.75e-07 NA NA
5. P B3H2K9 Urease accessory protein UreG 2.64e-03 1.65e-03 NA NA
5. P A3LTA2 Small COPII coat GTPase SAR1 4.61e-08 1.91e-03 NA NA
5. P B5ZMN5 Urease accessory protein UreG 1.68e-03 8.47e-03 NA NA
5. P Q18510 ADP-ribosylation factor-like protein 6 2.25e-08 2.83e-05 NA NA
5. P A2S993 Urease accessory protein UreG 1.60e-03 3.01e-04 NA NA
5. P P69992 Urease accessory protein UreG 6.77e-04 1.74e-03 NA NA
5. P B9JR74 Urease accessory protein UreG 1.58e-03 6.22e-03 NA NA
5. P Q97ID0 Guanylate kinase 3.19e-02 2.83e-03 NA NA
5. P Q2KI07 ADP-ribosylation factor-like protein 8B 6.83e-08 1.32e-09 NA NA
5. P Q5RBG1 Ras-related protein Rab-5B 7.94e-08 1.44e-02 NA NA
5. P P51643 ADP-ribosylation factor 1 4.36e-08 9.96e-09 NA NA
5. P Q3B204 Guanylate kinase 1.92e-02 1.93e-02 NA NA
5. P Q0I662 Urease accessory protein UreG 2.28e-03 1.01e-03 NA NA
5. P P0A5I5 Guanylate kinase 8.42e-02 1.16e-03 NA NA
5. P A6WVR5 Urease accessory protein UreG 2.10e-03 1.29e-02 NA NA
5. P Q54V41 ADP-ribosylation factor K 2.38e-08 3.83e-08 NA NA
5. P Q9ZPX1 ADP-ribosylation factor-like protein 2 2.56e-08 2.14e-06 NA NA
5. P B0V9P2 Urease accessory protein UreG 1.20e-03 1.14e-02 NA NA
5. P Q94650 ADP-ribosylation factor 1 5.04e-08 7.29e-08 NA NA
5. P Q5RCQ6 ADP-ribosylation factor-like protein 3 2.81e-07 6.67e-06 NA NA
5. P P36536 GTP-binding protein SAR1a 7.76e-08 1.95e-07 NA NA
5. P Q601H3 Guanylate kinase 1.69e-02 3.49e-02 NA NA
5. P A5E5G3 Small COPII coat GTPase SAR1 6.00e-08 1.95e-03 NA NA
5. P P44310 Guanylate kinase 5.83e-02 1.82e-02 NA NA
5. P P36405 ADP-ribosylation factor-like protein 3 8.58e-09 2.39e-07 NA NA
5. P Q54UF1 ADP-ribosylation factor-like protein 2 1.38e-08 6.40e-06 NA NA
5. P Q5EA19 ADP-ribosylation factor-like protein 15 2.99e-07 1.02e-06 NA NA
5. P Q92AI1 Guanylate kinase 2.64e-02 3.18e-02 NA NA
5. P Q7V1B0 Urease accessory protein UreG 3.09e-03 2.17e-02 NA NA
5. P Q4AAI1 Guanylate kinase 1.75e-02 3.49e-02 NA NA
5. P Q3AQL3 Guanylate kinase 3.12e-02 4.34e-02 NA NA
5. P Q32NS2 NF-kappa-B inhibitor-interacting Ras-like protein 2 1.09e-06 1.65e-03 NA NA
5. P Q8EJU6 Guanylate kinase 1.99e-02 3.21e-03 NA NA
5. P P36579 ADP-ribosylation factor 1 4.31e-08 3.29e-08 NA NA
5. P Q89UF7 Urease accessory protein UreG 1.29e-03 7.42e-04 NA NA
5. P Q8P5T7 Guanylate kinase 3.49e-02 2.14e-02 NA NA
5. P Q984S9 Guanylate kinase 2.85e-02 1.06e-04 NA NA
5. P Q5BK71 ADP-ribosylation factor-like protein 11 3.82e-09 5.58e-06 NA NA
5. P Q479A8 Guanylate kinase 3.53e-02 4.68e-02 NA NA
6. F Q3JCW1 GTPase Der 3.42e-07 NA NA 0.6592
6. F Q9CHH6 GTPase Der 2.92e-07 NA NA 0.6391
6. F A4X692 GTPase Der 1.13e-06 NA NA 0.6446
6. F Q49884 GTPase Der 5.71e-05 NA NA 0.6721
6. F Q2NB82 GTPase Era 7.19e-10 NA NA 0.6635
6. F B6YQB9 GTPase Der 5.44e-07 NA NA 0.6327
6. F A8LYU3 GTPase Der 1.23e-06 NA NA 0.7051
6. F Q7V8X0 GTPase Der 3.81e-07 NA NA 0.608
6. F B3CR58 GTPase Der 2.72e-06 NA NA 0.6143
6. F O67749 GTPase Der 1.66e-06 NA NA 0.6772
6. F B3ETF1 GTPase Der 4.52e-07 NA NA 0.5884
6. F Q73Y13 GTPase Era 3.52e-12 NA NA 0.8138
6. F Q6AGF6 GTPase Der 5.95e-07 NA NA 0.7154
6. F B7I5H1 GTPase Der 6.65e-07 NA NA 0.6531
6. F P96128 GTPase Der 5.60e-07 NA NA 0.6565
6. F A5U372 GTPase Der 4.34e-07 NA NA 0.6537
6. F A8FT74 GTPase Der 1.95e-06 NA NA 0.6661
6. F Q8EQA8 GTPase Der 2.02e-07 NA NA 0.6218
6. F P0A563 GTPase Era 1.23e-11 NA NA 0.7903
6. F A5PKB7 GTPase IMAP family member 6 5.96e-06 NA NA 0.4369
6. F Q0ICK8 GTPase Der 3.81e-07 NA NA 0.6159
6. F Q5FFN4 GTPase Era 6.05e-12 NA NA 0.795
6. F A9BMU9 GTPase Der 4.26e-07 NA NA 0.6457
6. F P9WNL2 GTPase Der 3.58e-07 NA NA 0.6249
6. F C1AQS7 GTPase Era 1.24e-11 NA NA 0.7906
6. F Q7V2S6 GTPase Der 3.70e-07 NA NA 0.6004
6. F C1DE52 GTPase Der 3.31e-06 NA NA 0.6331
6. F Q6G0H5 GTPase Der 1.38e-06 NA NA 0.6772
6. F Q49768 GTPase Era 2.57e-12 NA NA 0.7782
6. F Q7U8G2 GTPase Der 3.19e-07 NA NA 0.6152
6. F Q740D6 GTPase Der 4.79e-07 NA NA 0.6517
6. F Q04ZS1 GTPase Der 1.19e-06 NA NA 0.6178
