Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54684.1
JCVISYN3A_0253
Transcription elongation factor.
M. mycoides homolog: Q6MTU9.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 23
Unique PROST Go: 14
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 418
Unique PROST Homologs: 50
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
B4UCU9
(Transcription elongation factor GreA) with a FATCAT P-Value: 0 and RMSD of 1.26 angstrom. The sequence alignment identity is 39.2%.
Structural alignment shown in left. Query protein AVX54684.1 colored as red in alignment, homolog B4UCU9 colored as blue.
Query protein AVX54684.1 is also shown in right top, homolog B4UCU9 showed in right bottom. They are colored based on secondary structures.
AVX54684.1 MSKEIILTQEGLEELKAELKYLLEVVRPKVIEELVEARNQGDLSENADYDAARNRQAEVEARIKEVETLINRAKVIDDSKTHSTGE-VKIGSTVQFVSSL 99 B4UCU9 MQR-VPMTKGGLVRLKDELRRLKSVERPKIVKEIAEARAHGDLSENAEYHAAKEKQSHIEGRIAQVEHWIASAEVIDVTK-HA-GDRVVFGATV----SL 93 AVX54684.1 -D----NKLKEIKIVGAIEADPFSNLISNESPIAKAIIGKKVNTTVEIKDIS--KPYKITIKSIK----------- 157 B4UCU9 EDAESGDQVT-YRIVGELEADLKQGKISVTSPIARALIGRSEGDTVVVRSPGGEKEYE--IQSVAFVEEELPTESE 166
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0003677 | DNA binding |
| 1. PBF | GO:0070063 | RNA polymerase binding |
| 1. PBF | GO:0006354 | DNA-templated transcription, elongation |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0032784 | regulation of DNA-templated transcription, elongation |
| 4. PB | GO:0001108 | bacterial-type RNA polymerase holo enzyme binding |
| 4. PB | GO:0005886 | plasma membrane |
| 4. PB | GO:0031439 | positive regulation of mRNA cleavage |
| 4. PB | GO:0005737 | cytoplasm |
| 5. P | GO:0006353 | DNA-templated transcription, termination |
| 5. P | GO:0046983 | protein dimerization activity |
| 5. P | GO:0031564 | transcription antitermination |
| 5. P | GO:0003681 | bent DNA binding |
| 5. P | GO:0016884 | carbon-nitrogen ligase activity, with glutamine as amido-N-donor |
| 5. P | GO:0016458 | obsolete gene silencing |
| 5. P | GO:0099016 | DNA end degradation evasion by virus |
| 5. P | GO:1900232 | negative regulation of single-species biofilm formation on inanimate substrate |
| 5. P | GO:0032993 | protein-DNA complex |
| 5. P | GO:0003680 | minor groove of adenine-thymine-rich DNA binding |
| 5. P | GO:0009295 | nucleoid |
| 5. P | GO:0001217 | DNA-binding transcription repressor activity |
| 5. P | GO:0042262 | DNA protection |
| 5. P | GO:0006355 | regulation of transcription, DNA-templated |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0070063 | RNA polymerase binding |
| GO:0003677 | DNA binding |
