Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54683.1
JCVISYN3A_0250
Uncharacterized protein.
M. mycoides homolog: Q6MTV2.
TIGRfam Classification: 1=Unknown.
Category: Nonessential.
Statistics
Total GO Annotation: 50
Unique PROST Go: 50
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 48
Unique PROST Homologs: 48
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
P72686
(Phosphate-specific transport system accessory protein PhoU homolog) with a FATCAT P-Value: 1.63e-05 and RMSD of 3.80 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein AVX54683.1 colored as red in alignment, homolog P72686 colored as blue.
Query protein AVX54683.1 is also shown in right top, homolog P72686 showed in right bottom. They are colored based on secondary structures.
AVX54683.1 MN---KKEIFNTD--FFESGLAYI---LTNLDFIQEE--------LEQEKLQTSL----VEKLITD--FEDVEDYETWDLLTNNLIQ---SED-KILEEI 74 P72686 MAASLSQQINNPERSYFEQALKRVEQDVLRMGALVEESFRMSHQALFENRLETPLKIAELEKEI-DRLYRHIE-QECASFLT---LQAPVAQDLRLLSAI 95 AVX54683.1 -QKIKDSTKFNL--LNSYFLAKNL-AIYLKSNSF----LIEQINKLQTNSPDDLSEDKKEEFINNLKQ---EILKNNSEL----YKQNERLFKEI-F--D 156 P72686 MQLVRD-----LERIGDY--AQDLGEIAMKLTRYPPHPCMDEIAAMAWQAQHML--DQSLVCLTQLDPNAGEIVKKMDDVVDDAY---DRLYKTLAFQRD 183 AVX54683.1 KK--VEFKKIYQLLIKETE-FEDF--NYANELLFNMLNNNFKFNNKQDLLKLEVLNNAQSLIDFLTFYESSLFDDEKE 229 P72686 IKGVVEPILLMALVIRHLERMADHATNIAQRV-------SYIVTGKRE------------------------------ 224
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:2000045 | regulation of G1/S transition of mitotic cell cycle |
| 5. P | GO:0006406 | mRNA export from nucleus |
| 5. P | GO:0019441 | tryptophan catabolic process to kynurenine |
| 5. P | GO:0034063 | stress granule assembly |
| 5. P | GO:0061133 | endopeptidase activator activity |
| 5. P | GO:0016233 | telomere capping |
| 5. P | GO:0070187 | shelterin complex |
| 5. P | GO:0051321 | meiotic cell cycle |
| 5. P | GO:0032211 | negative regulation of telomere maintenance via telomerase |
| 5. P | GO:0008537 | proteasome activator complex |
| 5. P | GO:0050868 | negative regulation of T cell activation |
| 5. P | GO:0045936 | negative regulation of phosphate metabolic process |
| 5. P | GO:0045087 | innate immune response |
| 5. P | GO:0000939 | inner kinetochore |
| 5. P | GO:2000186 | negative regulation of phosphate transmembrane transport |
| 5. P | GO:0000446 | nucleoplasmic THO complex |
| 5. P | GO:0050797 | thymidylate synthase (FAD) activity |
| 5. P | GO:0042729 | DASH complex |
| 5. P | GO:0140445 | chromosome, telomeric repeat region |
| 5. P | GO:0010950 | positive regulation of endopeptidase activity |
| 5. P | GO:0000779 | condensed chromosome, centromeric region |
| 5. P | GO:0006235 | dTTP biosynthetic process |
| 5. P | GO:0000776 | kinetochore |
| 5. P | GO:0050660 | flavin adenine dinucleotide binding |