6. F C5CIV1 GTPase Der 1.25e-07 NA NA 0.6464
6. F Q6G5J7 GTPase Der 5.10e-06 NA NA 0.6759
6. F P9WNK8 GTPase Era 1.20e-11 NA NA 0.7905
6. F A1VNF8 GTPase Der 7.72e-07 NA NA 0.6508
6. F A1KL54 GTPase Era 1.31e-11 NA NA 0.7903
6. F A5CDT2 GTPase Der 7.98e-07 NA NA 0.6191
6. F Q0VNE4 GTPase Der 7.13e-07 NA NA 0.667
6. F Q49Y10 GTPase Era 4.43e-12 NA NA 0.7275
6. F A5U557 GTPase Era 1.34e-11 NA NA 0.7608
6. F A0QEB0 GTPase Era 3.76e-12 NA NA 0.8136
6. F Q6NG20 GTPase Era 7.72e-12 NA NA 0.7676
6. F A5GR60 GTPase Der 3.39e-07 NA NA 0.634
6. F Q8F6K1 GTPase Der 9.00e-07 NA NA 0.6928
6. F A9IQH4 GTPase Der 3.22e-06 NA NA 0.6755
6. F Q30TK8 GTPase Der 4.42e-07 NA NA 0.6022
6. F A1TA72 GTPase Der 5.54e-05 NA NA 0.6702
6. F C1ANY6 GTPase Der 3.35e-07 NA NA 0.6215
6. F Q04TV4 GTPase Der 1.30e-06 NA NA 0.6093
7. B A6Q4R8 GTPase Der 5.63e-07 NA 0.003 NA
7. B B4U7P8 GTPase Obg 2.78e-06 NA 0.010 NA
7. B Q8Z4K5 GTPase Era 6.70e-12 NA 0.040 NA
7. B Q7VFY6 GTPase Der 1.23e-05 NA 1.31e-04 NA
7. B B1KX71 GTPase Der 4.26e-07 NA 1.07e-05 NA
7. B A1APR8 GTPase Era 4.44e-11 NA 0.004 NA
7. B A7ZBS1 GTPase Der 8.59e-07 NA 7.55e-06 NA
7. B A5I816 tRNA modification GTPase MnmE 1.28e-03 NA 1.43e-05 NA
7. B Q0SRG1 GTPase Era 2.90e-12 NA 3.52e-04 NA
7. B B1L9N6 tRNA modification GTPase MnmE 1.93e-05 NA 0.029 NA
7. B B8ZP66 GTPase Era 5.54e-13 NA 8.16e-07 NA
7. B Q2SR47 tRNA modification GTPase MnmE 1.46e-02 NA 0.025 NA
7. B Q8P161 tRNA modification GTPase MnmE 1.85e-05 NA 0.024 NA
7. B Q834T4 GTPase Der 2.11e-07 NA 6.13e-05 NA
7. B B7MYJ7 GTPase Era 3.90e-11 NA 0.047 NA
7. B B8I736 GTPase Era 5.28e-13 NA 4.22e-07 NA
7. B B1I462 GTPase Der 2.86e-07 NA 0.002 NA
7. B C5D8U8 Ribosome biogenesis GTPase A 2.57e-02 NA 8.95e-05 NA
7. B Q8XH30 tRNA modification GTPase MnmE 4.54e-05 NA 1.14e-04 NA
7. B Q5XDG3 GTPase Era 5.63e-13 NA 3.99e-07 NA
7. B Q601N0 tRNA modification GTPase MnmE 2.04e-04 NA 0.008 NA
7. B Q9H089 Large subunit GTPase 1 homolog 8.46e-02 NA 0.015 NA
7. B B2THQ9 GTPase Der 5.71e-07 NA 2.53e-05 NA
7. B Q9CY28 GTP-binding protein 8 0.00e+00 NA 2.39e-23 NA
7. B A4TKX7 GTPase Era 4.91e-11 NA 0.019 NA
7. B A3CPT0 GTPase Der 2.60e-07 NA 1.77e-04 NA
7. B B5XK74 GTPase Era 6.81e-13 NA 3.99e-07 NA
7. B A0Q125 GTPase Der 2.91e-07 NA 6.20e-05 NA
7. B Q9BT17 Mitochondrial ribosome-associated GTPase 1 5.00e-02 NA 0.031 NA
7. B B1YGA8 tRNA modification GTPase MnmE 1.25e-05 NA 0.032 NA
7. B Q1G7Z4 tRNA modification GTPase MnmE 1.67e-05 NA 0.001 NA
7. B B2IRW4 GTPase Der 2.66e-07 NA 5.59e-06 NA
7. B B1ZWP5 tRNA modification GTPase MnmE 5.36e-05 NA 0.004 NA
7. B A7Z636 GTPase Der 2.13e-07 NA 7.15e-07 NA
7. B Q6AEC6 GTPase Era 5.70e-12 NA 0.016 NA
7. B Q48UW6 GTPase Era 4.16e-12 NA 3.99e-07 NA
7. B O31743 Ribosome biogenesis GTPase A 1.40e-02 NA 2.16e-04 NA
7. B Q4L2Z2 tRNA modification GTPase MnmE 1.96e-05 NA 0.034 NA
7. B A5G693 GTPase Era 4.83e-12 NA 1.85e-06 NA
7. B Q5M5X5 GTPase Der 2.99e-07 NA 4.18e-05 NA
7. B B1IHR9 tRNA modification GTPase MnmE 1.08e-03 NA 1.43e-05 NA
7. B B7MIQ1 GTPase Era 3.70e-11 NA 0.047 NA
7. B Q6MFA3 tRNA modification GTPase MnmE 3.10e-05 NA 0.001 NA
7. B P47254 tRNA modification GTPase MnmE 9.00e-03 NA 0.014 NA
7. B Q02VP7 tRNA modification GTPase MnmE 3.71e-05 NA 0.003 NA
7. B A6LNG7 GTPase Der 2.30e-07 NA 0.010 NA
7. B B2TXX9 GTPase Era 3.96e-11 NA 0.047 NA
7. B Q9PB97 GTPase Era 2.50e-11 NA 1.22e-07 NA
7. B B1AI04 tRNA modification GTPase MnmE 1.57e-04 NA 0.046 NA
7. B B0U3D9 GTPase Era 4.47e-11 NA 1.10e-07 NA
7. B Q9C923 Nuclear/nucleolar GTPase 2 6.02e-02 NA 5.33e-04 NA
7. B Q1CKE3 GTPase Era 4.79e-11 NA 0.019 NA
7. B Q74AX4 GTPase Der 5.88e-07 NA 4.23e-05 NA
7. B Q8CMN5 tRNA modification GTPase MnmE 1.14e-05 NA 0.002 NA
7. B Q0I0Z2 tRNA modification GTPase MnmE 5.84e-05 NA 0.045 NA
7. B B9E055 GTPase Era 2.00e-12 NA 6.86e-05 NA
7. B Q3AC25 Small ribosomal subunit biogenesis GTPase RsgA 2.04e-03 NA 0.040 NA
7. B A8MG70 GTPase Era 3.13e-11 NA 0.027 NA
7. B Q5H1R1 GTPase Era 1.23e-11 NA 0.001 NA
7. B A7FW89 GTPase Der 4.87e-07 NA 1.07e-05 NA