| GO:0032784 | regulation of DNA-templated transcription, elongation |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P99156 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8781 |
| 1. PBF | B9J753 | Transcription elongation factor GreA | 0.00e+00 | 2.99e-54 | 1.61e-28 | 0.8919 |
| 1. PBF | A5FWZ7 | Transcription elongation factor GreA | 0.00e+00 | 2.28e-52 | 3.83e-29 | 0.9132 |
| 1. PBF | B8ZLB8 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8883 |
| 1. PBF | Q730F5 | Transcription elongation factor GreA | 0.00e+00 | 5.89e-57 | 6.61e-31 | 0.87 |
| 1. PBF | Q5ZZL8 | Transcription elongation factor GreA | 0.00e+00 | 1.01e-54 | 5.91e-30 | 0.8218 |
| 1. PBF | A8MLU4 | Transcription elongation factor GreA | 0.00e+00 | 3.10e-53 | 8.09e-29 | 0.9291 |
| 1. PBF | C1CSD7 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8778 |
| 1. PBF | A2RIW3 | Transcription elongation factor GreA | 0.00e+00 | 3.14e-52 | 3.74e-36 | 0.8781 |
| 1. PBF | B5E681 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8973 |
| 1. PBF | P47524 | Transcription elongation factor GreA | 0.00e+00 | 7.62e-57 | 1.46e-35 | 0.9468 |
| 1. PBF | P57464 | Transcription elongation factor GreA | 0.00e+00 | 1.79e-43 | 5.13e-29 | 0.9314 |
| 1. PBF | A6Q9U9 | Transcription elongation factor GreA | 0.00e+00 | 8.22e-44 | 3.80e-22 | 0.8203 |
| 1. PBF | B3ESB4 | Transcription elongation factor GreA | 0.00e+00 | 9.61e-57 | 2.72e-20 | 0.7617 |
| 1. PBF | P0A6W8 | Transcription elongation factor GreA | 0.00e+00 | 2.38e-51 | 1.18e-28 | 0.9563 |
| 1. PBF | Q4UJS8 | Transcription elongation factor GreA | 0.00e+00 | 3.61e-48 | 1.02e-29 | 0.9437 |
| 1. PBF | A7GJB4 | Transcription elongation factor GreA | 0.00e+00 | 1.08e-51 | 2.07e-26 | 0.8978 |
| 1. PBF | Q181F4 | Transcription elongation factor GreA | 0.00e+00 | 8.33e-51 | 7.53e-27 | 0.9122 |
| 1. PBF | Q8DSP7 | Transcription elongation factor GreA | 0.00e+00 | 1.40e-54 | 1.36e-24 | 0.8689 |
| 1. PBF | P64277 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-51 | 1.10e-29 | 0.8884 |
| 1. PBF | Q1LSK1 | Transcription elongation factor GreA | 0.00e+00 | 2.46e-48 | 2.34e-29 | 0.9402 |
| 1. PBF | Q4A921 | Transcription elongation factor GreA | 0.00e+00 | 7.43e-55 | 5.85e-30 | 0.8951 |
| 1. PBF | A1WXX6 | Transcription elongation factor GreA | 0.00e+00 | 8.86e-50 | 2.21e-25 | 0.9309 |
| 1. PBF | P64285 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8695 |
| 1. PBF | Q030Z7 | Transcription elongation factor GreA | 0.00e+00 | 8.20e-53 | 6.53e-35 | 0.8762 |
| 1. PBF | A1VN58 | Transcription elongation factor GreA | 0.00e+00 | 3.42e-45 | 1.56e-26 | 0.9457 |
| 1. PBF | C1AM72 | Transcription elongation factor GreA | 1.79e-14 | 1.21e-49 | 6.78e-13 | 0.7534 |
| 1. PBF | A9R594 | Transcription elongation factor GreA | 0.00e+00 | 6.85e-45 | 1.66e-30 | 0.9538 |