| 5. P | GO:0051301 | cell division |
| 5. P | GO:0030643 | cellular phosphate ion homeostasis |
| 5. P | GO:0050728 | negative regulation of inflammatory response |
| 5. P | GO:0000070 | mitotic sister chromatid segregation |
| 5. P | GO:0000818 | nuclear MIS12/MIND complex |
| 5. P | GO:0042981 | regulation of apoptotic process |
| 5. P | GO:0031617 | NMS complex |
| 5. P | GO:0006817 | phosphate ion transport |
| 5. P | GO:0000444 | MIS12/MIND type complex |
| 5. P | GO:0000137 | Golgi cis cisterna |
| 5. P | GO:0039686 | bidirectional double-stranded viral DNA replication |
| 5. P | GO:0000723 | telomere maintenance |
| 5. P | GO:0032259 | methylation |
| 5. P | GO:0035267 | NuA4 histone acetyltransferase complex |
| 5. P | GO:0032200 | telomere organization |
| 5. P | GO:0000321 | re-entry into mitotic cell cycle after pheromone arrest |
| 5. P | GO:0043027 | cysteine-type endopeptidase inhibitor activity involved in apoptotic process |
| 5. P | GO:0006231 | dTMP biosynthetic process |
| 5. P | GO:0032007 | negative regulation of TOR signaling |
| 5. P | GO:0000445 | THO complex part of transcription export complex |
| 5. P | GO:0061136 | regulation of proteasomal protein catabolic process |
| 5. P | GO:0010207 | photosystem II assembly |
| 5. P | GO:0005876 | spindle microtubule |
| 5. P | GO:0004833 | tryptophan 2,3-dioxygenase activity |
| 5. P | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 5. P | GO:0031160 | spore wall |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | Q6FJV4 | Chromatin modification-related protein EAF5 | 1.06e-04 | 6.94e-08 | NA | NA |
| 5. P | C3PH05 | Flavin-dependent thymidylate synthase | 2.10e-02 | 3.96e-02 | NA | NA |
| 5. P | Q1ECV8 | Tumor necrosis factor, alpha-induced protein 8-like protein 2 A | 1.09e-03 | 3.66e-05 | NA | NA |
| 5. P | P72686 | Phosphate-specific transport system accessory protein PhoU homolog | 1.63e-05 | 4.94e-02 | NA | NA |
| 5. P | O13852 | Protection of telomeres protein poz1 | 1.12e-03 | 1.58e-02 | NA | NA |
| 5. P | B1L944 | Flavin-dependent thymidylate synthase | 1.04e-01 | 8.76e-06 | NA | NA |
| 5. P | Q7V1W1 | Protein Thf1 | 3.60e-03 | 8.90e-03 | NA | NA |
| 5. P | Q01808 | Nucleoprotein | NA | 1.15e-02 | NA | NA |
| 5. P | A6LP90 | Flavin-dependent thymidylate synthase | 8.78e-02 | 1.16e-02 | NA | NA |
| 5. P | B7IF44 | Flavin-dependent thymidylate synthase | 8.67e-02 | 1.03e-03 | NA | NA |
| 5. P | Q6CSR8 | Inner kinetochore subunit NKP2 | 4.90e-03 | 1.41e-02 | NA | NA |
| 5. P | A9X192 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 1.27e-03 | 2.38e-02 | NA | NA |
| 5. P | B0KWC3 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 6.83e-04 | 4.70e-03 | NA | NA |
| 5. P | Q7T364 | Tumor necrosis factor, alpha-induced protein 8-like protein 2 B | 1.14e-03 | 2.30e-05 | NA | NA |