7. B B9L7G9 GTPase Der 6.19e-07 NA 0.050 NA
7. B Q5WHD9 GTPase Era 1.48e-12 NA 0.004 NA
7. B P0A3C1 GTPase Era 1.25e-12 NA 2.96e-04 NA
7. B Q7SHR8 Nucleolar GTP-binding protein 2 2.64e-02 NA 0.017 NA
7. B A5N451 tRNA modification GTPase MnmE 8.34e-05 NA 1.82e-05 NA
7. B Q8CX54 tRNA modification GTPase MnmE 2.88e-05 NA 3.46e-04 NA
7. B A8ZU05 GTPase Der 3.61e-06 NA 2.36e-04 NA
7. B Q89AM7 GTPase Era 2.30e-10 NA 0.011 NA
7. B Q8R6K8 tRNA modification GTPase MnmE 3.79e-05 NA 0.004 NA
7. B C7LZP1 GTPase Era 2.76e-10 NA 3.62e-04 NA
7. B Q2RFI8 tRNA modification GTPase MnmE 1.72e-06 NA 5.58e-05 NA
7. B A9JTX2 Mitochondrial ribosome-associated GTPase 1 4.21e-02 NA 0.024 NA
7. B Q2FGW7 GTPase Der 2.54e-07 NA 3.57e-04 NA
7. B Q9PIB6 GTPase Der 1.90e-06 NA 0.008 NA
7. B B3E421 GTPase Der 7.92e-07 NA 1.95e-04 NA
7. B Q6NY89 Large subunit GTPase 1 homolog 9.83e-02 NA 0.043 NA
7. B A8YTQ7 tRNA modification GTPase MnmE 2.41e-05 NA 1.06e-04 NA
7. B Q1JN21 GTPase Era 8.30e-13 NA 3.99e-07 NA
7. B A1RHQ7 GTPase Der 1.85e-06 NA 0.002 NA
7. B C1CK50 GTPase Era 5.75e-13 NA 8.16e-07 NA
7. B A7ZQ10 GTPase Era 3.84e-11 NA 0.047 NA
7. B P38860 GTPase MTG2, mitochondrial 2.40e-03 NA 0.033 NA
7. B Q9W590 Large subunit GTPase 1 homolog 1.42e-01 NA 0.016 NA
7. B B8DE49 GTPase Era 9.15e-13 NA 0.013 NA
7. B A6M3M5 tRNA modification GTPase MnmE 4.41e-05 NA 0.040 NA
7. B Q74JL6 GTPase Der 2.16e-07 NA 0.025 NA
7. B A6TXE5 tRNA modification GTPase MnmE 2.44e-05 NA 0.003 NA
7. B Q8KH12 GTPase Der 1.80e-07 NA 0.013 NA
7. B B9KRT2 GTPase Der 2.58e-06 NA 0.013 NA
7. B B1LA53 GTPase Obg 1.41e-05 NA 0.002 NA
7. B Q8RHA2 tRNA modification GTPase MnmE 8.19e-05 NA 0.012 NA
7. B B2FPX8 GTPase Era 1.26e-11 NA 2.91e-08 NA
7. B Q6GD92 tRNA modification GTPase MnmE 1.50e-05 NA 0.030 NA
7. B Q085U2 GTPase Der 1.88e-06 NA 0.002 NA
7. B Q819W8 Ribosome biogenesis GTPase A 1.15e-02 NA 7.58e-05 NA
7. B Q30T75 tRNA modification GTPase MnmE 4.26e-05 NA 0.021 NA
7. B P0A3C4 GTPase Era 5.76e-13 NA 8.16e-07 NA
7. B Q81SW9 GTPase Der 2.89e-07 NA 0.011 NA
7. B Q9X1F8 GTPase Der 2.42e-07 NA 0.010 NA
7. B A1B4S0 GTPase Der 3.53e-06 NA 0.004 NA
7. B B0K5N4 tRNA modification GTPase MnmE 2.80e-05 NA 0.008 NA
7. B Q9NVN8 Guanine nucleotide-binding protein-like 3-like protein 6.80e-02 NA 0.024 NA
7. B B9DTQ3 GTPase Der 5.03e-07 NA 1.86e-06 NA
7. B A8FJG0 tRNA modification GTPase MnmE 2.83e-05 NA 4.02e-06 NA
7. B Q65CN1 tRNA modification GTPase MnmE 2.99e-05 NA 4.85e-06 NA
7. B B9KFN5 GTPase Der 1.55e-06 NA 3.91e-04 NA
7. B A2RGB0 GTPase Der 2.62e-07 NA 3.28e-05 NA
7. B Q8XJK1 GTPase Der 5.77e-07 NA 5.97e-05 NA
7. B C6DBH0 GTPase Der 1.11e-06 NA 3.38e-04 NA
7. B Q3YYV0 GTPase Era 3.82e-11 NA 0.047 NA
7. B P0DA96 GTPase Era 3.70e-12 NA 3.99e-07 NA
7. B Q9WXV3 GTPase Obg 3.71e-03 NA 4.89e-04 NA
7. B B8CXI2 GTPase Era 1.47e-11 NA 1.27e-06 NA
7. B Q181S7 tRNA modification GTPase MnmE 2.55e-05 NA 1.96e-05 NA
7. B A8G2J5 tRNA modification GTPase MnmE 5.56e-06 NA 0.003 NA
7. B C0PYN4 GTPase Der 6.98e-07 NA 8.93e-06 NA
7. B A0AIR3 GTPase Era 5.58e-12 NA 0.014 NA
7. B Q931E1 tRNA modification GTPase MnmE 9.24e-06 NA 0.022 NA
7. B Q5RA07 Guanine nucleotide-binding protein-like 1 2.37e-02 NA 0.005 NA
7. B Q7MHN9 GTPase Era 5.56e-11 NA 9.45e-06 NA
7. B Q8DKI1 GTPase Der 3.86e-07 NA 0.002 NA
7. B Q10VJ7 tRNA modification GTPase MnmE 3.98e-06 NA 0.014 NA
7. B B2V3Z1 GTPase Der 4.49e-07 NA 8.67e-05 NA
7. B Q7M7W8 GTPase Der 1.28e-06 NA 4.62e-06 NA
7. B G1UB61 Septin CDC11 1.13e-07 NA 0.034 NA
7. B Q49UI4 tRNA modification GTPase MnmE 1.87e-05 NA 0.002 NA
7. B Q71ZK8 GTPase Era 8.88e-13 NA 0.014 NA
7. B A1V9V1 GTPase Der 1.42e-06 NA 3.41e-06 NA
7. B Q6PGG6 Guanine nucleotide-binding protein-like 3-like protein 6.89e-02 NA 0.019 NA
7. B Q3AQ22 GTPase Der 6.43e-07 NA 2.29e-05 NA
7. B P53145 Large subunit GTPase 1 9.61e-02 NA 0.002 NA
7. B A1AE96 GTPase Era 3.79e-11 NA 0.047 NA
7. B Q58859 Uncharacterized GTP-binding protein MJ1464 2.35e-02 NA 0.028 NA