| 1. PBF | Q9JTT4 | Transcription elongation factor GreA | 0.00e+00 | 8.07e-46 | 3.26e-27 | 0.898 |
| 1. PBF | Q0SQ85 | Transcription elongation factor GreA | 0.00e+00 | 7.37e-51 | 1.36e-27 | 0.8762 |
| 1. PBF | A5IAV2 | Transcription elongation factor GreA | 0.00e+00 | 3.20e-49 | 2.18e-27 | 0.9511 |
| 1. PBF | Q8PJ11 | Transcription elongation factor GreB | 0.00e+00 | 6.80e-42 | 1.82e-15 | 0.8802 |
| 1. PBF | Q8DP42 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8796 |
| 1. PBF | B8ZT53 | Transcription elongation factor GreA | 1.40e-14 | 2.33e-49 | 4.99e-12 | 0.7614 |
| 1. PBF | B5ZBB2 | Transcription elongation factor GreA | 0.00e+00 | 2.64e-54 | 7.37e-29 | 0.8265 |
| 1. PBF | B6JM90 | Transcription elongation factor GreA | 0.00e+00 | 3.95e-40 | 7.14e-26 | 0.8216 |
| 1. PBF | Q725M4 | Transcription elongation factor GreA | 0.00e+00 | 8.57e-36 | 7.50e-22 | 0.8193 |
| 1. PBF | P64276 | Transcription elongation factor GreA | 0.00e+00 | 2.71e-39 | 4.07e-26 | 0.8273 |
| 1. PBF | Q8KCH5 | Transcription elongation factor GreA | 0.00e+00 | 2.83e-55 | 4.92e-23 | 0.7961 |
| 1. PBF | Q03YY4 | Transcription elongation factor GreA | 0.00e+00 | 2.98e-56 | 6.01e-29 | 0.9141 |
| 1. PBF | Q6AL57 | Transcription elongation factor GreA | 0.00e+00 | 8.24e-45 | 1.18e-11 | 0.8503 |
| 1. PBF | P64274 | Transcription elongation factor GreB | 0.00e+00 | 1.36e-41 | 2.22e-16 | 0.839 |
| 1. PBF | B2S1W7 | Transcription elongation factor GreA | 0.00e+00 | 4.54e-43 | 1.23e-10 | 0.7759 |
| 1. PBF | A1UTG0 | Transcription elongation factor GreA | 0.00e+00 | 9.58e-55 | 1.35e-26 | 0.8954 |
| 1. PBF | Q5WHM1 | Transcription elongation factor GreA | 0.00e+00 | 6.11e-56 | 5.41e-28 | 0.872 |
| 1. PBF | P64281 | Transcription elongation factor GreA | 0.00e+00 | 2.90e-51 | 1.13e-28 | 0.9608 |
| 1. PBF | C6BRV2 | Transcription elongation factor GreA | 0.00e+00 | 1.97e-42 | 1.88e-18 | 0.8146 |
| 1. PBF | Q4A759 | Transcription elongation factor GreA | 0.00e+00 | 3.75e-54 | 6.04e-30 | 0.8946 |
| 1. PBF | Q5ZS95 | Transcription elongation factor GreA | 0.00e+00 | 8.18e-49 | 1.83e-28 | 0.9497 |
| 1. PBF | C4XLU8 | Transcription elongation factor GreA | 0.00e+00 | 3.63e-38 | 1.07e-15 | 0.7919 |
| 1. PBF | P64287 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8734 |
| 1. PBF | B0TYL2 | Transcription elongation factor GreA | 0.00e+00 | 2.22e-52 | 8.30e-25 | 0.9458 |
| 1. PBF | Q607B0 | Transcription elongation factor GreA | 0.00e+00 | 6.10e-47 | 4.92e-27 | 0.9393 |
| 1. PBF | P0A6W6 | Transcription elongation factor GreA | 0.00e+00 | 2.38e-51 | 1.18e-28 | 0.9605 |
| 1. PBF | Q2A2C7 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9497 |
| 1. PBF | B3EE12 | Transcription elongation factor GreA | 0.00e+00 | 9.69e-56 | 1.07e-23 | 0.7808 |
