Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54682.1
JCVISYN3A_0249
Uncharacterized protein.
M. mycoides homolog: Q6MTV3.
TIGRfam Classification: 1=Unknown.
Category: Essential.
Statistics
Total GO Annotation: 21
Unique PROST Go: 21
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 20
Unique PROST Homologs: 20
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
Q8S8F8
(GLABRA2 expression modulator) with a FATCAT P-Value: 3.47e-05 and RMSD of 2.78 angstrom. The sequence alignment identity is 17.0%.
Structural alignment shown in left. Query protein AVX54682.1 colored as red in alignment, homolog Q8S8F8 colored as blue.
Query protein AVX54682.1 is also shown in right top, homolog Q8S8F8 showed in right bottom. They are colored based on secondary structures.
AVX54682.1 ----------------------------------------------------------------------------------------MSSKLIAIIIFI 12 Q8S8F8 MEPPKGDTVVKTEVPVKDPSLSVVDSKTKGVEDANTEIALSDEVEIETKGSDSTPVKAPSRTSSGSKKSVHWSPELVSGSQEPDQKAASSSSAGS----- 95 AVX54682.1 VIYLIFLLITFILTYFYQIKNKDFIEFNKKYLNEWNKYKFD--NKNSSL--NEIDFKYQ-L---P---ENEIG-LFQK-ELLISGINQKIKDYKDYF--D 97 Q8S8F8 NPYIAR---SPAETSDASL--KDTMETVKGVLGRWGKRVAEAAKKTESLAGN----TWQHLRTAPSFADAAMGRIAQSTKVFAEGGYEKI--FRQTFETD 184 AVX54682.1 -DDYLVLKKSLSLYQTTSYDFKQV--KLYLTNLHLVI-DDNNQFYK---------YKII----EIK----SCSIC--------VIR-DKN----LLQKGC 163 Q8S8F8 PEEQLL--NSFACYLSTS--AGPVMGVLYISSAKLAYCSDNPLSYKNGDQTEWSYYKVVIPLHQLKAVNPSASIVNPAEKYIQVISVD-NHEFWFM--G- 276 AVX54682.1 VLKTN-DQSLTILGDVFLLVLSIKKLKKEF 192 Q8S8F8 FL--NYDGAVTSLQD-SLQAGALRSV---- 299
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0039663 | membrane fusion involved in viral entry into host cell |
| 5. P | GO:0010482 | regulation of epidermal cell division |
| 5. P | GO:0010026 | trichome differentiation |
| 5. P | GO:0055036 | virion membrane |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0000247 | C-8 sterol isomerase activity |
| 5. P | GO:0005773 | vacuole |
| 5. P | GO:0043093 | FtsZ-dependent cytokinesis |
| 5. P | GO:0006869 | lipid transport |
| 5. P | GO:0009845 | seed germination |
| 5. P | GO:0048765 | root hair cell differentiation |
| 5. P | GO:0090529 | cell septum assembly |
| 5. P | GO:0009793 | embryo development ending in seed dormancy |
| 5. P | GO:0032153 | cell division site |
| 5. P | GO:0098755 | maintenance of seed dormancy by absisic acid |
| 5. P | GO:0006696 | ergosterol biosynthetic process |
| 5. P | GO:0009536 | plastid |
| 5. P | GO:0051567 | histone H3-K9 methylation |
| 5. P | GO:0010029 | regulation of seed germination |
| 5. P | GO:0019031 | viral envelope |
| 5. P | GO:0004045 | aminoacyl-tRNA hydrolase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | P60672 | Envelope protein A28 homolog | NA | 9.34e-04 | NA | NA |
| 5. P | C4K4K3 | Cell division protein ZipA | 2.54e-01 | 4.18e-02 | NA | NA |
| 5. P | O97067 | Probable peptidyl-tRNA hydrolase 2 | 2.19e-01 | 1.91e-02 | NA | NA |
| 5. P | Q9FMW4 | Putative GEM-like protein 8 | 3.67e-04 | 2.29e-06 | NA | NA |
| 5. P | Q9FMW5 | GEM-like protein 7 | 1.82e-04 | 1.47e-03 | NA | NA |
| 5. P | Q55BU8 | Protein erg2 homolog | 3.61e-02 | 3.34e-02 | NA | NA |
| 5. P | Q9M122 | GEM-like protein 2 | 2.17e-04 | 3.58e-05 | NA | NA |
| 5. P | Q9M063 | Putative GEM-like protein 3 | 1.73e-04 | 1.72e-05 | NA | NA |
| 5. P | P75236 | Uncharacterized protein MG364 homolog | 1.11e-01 | 4.86e-02 | NA | NA |
| 5. P | Q06906 | Occlusion-derived virus envelope protein E25 | NA | 2.17e-03 | NA | NA |
| 5. P | O29042 | Uncharacterized protein AF_1226 | 3.41e-02 | 1.02e-03 | NA | NA |
| 5. P | Q58423 | Uncharacterized protein MJ1017 | 2.04e-02 | 6.41e-12 | NA | NA |
| 5. P | Q5UQE3 | Uncharacterized protein R473 | NA | 1.47e-04 | NA | NA |
| 5. P | Q91FJ9 | Uncharacterized protein 325L | NA | 2.12e-02 | NA | NA |
| 5. P | Q8S8F8 | GLABRA2 expression modulator | 3.47e-05 | 3.64e-03 | NA | NA |
| 5. P | Q9FMW6 | GEM-like protein 6 | 3.96e-03 | 1.76e-05 | NA | NA |
| 5. P | Q9SE96 | GEM-like protein 1 | 8.83e-05 | 3.13e-04 | NA | NA |
| 5. P | O67017 | Uncharacterized protein aq_850 | 2.37e-03 | 1.67e-03 | NA | NA |
| 5. P | Q9DHJ5 | Envelope protein A28 homolog | NA | 4.58e-02 | NA | NA |
| 5. P | Q9LYV6 | GEM-like protein 5 | 8.38e-04 | 5.24e-06 | NA | NA |