7. B A8FKH3 GTPase Der 2.78e-06 NA 0.006 NA
7. B A6U595 tRNA modification GTPase MnmE 2.00e-05 NA 0.030 NA
7. B Q8Y750 GTPase Era 9.25e-13 NA 0.014 NA
7. B C1CXC1 GTPase Era 8.83e-10 NA 3.17e-06 NA
7. B A6QKK2 tRNA modification GTPase MnmE 1.48e-05 NA 0.028 NA
7. B Q0T1T9 GTPase Era 4.28e-11 NA 0.030 NA
7. B P0DA97 GTPase Era 7.58e-13 NA 3.99e-07 NA
7. B Q1IWI7 GTPase Der 2.35e-07 NA 5.66e-06 NA
7. B A7H4Z1 GTPase Der 1.03e-06 NA 0.004 NA
7. B Q0TES2 GTPase Era 3.87e-11 NA 0.047 NA
7. B Q031W8 GTPase Era 1.17e-12 NA 2.78e-04 NA
7. B B9DNV9 GTPase Der 3.78e-07 NA 5.42e-04 NA
7. B B0K8N3 GTPase Der 3.19e-07 NA 2.21e-07 NA
7. B Q8DYI1 GTPase Era 6.69e-13 NA 6.88e-07 NA
7. B Q1G9W6 GTPase Era 1.24e-11 NA 0.009 NA
7. B A7FFU0 GTPase Era 4.93e-11 NA 0.019 NA
7. B Q46HI4 tRNA modification GTPase MnmE 6.09e-06 NA 0.004 NA
7. B Q3UM18 Large subunit GTPase 1 homolog 1.50e-01 NA 0.015 NA
7. B Q11TG8 tRNA modification GTPase MnmE 5.54e-05 NA 0.001 NA
7. B B1IIN2 GTPase Der 6.48e-07 NA 1.09e-05 NA
7. B B7M8H9 GTPase Era 3.81e-11 NA 0.047 NA
7. B A4VW74 GTPase Era 2.66e-12 NA 2.07e-07 NA
7. B Q8YZH7 GTPase Der 4.73e-07 NA 1.71e-05 NA
7. B Q04J64 GTPase Der 2.61e-07 NA 5.59e-06 NA
7. B B3ETH9 tRNA modification GTPase MnmE 2.11e-05 NA 5.81e-04 NA
7. B B8ZMH4 GTPase Der 2.90e-07 NA 5.59e-06 NA
7. B Q83QI5 GTPase Era 4.38e-12 NA 0.030 NA
7. B Q6G5W4 tRNA modification GTPase MnmE 2.42e-05 NA 0.030 NA
7. B A7GHG2 GTPase Era 1.87e-12 NA 2.25e-06 NA
7. B B1KLB1 GTPase Der 2.34e-06 NA 0.016 NA
7. B Q1C554 GTPase Era 5.28e-11 NA 0.019 NA
7. B A3QCG6 GTPase Der 1.70e-06 NA 0.008 NA
7. B B2TMB9 GTPase Era 3.40e-12 NA 0.008 NA
7. B Q9SJF1 GTPase LSG1-2 2.51e-01 NA 0.047 NA
7. B Q6YPI0 tRNA modification GTPase MnmE 1.22e-05 NA 5.06e-08 NA
7. B Q040F3 tRNA modification GTPase MnmE 9.65e-06 NA 0.018 NA
7. B P64065 GTPase Der 2.88e-07 NA 2.80e-05 NA
7. B B0TZQ0 GTPase Der 1.71e-06 NA 0.003 NA
7. B O81004 GTP-binding protein At2g22870 0.00e+00 NA 6.30e-33 NA
7. B D5DJL5 Ribosome biogenesis GTPase A 3.17e-02 NA 0.001 NA
7. B Q74H94 tRNA modification GTPase MnmE 1.12e-05 NA 0.021 NA
7. B B0RX26 GTPase Era 3.03e-11 NA 0.002 NA
7. B Q31CZ2 tRNA modification GTPase MnmE 3.15e-06 NA 0.002 NA
7. B B7J2L5 GTPase Era 9.10e-12 NA 2.95e-07 NA
7. B B2UMV5 GTPase Der 5.16e-07 NA 2.39e-05 NA
7. B B4U458 GTPase Era 4.28e-13 NA 4.22e-07 NA
7. B Q03F63 GTPase Era 3.85e-12 NA 0.004 NA
7. B A4W2H9 GTPase Era 2.74e-12 NA 2.07e-07 NA
7. B A3CNB0 tRNA modification GTPase MnmE 1.75e-05 NA 0.012 NA
7. B A0LE48 tRNA modification GTPase MnmE 1.69e-05 NA 0.010 NA
7. B B7K1S0 GTPase Der 3.20e-07 NA 0.001 NA
7. B B8GAY7 GTPase Der 5.94e-07 NA 2.70e-04 NA
7. B A5I626 GTPase Era 1.90e-12 NA 2.62e-06 NA
7. B C3L0M1 GTPase Der 4.78e-07 NA 3.16e-05 NA
7. B Q3MBM5 tRNA modification GTPase MnmE 1.22e-05 NA 0.003 NA
7. B B5Z140 GTPase Era 3.57e-12 NA 0.011 NA
7. B A6U1U3 GTPase Der 2.38e-07 NA 0.002 NA
7. B B0S3V2 tRNA modification GTPase MnmE 3.37e-05 NA 0.008 NA
7. B Q5M1D9 GTPase Der 3.12e-07 NA 4.18e-05 NA
7. B A3DHY8 tRNA modification GTPase MnmE 2.16e-06 NA 0.006 NA
7. B A1VYA6 GTPase Der 2.17e-06 NA 0.006 NA
7. B Q182C3 GTPase Era 3.12e-11 NA 0.002 NA
7. B Q5BK22 GTP-binding protein 8 0.00e+00 NA 8.08e-24 NA
7. B C1FSU2 GTPase Der 4.21e-07 NA 1.20e-05 NA
7. B Q2LSF6 tRNA modification GTPase MnmE 5.38e-06 NA 4.75e-05 NA
7. B A4ITX1 tRNA modification GTPase MnmE 2.57e-05 NA 3.19e-04 NA
7. B A5GW82 tRNA modification GTPase MnmE 8.47e-06 NA 2.09e-04 NA
7. B Q3A4Q5 GTPase Der 2.41e-07 NA 7.88e-04 NA
7. B Q0HX53 GTPase Der 2.10e-06 NA 0.001 NA
7. B B8E9T1 GTPase Der 1.76e-06 NA 0.002 NA
7. B C0MBF0 GTPase Era 5.31e-13 NA 3.46e-07 NA
7. B B2IPC3 GTPase Era 6.23e-13 NA 8.16e-07 NA
7. B P32559 tRNA modification GTPase MSS1, mitochondrial 6.99e-06 NA 0.013 NA
7. B Q895X8 GTPase Der 3.04e-07 NA 1.08e-04 NA
7. B C1CDW4 GTPase Era 4.45e-13 NA 1.40e-07 NA
7. B Q21086 Guanine nucleotide-binding protein-like 3 homolog 1.08e-02 NA 0.002 NA
7. B Q9WYA4 tRNA modification GTPase MnmE 7.45e-06 NA 0.031 NA