| 1. PBF | Q97EB6 | Transcription elongation factor GreA | 0.00e+00 | 3.27e-50 | 2.41e-27 | 0.8697 |
| 1. PBF | Q20ZR6 | Transcription elongation factor GreA | 0.00e+00 | 5.96e-47 | 1.65e-27 | 0.9078 |
| 1. PBF | P64273 | Transcription elongation factor GreB | 1.11e-16 | 1.36e-41 | 2.22e-16 | 0.8311 |
| 1. PBF | B1KTC2 | Transcription elongation factor GreA | 0.00e+00 | 1.08e-51 | 2.07e-26 | 0.9034 |
| 1. PBF | Q7MPX6 | Transcription elongation factor GreB | 0.00e+00 | 9.29e-40 | 7.82e-13 | 0.8186 |
| 1. PBF | P64275 | Transcription elongation factor GreA | 0.00e+00 | 2.71e-39 | 4.07e-26 | 0.8255 |
| 1. PBF | A1AS07 | Transcription elongation factor GreA | 0.00e+00 | 4.28e-58 | 3.65e-32 | 0.8946 |
| 1. PBF | B2S6W5 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9153 |
| 1. PBF | A7FZA6 | Transcription elongation factor GreA | 0.00e+00 | 3.20e-51 | 2.79e-25 | 0.8867 |
| 1. PBF | Q9ADK2 | Transcription elongation factor GreA | 1.31e-13 | 1.29e-48 | 6.26e-10 | 0.7513 |
| 1. PBF | Q634G5 | Transcription elongation factor GreA | 0.00e+00 | 5.74e-57 | 3.96e-30 | 0.7859 |
| 1. PBF | B2I844 | Transcription elongation factor GreA | 0.00e+00 | 1.83e-45 | 9.71e-26 | 0.8456 |
| 1. PBF | Q5HNU0 | Transcription elongation factor GreA | 0.00e+00 | 2.14e-55 | 2.83e-27 | 0.8731 |
| 1. PBF | A5ITD5 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8817 |
| 1. PBF | B9KLF5 | Transcription elongation factor GreA | 0.00e+00 | 2.23e-46 | 7.45e-29 | 0.8727 |
| 1. PBF | A1AXD2 | Transcription elongation factor GreA | 0.00e+00 | 2.13e-48 | 6.44e-26 | 0.9459 |
| 1. PBF | B9E6Y8 | Transcription elongation factor GreA | 0.00e+00 | 7.02e-51 | 1.99e-37 | 0.8686 |
| 1. PBF | Q89DR1 | Transcription elongation factor GreA | 0.00e+00 | 6.94e-52 | 6.54e-28 | 0.9093 |
| 1. PBF | A6WZH2 | Transcription elongation factor GreA | 0.00e+00 | 1.42e-51 | 3.76e-28 | 0.9139 |
| 1. PBF | B8GNX7 | Transcription elongation factor GreA | 0.00e+00 | 2.46e-48 | 7.99e-26 | 0.9403 |
| 1. PBF | Q8VQD7 | Transcription inhibitor protein Gfh1 | 1.22e-15 | 1.83e-43 | 2.34e-10 | 0.7751 |
| 1. PBF | A4SFN0 | Transcription elongation factor GreA | 0.00e+00 | 8.41e-53 | 3.89e-26 | 0.781 |
| 1. PBF | C1C8A8 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8736 |
| 1. PBF | Q9PEC0 | Transcription elongation factor GreA | 0.00e+00 | 1.48e-45 | 2.51e-26 | 0.8437 |
| 1. PBF | Q9KDD7 | Transcription elongation factor GreA | 0.00e+00 | 7.05e-57 | 6.86e-28 | 0.8855 |
| 1. PBF | P64284 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.879 |
| 1. PBF | Q7VM42 | Transcription elongation factor GreB | 0.00e+00 | 2.84e-40 | 2.87e-22 | 0.9034 |
| 1. PBF | A6LPL4 | Transcription elongation factor GreA | 0.00e+00 | 2.50e-50 | 9.39e-28 | 0.855 |