| 5. P | Q6P7I6 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 1.05e-03 | 3.62e-05 | NA | NA |
| 5. P | Q6BHU0 | DASH complex subunit SPC19 | 3.45e-03 | 2.51e-02 | NA | NA |
| 5. P | Q9Z994 | Uncharacterized protein CPn_0087/CP_0687/CPj0087/CpB0087 | 4.48e-04 | 5.15e-04 | NA | NA |
| 5. P | P47649 | Uncharacterized protein MG409 | 4.48e-06 | 1.97e-04 | NA | NA |
| 5. P | Q5ZJU8 | Tumor necrosis factor alpha-induced protein 8-like protein 1 | 8.98e-04 | 1.42e-04 | NA | NA |
| 5. P | Q5UP85 | Uncharacterized protein R13 | NA | 8.04e-05 | NA | NA |
| 5. P | P46671 | Factor arrest protein 3 | 4.29e-04 | 4.38e-04 | NA | NA |
| 5. P | B9KBK3 | Flavin-dependent thymidylate synthase | 6.65e-02 | 1.65e-06 | NA | NA |
| 5. P | Q12493 | Inner kinetochore subunit NKP1 | 2.78e-03 | 7.25e-03 | NA | NA |
| 5. P | Q9V0F7 | UPF0128 protein PYRAB08320 | 3.07e-01 | 9.95e-03 | NA | NA |
| 5. P | Q12143 | Kinetochore-associated protein NSL1 | 3.65e-04 | 9.95e-03 | NA | NA |
| 5. P | Q6GQ44 | Tumor necrosis factor alpha-induced protein 8 | 6.57e-04 | 3.08e-05 | NA | NA |
| 5. P | Q9PR96 | Uncharacterized protein UU049 | 1.18e-01 | 6.35e-04 | NA | NA |
| 5. P | Q8U0U4 | UPF0128 protein PF1488 | 2.19e-01 | 1.51e-02 | NA | NA |
| 5. P | P75187 | Uncharacterized protein MG409 homolog | 6.27e-06 | 3.25e-05 | NA | NA |
| 5. P | O13539 | THO complex subunit THP2 | 2.03e-04 | 9.19e-04 | NA | NA |
| 5. P | B3STP6 | Spore wall protein 12 | 2.76e-04 | 1.36e-03 | NA | NA |
| 5. P | O14106 | Protein rgg8 | 2.09e-02 | 4.25e-02 | NA | NA |
| 5. P | Q9P6M3 | Kinetochore protein mis14 | 3.48e-03 | 4.88e-05 | NA | NA |
| 5. P | Q967U1 | Proteasome activator 28 | 3.02e-03 | 4.61e-02 | NA | NA |
| 5. P | Q5BKH4 | Tumor necrosis factor alpha-induced protein 8-like protein 2 | 1.02e-03 | 2.33e-02 | NA | NA |
| 5. P | A3PYB1 | Flavin-dependent thymidylate synthase | 1.89e-02 | 2.79e-02 | NA | NA |
| 5. P | Q9WYT0 | Flavin-dependent thymidylate synthase | 1.29e-01 | 9.05e-06 | NA | NA |
| 5. P | O66958 | UPF0128 protein aq_756 | 3.53e-01 | 5.78e-03 | NA | NA |
| 5. P | Q5UQ29 | Uncharacterized protein R212 | NA | 1.30e-02 | NA | NA |
| 5. P | Q58266 | Uncharacterized protein MJ0856 | 1.09e-03 | 2.17e-02 | NA | NA |
| 5. P | Q10012 | Uncharacterized protein T19C3.6 | 5.44e-04 | 9.24e-03 | NA | NA |
| 5. P | Q5UQA1 | Uncharacterized protein R535 | NA | 8.34e-03 | NA | NA |
| 5. P | P33859 | Protein C1 | NA | 2.49e-02 | NA | NA |
| 5. P | A5IJX2 | Flavin-dependent thymidylate synthase | 1.05e-01 | 7.25e-06 | NA | NA |
| 5. P | Q4US93 | Tryptophan 2,3-dioxygenase-like protein | 1.85e-03 | 4.61e-02 | NA | NA |
| 5. P | Q8PBB3 | Tryptophan 2,3-dioxygenase-like protein | 1.86e-03 | 4.61e-02 | NA | NA |
| 5. P | P13342 | DNA helicase assembly protein | NA | 3.33e-03 | NA | NA |
| 5. P | Q3V4V3 | Uncharacterized protein ORF220 | NA | 1.95e-02 | NA | NA |