7. B A8FD69 Ribosome biogenesis GTPase A 1.43e-02 NA 3.65e-04 NA
7. B Q0TPJ9 GTPase Der 6.21e-07 NA 5.97e-05 NA
7. B Q8ZD71 GTPase Era 5.49e-11 NA 0.019 NA
7. B A7GVP7 tRNA modification GTPase MnmE 5.59e-03 NA 0.016 NA
7. B Q8XIU8 GTPase Era 2.83e-12 NA 2.92e-04 NA
7. B C6E2H7 GTPase Era 1.41e-10 NA 4.09e-07 NA
7. B Q0SPQ3 tRNA modification GTPase MnmE 6.35e-05 NA 2.36e-05 NA
7. B P64061 GTPase Der 1.96e-07 NA 0.002 NA
7. B C3L3F3 GTPase Era 2.13e-12 NA 3.32e-06 NA
7. B A6TSJ8 GTPase Era 2.32e-11 NA 1.42e-04 NA
7. B Q5HFU8 GTPase Der 2.74e-07 NA 0.002 NA
7. B A4IQA2 GTPase Der 1.93e-07 NA 0.005 NA
7. B Q57986 Fe(2+) transporter FeoB 2.81e-04 NA 5.92e-04 NA
7. B Q04A20 GTPase Era 1.46e-11 NA 0.009 NA
7. B Q5WAG3 tRNA modification GTPase MnmE 1.30e-05 NA 2.23e-05 NA
7. B A0RQK2 GTPase Der 8.88e-07 NA 0.009 NA
7. B A5IWD7 tRNA modification GTPase MnmE 2.06e-05 NA 0.030 NA
7. B B7LUZ8 GTPase Era 4.07e-11 NA 0.043 NA
7. B B1LNG6 GTPase Der 5.65e-07 NA 1.78e-05 NA
7. B C1CM45 GTPase Der 3.28e-07 NA 5.59e-06 NA
7. B A4WUI6 GTPase Der 2.94e-06 NA 0.013 NA
7. B O24756 GTPase Era 5.64e-13 NA 1.16e-07 NA
7. B Q9RS19 GTPase Der 1.80e-07 NA 2.70e-05 NA
7. B Q2LVR8 GTPase Era 1.23e-11 NA 0.002 NA
7. B A4VX53 GTPase Der 2.61e-07 NA 0.001 NA
7. B C0MCD8 GTPase Era 5.75e-13 NA 3.80e-07 NA
7. B Q04KR8 tRNA modification GTPase MnmE 2.20e-05 NA 0.005 NA
7. B Q5QYB3 GTPase Der 1.15e-06 NA 3.81e-04 NA
7. B P36916 Guanine nucleotide-binding protein-like 1 7.80e-03 NA 0.003 NA
7. B Q0I6N5 tRNA modification GTPase MnmE 4.33e-06 NA 4.51e-05 NA
7. B C4Z0C8 GTPase Der 3.65e-05 NA 1.44e-06 NA
7. B B1ILK9 GTPase Era 2.62e-12 NA 3.52e-06 NA
7. B B5E488 GTPase Era NA NA 1.59e-05 NA
7. B Q8DY73 GTPase Der 2.93e-07 NA 9.15e-05 NA
7. B B2S103 GTPase Era 1.48e-11 NA 9.11e-05 NA
7. B Q9XCI8 GTPase Der 7.28e-07 NA 9.72e-06 NA
7. B Q1IXB4 GTPase Era 1.55e-09 NA 5.07e-08 NA
7. B A2REM7 tRNA modification GTPase MnmE 2.18e-05 NA 0.023 NA
7. B B2V2K0 GTPase Era 3.38e-12 NA 0.025 NA
7. B A5CY46 tRNA modification GTPase MnmE 8.33e-06 NA 0.021 NA
7. B A1R085 GTPase Era 1.44e-11 NA 1.66e-05 NA
7. B B7KHD2 GTPase Der 4.08e-07 NA 3.85e-07 NA
7. B P36915 Guanine nucleotide-binding protein-like 1 3.78e-02 NA 0.005 NA
7. B Q5TM59 Guanine nucleotide-binding protein-like 1 2.39e-02 NA 0.005 NA
7. B Q97ID7 GTPase Der 3.99e-07 NA 0.010 NA
7. B Q92AI9 Small ribosomal subunit biogenesis GTPase RsgA 2 1.15e-02 NA 0.038 NA
7. B Q8RB50 GTPase Era 1.73e-12 NA 0.001 NA
7. B B9MS56 GTPase Era 8.76e-12 NA 0.029 NA
7. B Q2FYG0 GTPase Der 2.89e-07 NA 0.002 NA
7. B Q1LU74 GTPase Der 2.25e-07 NA 0.015 NA
7. B Q9TLX6 Probable tRNA modification GTPase MnmE 6.90e-07 NA 4.29e-08 NA
7. B Q8FF17 GTPase Era 3.64e-11 NA 0.047 NA
7. B B7GGD6 Ribosome biogenesis GTPase A 3.38e-02 NA 5.72e-05 NA
7. B Q97R24 tRNA modification GTPase MnmE 2.14e-05 NA 0.007 NA
7. B Q10190 Large subunit GTPase 1 1.25e-01 NA 0.002 NA
7. B Q54KS4 Guanine nucleotide-binding protein-like 3 homolog 2.88e-01 NA 0.009 NA
7. B Q2JM09 GTPase Der 4.18e-07 NA 8.93e-04 NA
7. B C1CRT1 GTPase Era 6.22e-13 NA 8.16e-07 NA
7. B Q4PS77 Mitochondrial ribosome-associated GTPase 1 4.49e-02 NA 0.002 NA
7. B A7MH00 GTPase Era 4.74e-11 NA 0.002 NA
7. B Q31XS1 GTPase Era 3.84e-11 NA 0.047 NA
7. B A7FXK1 GTPase Era 1.87e-12 NA 2.62e-06 NA
7. B P0A3C3 GTPase Era 4.60e-13 NA 8.16e-07 NA
7. B A8A376 GTPase Era 4.00e-11 NA 0.028 NA
7. B C4K7P4 tRNA modification GTPase MnmE 4.90e-05 NA 0.014 NA
7. B A4W3F7 GTPase Der 2.80e-07 NA 0.001 NA
7. B A2XGQ1 Nuclear/nucleolar GTPase 2 1.77e-02 NA 0.003 NA
7. B B0K708 GTPase Era 2.64e-12 NA 6.81e-07 NA
7. B B2I605 GTPase Era 1.56e-11 NA 2.01e-07 NA
7. B Q3T0J9 Guanine nucleotide-binding protein-like 3-like protein 1.23e-01 NA 0.017 NA
7. B Q8EWH6 GTPase Der 3.78e-07 NA 1.71e-06 NA
7. B Q1JI67 GTPase Era 3.99e-12 NA 4.73e-07 NA
7. B Q831T9 GTPase Era 1.93e-12 NA 0.002 NA
7. B A1AV43 tRNA modification GTPase MnmE 3.27e-05 NA 0.005 NA
7. B P66972 tRNA modification GTPase MnmE 1.35e-05 NA 0.030 NA