| 1. PBF | P0DB46 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8769 |
| 1. PBF | Q883T5 | Transcription elongation factor GreB | 0.00e+00 | 5.83e-44 | 7.29e-14 | 0.8517 |
| 1. PBF | A7H585 | Transcription elongation factor GreA | 0.00e+00 | 1.52e-43 | 4.58e-24 | 0.7858 |
| 1. PBF | A5WDP3 | Transcription elongation factor GreA | 0.00e+00 | 3.27e-49 | 1.83e-24 | 0.8861 |
| 1. PBF | B8DE15 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-51 | 1.10e-29 | 0.8863 |
| 1. PBF | Q2YT68 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.882 |
| 1. PBF | B3CTQ6 | Transcription elongation factor GreA | 0.00e+00 | 4.95e-45 | 3.61e-20 | 0.9294 |
| 1. PBF | Q2K600 | Transcription elongation factor GreA | 0.00e+00 | 6.95e-56 | 5.22e-29 | 0.8917 |
| 1. PBF | B9L822 | Transcription elongation factor GreA | 0.00e+00 | 2.24e-43 | 2.02e-30 | 0.7937 |
| 1. PBF | Q5X1R6 | Transcription elongation factor GreA | 0.00e+00 | 8.18e-49 | 1.83e-28 | 0.9496 |
| 1. PBF | Q7M9N2 | Transcription elongation factor GreA | 0.00e+00 | 1.41e-42 | 1.18e-24 | 0.8043 |
| 1. PBF | A1AZ46 | Transcription elongation factor GreA | 0.00e+00 | 2.17e-49 | 4.00e-30 | 0.8829 |
| 1. PBF | A5ILE7 | Transcription elongation factor GreA | 0.00e+00 | 3.61e-49 | 7.45e-24 | 0.8298 |
| 1. PBF | Q6G2M7 | Transcription elongation factor GreA | 0.00e+00 | 4.83e-55 | 2.81e-25 | 0.8877 |
| 1. PBF | A0LC15 | Transcription elongation factor GreA | 0.00e+00 | 3.57e-54 | 3.03e-20 | 0.9157 |
| 1. PBF | A5U1C6 | Transcription elongation factor GreA | 2.42e-14 | 1.21e-49 | 6.78e-13 | 0.7544 |
| 1. PBF | B3QJZ1 | Transcription elongation factor GreA | 0.00e+00 | 3.20e-49 | 5.39e-29 | 0.9031 |
| 1. PBF | Q0B0N4 | Transcription elongation factor GreA | 0.00e+00 | 7.25e-55 | 2.75e-22 | 0.7986 |
| 1. PBF | B8IBN8 | Transcription elongation factor GreA | 0.00e+00 | 7.72e-47 | 1.38e-29 | 0.8888 |
| 1. PBF | O68546 | Transcription elongation factor GreA | 0.00e+00 | 4.06e-56 | 1.14e-27 | 0.9037 |
| 1. PBF | Q87LZ2 | Transcription elongation factor GreA | 0.00e+00 | 6.41e-48 | 3.96e-24 | 0.9198 |
| 1. PBF | A9BFC0 | Transcription elongation factor GreA | 0.00e+00 | 1.35e-55 | 8.16e-22 | 0.8278 |
| 1. PBF | P56894 | Transcription elongation factor GreA | 0.00e+00 | 9.10e-55 | 6.88e-30 | 0.8865 |
| 1. PBF | A1WH11 | Transcription elongation factor GreA | 0.00e+00 | 2.39e-46 | 8.16e-33 | 0.9034 |
| 1. PBF | A8GUN3 | Transcription elongation factor GreA | 0.00e+00 | 1.16e-47 | 4.05e-29 | 0.9344 |
| 1. PBF | Q17WJ3 | Transcription elongation factor GreA | 0.00e+00 | 5.17e-41 | 3.88e-25 | 0.8369 |
| 1. PBF | A0LK20 | Transcription elongation factor GreA | 0.00e+00 | 3.21e-55 | 9.28e-22 | 0.8727 |