7. B A5IMD9 GTPase Der 2.23e-07 NA 0.011 NA
7. B Q2YDM7 Large subunit GTPase 1 homolog 1.01e-01 NA 0.017 NA
7. B Q6MGS5 GTPase Obg 5.86e-03 NA 0.012 NA
7. B B8I442 GTPase Der 5.91e-07 NA 1.83e-07 NA
7. B A5N6N6 GTPase Era 2.03e-12 NA 6.86e-05 NA
7. B P0DA91 GTPase Der 2.87e-07 NA 2.55e-05 NA
7. B A8MKR9 tRNA modification GTPase MnmE 2.71e-05 NA 0.001 NA
7. B P06616 GTPase Era 3.85e-11 NA 0.028 NA
7. B A2RG20 GTPase Era 3.64e-12 NA 3.99e-07 NA
7. B P0C0B9 GTPase Era 4.22e-12 NA 1.12e-07 NA
7. B A7GYN7 GTPase Era 7.88e-11 NA 0.022 NA
7. B A5IKX2 GTPase Obg 1.15e-05 NA 0.006 NA
7. B B2KA46 GTPase Era 5.43e-11 NA 0.019 NA
7. B Q7YR35 Guanine nucleotide-binding protein-like 1 2.35e-02 NA 0.005 NA
7. B B5RMK6 GTPase Era 1.42e-11 NA 1.15e-04 NA
7. B B0T6E0 tRNA modification GTPase MnmE 2.19e-05 NA 0.003 NA
7. B Q10LF7 Nuclear/nucleolar GTPase 2 3.32e-02 NA 0.003 NA
7. B O67030 tRNA modification GTPase MnmE 2.33e-05 NA 0.003 NA
7. B P37214 GTPase Era 6.61e-13 NA 3.40e-07 NA
7. B A7ZAW1 tRNA modification GTPase MnmE 3.34e-05 NA 3.12e-05 NA
7. B B1LP79 GTPase Era 4.19e-11 NA 0.047 NA
7. B Q92BP8 GTPase Era 8.79e-13 NA 7.17e-04 NA
7. B Q047F9 tRNA modification GTPase MnmE 1.72e-05 NA 0.001 NA
7. B Q8KAS1 tRNA modification GTPase MnmE 1.27e-05 NA 0.023 NA
7. B A5IKF4 tRNA modification GTPase MnmE 5.96e-04 NA 0.021 NA
7. B B4EZS9 GTPase Der 5.04e-07 NA 0.015 NA
7. B Q0SMJ3 GTPase Era 6.31e-11 NA 6.58e-06 NA
7. B Q9CDH8 tRNA modification GTPase MnmE 3.31e-05 NA 0.002 NA
7. B Q8R9J1 GTPase Der 4.70e-07 NA 1.15e-05 NA
7. B Q1JIH4 GTPase Der 3.13e-07 NA 1.17e-05 NA
7. B Q65VC3 tRNA modification GTPase MnmE 6.77e-05 NA 0.004 NA
7. B C6E0Y6 GTPase Der 4.35e-07 NA 2.32e-06 NA
7. B A2BUG6 tRNA modification GTPase MnmE 2.14e-06 NA 0.012 NA
7. B Q4A8F6 tRNA modification GTPase MnmE 1.66e-04 NA 0.008 NA
7. B P66973 tRNA modification GTPase MnmE 2.49e-05 NA 0.030 NA
7. B B4SRK9 GTPase Era 1.06e-11 NA 3.14e-08 NA
7. B A7GGA7 GTPase Der 4.58e-07 NA 1.21e-05 NA
7. B Q667V2 GTPase Era 5.26e-11 NA 0.019 NA
7. B B5RQ02 GTPase Era 1.31e-11 NA 3.48e-04 NA
7. B B5EE25 GTPase Der 4.48e-07 NA 2.15e-06 NA
7. B Q04KV9 GTPase Era 4.65e-13 NA 8.16e-07 NA
7. B A4XSC5 GTPase Era 8.46e-11 NA 0.001 NA
7. B P64088 GTPase Era 7.46e-13 NA 3.99e-07 NA
7. B Q5HW81 GTPase Der 1.76e-04 NA 0.008 NA
7. B Q9RWM0 GTPase Era 3.94e-10 NA 8.01e-04 NA
7. B Q5ZKR4 Rab-like protein 3 1.32e-07 NA 0.040 NA
7. B A7FPM0 tRNA modification GTPase MnmE 2.18e-05 NA 1.43e-05 NA
7. B B1LBI4 GTPase Der 2.68e-07 NA 0.005 NA
7. B Q9KPB3 GTPase Era 1.45e-10 NA 0.002 NA
7. B Q256D0 tRNA modification GTPase MnmE 7.77e-05 NA 2.84e-05 NA
7. B B0TLI8 GTPase Der 1.61e-06 NA 6.82e-04 NA
7. B Q73LG9 GTPase Era 1.12e-09 NA 1.96e-04 NA
7. B Q821L2 tRNA modification GTPase MnmE 3.02e-03 NA 7.73e-06 NA
7. B Q87C05 GTPase Era 1.18e-11 NA 2.01e-07 NA
7. B Q3K022 GTPase Era 6.68e-13 NA 6.88e-07 NA
7. B Q39T84 GTPase Era 1.42e-11 NA 0.002 NA
7. B O51604 GTPase Era 8.39e-12 NA 2.95e-07 NA
7. B Q9PQA7 GTPase Der 3.28e-07 NA 1.35e-04 NA
7. B Q4R8D2 Guanine nucleotide-binding protein-like 1 3.76e-02 NA 0.005 NA
7. B Q8N3Z3 GTP-binding protein 8 0.00e+00 NA 2.87e-23 NA
7. B Q3BVV5 GTPase Era 1.03e-10 NA 0.003 NA
7. B Q660L0 GTPase Era 7.44e-12 NA 2.39e-06 NA
7. B Q87LP0 GTPase Era 5.36e-11 NA 1.08e-04 NA
7. B A5IXQ6 GTPase Era 2.85e-10 NA 0.002 NA
7. B Q04AY6 GTPase Der 2.09e-07 NA 0.013 NA
7. B A7GWZ2 GTPase Der 9.39e-07 NA 1.50e-04 NA
7. B Q1JH22 tRNA modification GTPase MnmE 2.14e-05 NA 0.024 NA
7. B Q7NGF9 GTPase Der 3.80e-07 NA 5.86e-04 NA
7. B C0QA05 GTPase Der 6.52e-06 NA 8.77e-04 NA
7. B E0TTS5 Ribosome biogenesis GTPase A 1.68e-02 NA 1.96e-04 NA
7. B P0DG22 tRNA modification GTPase MnmE 2.25e-05 NA 0.024 NA
7. B B1HPM3 tRNA modification GTPase MnmE 1.60e-05 NA 0.004 NA
7. B A1APR9 GTPase Der 4.23e-07 NA 6.15e-07 NA
7. B Q2YT12 GTPase Era 5.78e-12 NA 0.017 NA
7. B B9K8E0 GTPase Der 2.50e-07 NA 0.003 NA
7. B Q1JD46 GTPase Era 3.88e-12 NA 3.99e-07 NA
7. B Q03MB1 GTPase Der 3.20e-07 NA 3.25e-05 NA