| 1. PBF | P0A6W7 | Transcription elongation factor GreA | 0.00e+00 | 2.38e-51 | 1.18e-28 | 0.9617 |
| 1. PBF | A7Z726 | Transcription elongation factor GreA | 0.00e+00 | 2.70e-54 | 3.10e-30 | 0.8664 |
| 1. PBF | Q2SSM5 | Transcription elongation factor GreA | 0.00e+00 | 8.65e-79 | 2.55e-97 | 0.9964 |
| 1. PBF | A8Z4E8 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8836 |
| 1. PBF | B2USW4 | Transcription elongation factor GreA | 0.00e+00 | 9.41e-41 | 5.00e-26 | 0.8388 |
| 1. PBF | C1CFA2 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8932 |
| 1. PBF | A5IYH4 | Transcription elongation factor GreA | 0.00e+00 | 3.99e-47 | 5.19e-29 | 0.8029 |
| 1. PBF | P0DB47 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8763 |
| 1. PBF | A2RGA4 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8811 |
| 1. PBF | Q2FGB6 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8735 |
| 1. PBF | B3PUK3 | Transcription elongation factor GreA | 0.00e+00 | 2.83e-55 | 7.87e-29 | 0.9059 |
| 1. PBF | A8HR94 | Transcription elongation factor GreA | 0.00e+00 | 1.82e-47 | 2.42e-26 | 0.9287 |
| 1. PBF | P27640 | Transcription elongation factor GreA | 0.00e+00 | 9.07e-46 | 3.85e-29 | 0.9345 |
| 1. PBF | P64272 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9186 |
| 1. PBF | Q6FZ57 | Transcription elongation factor GreA | 0.00e+00 | 3.34e-53 | 5.88e-26 | 0.9101 |
| 1. PBF | Q5HWI0 | Transcription elongation factor GreA | 0.00e+00 | 8.49e-47 | 6.98e-24 | 0.7885 |
| 1. PBF | B4RH54 | Transcription elongation factor GreA | 0.00e+00 | 4.32e-57 | 5.08e-29 | 0.9365 |
| 1. PBF | Q72JT8 | Transcription inhibitor protein Gfh1 | 8.88e-16 | 3.66e-45 | 2.30e-10 | 0.7789 |
| 1. PBF | Q5HFF2 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8795 |
| 1. PBF | Q4FPG2 | Transcription elongation factor GreA | 0.00e+00 | 2.22e-50 | 2.97e-29 | 0.9062 |
| 1. PBF | Q5NFC6 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9493 |
| 1. PBF | A6U8X4 | Transcription elongation factor GreA | 0.00e+00 | 9.10e-55 | 6.88e-30 | 0.8855 |
| 1. PBF | B8DJL8 | Transcription elongation factor GreA | 0.00e+00 | 1.66e-41 | 4.57e-18 | 0.8343 |
| 1. PBF | B3E3H5 | Transcription elongation factor GreA | 0.00e+00 | 3.30e-58 | 6.88e-30 | 0.8532 |
| 1. PBF | Q8ZLJ2 | Transcription elongation factor GreB | 0.00e+00 | 2.51e-43 | 7.62e-17 | 0.8548 |
| 1. PBF | Q9KNL7 | Transcription elongation factor GreB | 0.00e+00 | 5.91e-41 | 3.06e-13 | 0.8857 |
| 1. PBF | Q8Z217 | Transcription elongation factor GreB | 0.00e+00 | 1.39e-43 | 2.65e-16 | 0.8554 |
| 1. PBF | Q5M638 | Transcription elongation factor GreA | 0.00e+00 | 6.23e-53 | 1.40e-26 | 0.893 |
| 1. PBF | C3P968 | Transcription elongation factor GreA | 0.00e+00 | 5.74e-57 | 3.96e-30 | 0.7916 |
| 1. PBF | Q8E3U5 | Transcription elongation factor GreA | 0.00e+00 | 5.84e-52 | 6.01e-25 | 0.8768 |
| 1. PBF | P46808 | Transcription elongation factor GreA | 3.39e-14 | 2.33e-49 | 4.99e-12 | 0.7452 |
| 1. PBF | P57801 | Transcription elongation factor GreA | 0.00e+00 | 1.20e-50 | 5.78e-26 | 0.9556 |
| 1. PBF | Q8UDE5 | Transcription elongation factor GreA | 0.00e+00 | 1.71e-54 | 2.86e-30 | 0.8917 |
| 1. PBF | Q87WP5 | Transcription elongation factor GreA | 0.00e+00 | 3.12e-45 | 3.29e-23 | 0.9289 |
| 1. PBF | B9DY72 | Transcription elongation factor GreA | 0.00e+00 | 6.21e-51 | 1.14e-26 | 0.8757 |
| 1. PBF | A7X319 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8725 |
| 1. PBF | Q2YRN8 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.914 |
| 1. PBF | A3DJG6 | Transcription elongation factor GreA | 0.00e+00 | 4.59e-55 | 3.19e-29 | 0.9356 |
| 1. PBF | Q1GUG9 | Transcription elongation factor GreA | 0.00e+00 | 1.82e-47 | 1.47e-24 | 0.8019 |
| 1. PBF | B1MKJ7 | Transcription elongation factor GreA | 1.90e-14 | 5.43e-49 | 2.89e-13 | 0.7553 |
| 1. PBF | Q817Z6 | Transcription elongation factor GreA | 0.00e+00 | 4.43e-57 | 3.08e-30 | 0.8503 |
| 1. PBF | Q5M1J6 | Transcription elongation factor GreA | 0.00e+00 | 6.23e-53 | 1.40e-26 | 0.8948 |
| 1. PBF | Q0A765 | Transcription elongation factor GreA | 0.00e+00 | 5.32e-50 | 2.08e-29 | 0.9492 |
| 1. PBF | Q2LR03 | Transcription elongation factor GreA | 0.00e+00 | 1.26e-42 | 4.48e-18 | 0.8481 |
| 1. PBF | Q9JYU3 | Transcription elongation factor GreA | 0.00e+00 | 5.69e-48 | 8.72e-27 | 0.897 |
| 1. PBF | Q71ZH4 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-51 | 1.10e-29 | 0.8989 |
| 1. PBF | B9IYE4 | Transcription elongation factor GreA | 0.00e+00 | 5.89e-57 | 6.61e-31 | 0.8694 |
| 1. PBF | A1BHJ3 | Transcription elongation factor GreA | 0.00e+00 | 6.70e-54 | 1.20e-20 | 0.7938 |
| 1. PBF | B0SZ84 | Transcription elongation factor GreA | 0.00e+00 | 3.08e-57 | 1.02e-27 | 0.9319 |
| 1. PBF | Q3SPT8 | Transcription elongation factor GreA | 0.00e+00 | 1.06e-50 | 1.98e-27 | 0.9234 |
| 1. PBF | B2TI25 | Transcription elongation factor GreA | 0.00e+00 | 8.97e-51 | 6.66e-24 | 0.8582 |
| 1. PBF | A0AIU5 | Transcription elongation factor GreA | 0.00e+00 | 6.68e-51 | 3.51e-30 | 0.8893 |
| 1. PBF | A5ER96 | Transcription elongation factor GreA | 0.00e+00 | 2.22e-50 | 2.15e-29 | 0.9184 |
| 1. PBF | Q8EPT6 | Transcription elongation factor GreA | 0.00e+00 | 1.65e-51 | 5.35e-28 | 0.8199 |
| 1. PBF | Q9A4I3 | Transcription elongation factor GreA | 0.00e+00 | 5.48e-55 | 1.54e-27 | 0.9294 |
| 1. PBF | Q8CSB3 | Transcription elongation factor GreA | 0.00e+00 | 2.14e-55 | 2.83e-27 | 0.8817 |
| 1. PBF | Q6N2H8 | Transcription elongation factor GreA | 0.00e+00 | 3.20e-49 | 5.39e-29 | 0.9021 |