7. B A0RNG2 tRNA modification GTPase MnmE 2.90e-03 NA 0.020 NA
7. B A2C018 tRNA modification GTPase MnmE 4.57e-06 NA 0.003 NA
7. B B3E422 GTPase Era 1.81e-12 NA 0.016 NA
7. B A8H249 GTPase Der 1.89e-06 NA 5.77e-04 NA
7. B B1XB40 GTPase Era 3.75e-11 NA 0.028 NA
7. B P25811 tRNA modification GTPase MnmE 3.47e-05 NA 5.47e-05 NA
7. B Q7VQV3 tRNA modification GTPase MnmE 8.84e-05 NA 0.008 NA
7. B B1IBH5 tRNA modification GTPase MnmE 3.24e-05 NA 0.005 NA
7. B C1D094 GTPase Der 2.25e-07 NA 1.44e-06 NA
7. B Q9M8Z5 Guanine nucleotide-binding protein-like NSN1 2.46e-01 NA 0.003 NA
7. B Q8EPY0 GTPase Era 4.62e-12 NA 0.001 NA
7. B Q1J822 GTPase Era 8.80e-13 NA 1.51e-06 NA
7. B Q6G988 GTPase Der 2.76e-07 NA 0.002 NA
7. B Q8RGV7 GTPase Der 5.34e-07 NA 0.007 NA
7. B Q2YZB8 tRNA modification GTPase MnmE 1.72e-05 NA 0.032 NA
7. B Q2FDE8 tRNA modification GTPase MnmE 1.08e-05 NA 0.028 NA
7. B B0S8I0 GTP-binding protein 8 0.00e+00 NA 4.21e-24 NA
7. B A6QH24 GTPase Der 1.94e-07 NA 0.002 NA
7. B B7UH06 GTPase Era 3.80e-11 NA 0.047 NA
7. B Q97JI5 GTPase Era 1.47e-11 NA 0.003 NA
7. B B0TAF1 GTPase Era 7.33e-13 NA 1.55e-09 NA
7. B Q7NAD9 tRNA modification GTPase MnmE 2.03e-05 NA 0.020 NA
7. B P75135 Probable ribosome biogenesis GTPase A 2.32e-02 NA 7.31e-05 NA
7. B Q1WTU6 GTPase Era 1.58e-11 NA 1.53e-04 NA
7. B Q5XCB7 tRNA modification GTPase MnmE 2.26e-05 NA 0.023 NA
7. B Q5ZJD3 Large subunit GTPase 1 homolog 1.32e-01 NA 0.015 NA
7. B Q9RCA7 tRNA modification GTPase MnmE 3.08e-05 NA 9.84e-05 NA
7. B A6TCI0 GTPase Era 4.48e-11 NA 0.032 NA
7. B Q6MG06 Guanine nucleotide-binding protein-like 1 2.38e-02 NA 0.005 NA
7. B A8FEL8 GTPase Der 2.33e-07 NA 1.26e-05 NA
7. B Q05473 MIOREX complex component 8 0.00e+00 NA 1.12e-16 NA
7. B Q0TNU5 GTPase Era 2.75e-12 NA 1.08e-04 NA
7. B Q5XDR3 GTPase Der 2.93e-07 NA 2.80e-05 NA
7. B B7N6F4 GTPase Era 4.36e-11 NA 0.047 NA
7. B B1HTJ0 GTPase Era 9.80e-13 NA 0.001 NA
7. B Q2P4M0 GTPase Era 1.46e-10 NA 0.001 NA
7. B B7NRL9 GTPase Era 3.94e-11 NA 0.047 NA
7. B A8YYS1 tRNA modification GTPase MnmE 2.13e-05 NA 0.028 NA
7. B A7GJN9 tRNA modification GTPase MnmE 4.81e-05 NA 2.13e-05 NA
7. B A3PAQ7 tRNA modification GTPase MnmE 4.54e-06 NA 2.77e-04 NA
7. B Q3AEZ3 GTPase Era 2.07e-11 NA 0.032 NA
7. B B1IVR1 GTPase Era 3.70e-11 NA 0.028 NA
7. B B5XJW0 GTPase Der 2.99e-07 NA 2.80e-05 NA
7. B A7HK07 tRNA modification GTPase MnmE 2.30e-05 NA 0.007 NA
7. B A9NE34 tRNA modification GTPase MnmE 1.80e-05 NA 3.50e-06 NA
7. B Q2S6H2 tRNA modification GTPase MnmE 5.20e-05 NA 0.040 NA
7. B B0K8H9 tRNA modification GTPase MnmE 2.77e-05 NA 0.008 NA
7. B Q2Y5A9 tRNA modification GTPase MnmE 5.87e-06 NA 0.007 NA
7. B A5G692 GTPase Der 3.99e-07 NA 1.16e-04 NA
7. B A5D1U6 GTPase Der 2.43e-07 NA 1.26e-04 NA
7. B B9M914 GTPase Der 5.36e-07 NA 2.67e-06 NA
7. B Q3JZR6 GTPase Der 2.61e-07 NA 9.15e-05 NA
7. B Q8PB51 GTPase Era 1.42e-11 NA 0.002 NA
7. B Q39T85 GTPase Der 5.02e-07 NA 1.38e-06 NA
7. B B1KZM3 GTPase Era 2.05e-12 NA 3.76e-06 NA
7. B Q0SS66 GTPase Der 5.90e-07 NA 5.97e-05 NA
7. B Q2NIG1 tRNA modification GTPase MnmE 8.13e-06 NA 1.53e-11 NA
7. B A2BNY4 tRNA modification GTPase MnmE 4.48e-06 NA 8.22e-04 NA
7. B Q8H1F6 DAR GTPase 3, chloroplastic 1.09e-02 NA 0.006 NA
7. B B0KA54 GTPase Era 2.85e-12 NA 6.81e-07 NA
7. B Q057R5 GTPase Era 5.03e-09 NA 0.044 NA
7. B B5ZBM9 GTPase Der 3.38e-07 NA 3.14e-05 NA
7. B Q5HS36 tRNA modification GTPase MnmE 1.15e-05 NA 0.002 NA
7. B Q82XA1 tRNA modification GTPase MnmE 3.90e-05 NA 1.42e-04 NA
7. B A9R403 GTPase Era 5.14e-11 NA 0.019 NA
7. B B9K736 GTPase Obg 7.40e-04 NA 2.60e-05 NA
7. B Q8PMU9 GTPase Era 1.75e-11 NA 0.003 NA
7. B Q28QC6 GTPase Der 2.34e-06 NA 1.21e-04 NA
7. B B5XNH1 GTPase Era 5.22e-11 NA 0.011 NA
7. B Q9WZM6 Ribosome biogenesis GTPase A 8.69e-02 NA 0.020 NA
7. B B8G2P9 GTPase Der 3.16e-07 NA 2.49e-09 NA
7. B Q2GA15 GTPase Der 4.91e-06 NA 3.47e-04 NA
7. B P42182 GTPase Era 7.14e-13 NA 0.005 NA
7. B Q9PRC7 tRNA modification GTPase MnmE 1.60e-04 NA 0.046 NA
7. B B1JRC8 GTPase Era 5.24e-11 NA 0.019 NA
7. B Q8E3T9 GTPase Der 3.85e-07 NA 6.79e-05 NA
7. B Q49435 Probable ribosome biogenesis GTPase A 1.10e-01 NA 2.46e-05 NA
7. B Q1JNC4 GTPase Der 2.89e-07 NA 2.80e-05 NA
7. B Q5HP70 GTPase Der 3.11e-07 NA 3.63e-04 NA
7. B Q5N167 GTPase Der 3.86e-07 NA 0.005 NA
7. B Q65JP4 Ribosome biogenesis GTPase A 1.63e-02 NA 1.30e-04 NA
7. B Q5KU57 tRNA modification GTPase MnmE 3.16e-05 NA 6.92e-05 NA
7. B Q1LSJ9 GTPase Obg 4.27e-05 NA 0.035 NA
7. B B7LDF9 GTPase Era 3.30e-11 NA 0.047 NA
7. B B6I5E0 GTPase Era 4.15e-11 NA 0.047 NA
7. B P0DG23 tRNA modification GTPase MnmE 1.81e-05 NA 0.024 NA
7. B A8F7S2 GTPase Der 1.58e-06 NA 4.02e-05 NA
7. B Q6MUE7 tRNA modification GTPase MnmE 1.40e-02 NA 0.003 NA
7. B P0A6P5 GTPase Der 6.82e-07 NA 1.69e-05 NA
7. B Q892S2 GTPase Era 2.15e-12 NA 5.01e-04 NA
7. B B1KUB2 tRNA modification GTPase MnmE 2.12e-05 NA 1.43e-05 NA
7. B C1FVS6 GTPase Era 2.66e-12 NA 9.85e-06 NA
7. B Q5FJT7 GTPase Era 3.49e-11 NA 7.30e-04 NA
7. B O25505 GTPase Der 7.34e-07 NA 0.047 NA
7. B Q2NS44 GTPase Der 1.50e-06 NA 0.003 NA
7. B Q8E443 GTPase Era 3.66e-12 NA 6.88e-07 NA
7. B Q0AE55 tRNA modification GTPase MnmE 6.34e-06 NA 3.71e-04 NA
7. B P58070 GTPase Era 4.08e-11 NA 0.011 NA
7. B A8YVM7 GTPase Era 2.33e-11 NA 4.84e-04 NA
7. B A2RP37 tRNA modification GTPase MnmE 3.79e-05 NA 0.003 NA
7. B C1KVA9 GTPase Era 8.64e-13 NA 0.014 NA
7. B Q899S2 tRNA modification GTPase MnmE 1.44e-05 NA 0.011 NA
7. B Q8MT06 Guanine nucleotide-binding protein-like 3 homolog 5.71e-02 NA 0.003 NA
7. B Q5SM23 GTPase Era 1.33e-09 NA 1.39e-09 NA
7. B Q4USF8 GTPase Era 3.45e-11 NA 0.002 NA
7. B Q1R8G7 GTPase Era 4.62e-11 NA 0.047 NA
7. B A3CP94 GTPase Era 5.85e-13 NA 3.22e-07 NA
7. B Q8R2R6 Mitochondrial ribosome-associated GTPase 1 3.88e-02 NA 0.002 NA
7. B Q5HCI3 tRNA modification GTPase MnmE 8.40e-06 NA 0.028 NA
7. B B1IBC9 GTPase Era 3.29e-12 NA 8.16e-07 NA
7. B Q2RN77 tRNA modification GTPase MnmE 4.34e-03 NA 0.049 NA
7. B Q0TLZ4 tRNA modification GTPase MnmE 4.16e-05 NA 1.14e-04 NA
7. B B9M913 GTPase Era 6.43e-12 NA 1.49e-05 NA
7. B Q8DPZ8 tRNA modification GTPase MnmE 2.00e-05 NA 0.005 NA
7. B Q4AAC5 tRNA modification GTPase MnmE 1.70e-04 NA 0.008 NA
7. B A7X7A8 tRNA modification GTPase MnmE 2.22e-05 NA 0.022 NA
7. B Q82XU6 GTPase Der 3.73e-04 NA 2.25e-04 NA
7. B B7IGK8 GTPase Obg 3.59e-03 NA 0.012 NA
7. B B0K3E4 GTPase Der 3.18e-07 NA 2.07e-07 NA
7. B Q5L4W0 tRNA modification GTPase MnmE 1.09e-04 NA 0.002 NA
7. B Q8YN91 tRNA modification GTPase MnmE 4.53e-06 NA 0.003 NA
7. B A8AXP0 tRNA modification GTPase MnmE 2.21e-05 NA 0.008 NA
7. B B3WE80 GTPase Der 2.59e-07 NA 0.021 NA
7. B C1C6U6 GTPase Era 3.06e-12 NA 8.16e-07 NA
7. B A7HZI3 GTPase Der 7.05e-07 NA 5.87e-07 NA
7. B Q2FUQ2 tRNA modification GTPase MnmE 1.93e-05 NA 0.030 NA
7. B Q5BJT6 Large subunit GTPase 1 homolog 1.61e-01 NA 0.011 NA
7. B Q9CLQ1 tRNA modification GTPase MnmE 8.04e-05 NA 0.014 NA
7. B B0CBB0 tRNA modification GTPase MnmE 1.34e-05 NA 2.36e-04 NA
7. B Q8DC75 GTPase Era 4.41e-11 NA 9.45e-06 NA
7. B P0DA90 GTPase Der 4.28e-07 NA 2.55e-05 NA
7. B A6LRP9 GTPase Era 4.28e-12 NA 0.003 NA
7. B Q9KCD4 GTPase Der 4.09e-07 NA 2.28e-04 NA
7. B Q6APY7 tRNA modification GTPase MnmE 9.98e-07 NA 0.004 NA
7. B C4ZYI9 GTPase Era 3.79e-11 NA 0.028 NA
7. B Q6P4W5 Guanine nucleotide-binding protein-like 3 5.27e-02 NA 0.029 NA
7. B B9LBT6 GTPase Der 8.93e-07 NA 3.63e-04 NA
7. B B0TFW3 GTPase Der 2.30e-07 NA 6.41e-07 NA
7. B B5ZBZ8 GTPase Era 5.11e-11 NA 3.03e-04 NA
7. B C0ZCB6 GTPase Der 3.81e-07 NA 0.001 NA
7. B B1AJD1 GTPase Era 3.27e-10 NA 0.002 NA
7. B P0A3C2 GTPase Era 1.12e-12 NA 2.96e-04 NA
7. B Q48V63 GTPase Der 2.70e-07 NA 2.74e-05 NA
7. B Q9PPZ9 GTPase Era 1.21e-10 NA 0.002 NA
7. B Q99ZU0 tRNA modification GTPase MnmE 2.16e-05 NA 0.023 NA
7. B A6TS39 GTPase Der 2.79e-07 NA 1.69e-05 NA
7. B Q8RGM1 GTPase Era 1.57e-11 NA 0.002 NA
7. B Q1JDF1 GTPase Der 2.92e-07 NA 2.80e-05 NA
7. B A6H103 GTPase Der 4.78e-07 NA 0.029 NA