| 1. PBF | C1CLL5 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8786 |
| 1. PBF | Q5KWV4 | Transcription elongation factor GreA | 0.00e+00 | 2.46e-48 | 2.02e-30 | 0.8591 |
| 1. PBF | P57802 | Transcription elongation factor GreB | 0.00e+00 | 7.51e-39 | 1.92e-18 | 0.8918 |
| 1. PBF | B9LBX1 | Transcription elongation factor GreA | 0.00e+00 | 4.86e-53 | 7.06e-30 | 0.9126 |
| 1. PBF | Q98Q16 | Transcription elongation factor GreA | 0.00e+00 | 5.93e-60 | 4.69e-31 | 0.8382 |
| 1. PBF | B0S216 | Transcription elongation factor GreA | 0.00e+00 | 5.96e-56 | 1.22e-31 | 0.9129 |
| 1. PBF | A8FK75 | Transcription elongation factor GreA | 0.00e+00 | 8.49e-47 | 6.98e-24 | 0.785 |
| 1. PBF | Q8XHL7 | Transcription elongation factor GreA | 0.00e+00 | 7.37e-51 | 1.36e-27 | 0.8882 |
| 1. PBF | Q2RQB1 | Transcription elongation factor GreA | 0.00e+00 | 9.00e-49 | 1.11e-34 | 0.8362 |
| 1. PBF | Q87EB7 | Transcription elongation factor GreA | 0.00e+00 | 1.83e-45 | 9.71e-26 | 0.8481 |
| 1. PBF | A7NFC5 | Transcription elongation factor GreA | 0.00e+00 | 3.98e-50 | 5.57e-26 | 0.9135 |
| 1. PBF | Q8K9G6 | Transcription elongation factor GreA | 0.00e+00 | 2.08e-46 | 8.03e-28 | 0.9569 |
| 1. PBF | P43882 | Transcription elongation factor GreB | 0.00e+00 | 2.38e-40 | 9.73e-18 | 0.8948 |
| 1. PBF | P64282 | Transcription elongation factor GreA | 0.00e+00 | 2.90e-51 | 1.13e-28 | 0.9607 |
| 1. PBF | Q03MH4 | Transcription elongation factor GreA | 0.00e+00 | 2.92e-52 | 9.00e-27 | 0.8966 |
| 1. PBF | A5UPG5 | Transcription elongation factor GreA | 0.00e+00 | 2.70e-49 | 1.10e-24 | 0.9085 |
| 1. PBF | Q88DU7 | Transcription elongation factor GreA | 0.00e+00 | 3.61e-50 | 2.53e-22 | 0.9393 |
| 1. PBF | Q11GG5 | Transcription elongation factor GreA | 0.00e+00 | 7.41e-54 | 2.87e-28 | 0.9151 |
| 1. PBF | Q9PQI7 | Transcription elongation factor GreA | 0.00e+00 | 1.95e-54 | 6.83e-29 | 0.8285 |
| 1. PBF | C0REE0 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9128 |
| 1. PBF | Q7NBS1 | Transcription elongation factor GreA | 0.00e+00 | 2.77e-54 | 6.82e-38 | 0.9111 |
| 1. PBF | A7GT58 | Transcription elongation factor GreA | 0.00e+00 | 1.53e-56 | 6.70e-32 | 0.8601 |
| 1. PBF | Q9HZY5 | Transcription elongation factor GreB | 0.00e+00 | 9.85e-37 | 2.73e-14 | 0.9218 |
| 1. PBF | A1VY10 | Transcription elongation factor GreA | 0.00e+00 | 7.39e-48 | 6.94e-25 | 0.776 |
| 1. PBF | A4IR71 | Transcription elongation factor GreA | 0.00e+00 | 2.10e-47 | 2.66e-31 | 0.853 |
| 1. PBF | Q04EK0 | Transcription elongation factor GreA | 0.00e+00 | 5.43e-49 | 2.86e-27 | 0.8832 |
| 1. PBF | Q9K0C5 | Transcription elongation factor GreB | 0.00e+00 | 3.60e-44 | 5.23e-14 | 0.921 |
| 1. PBF | A0M5U7 | Transcription elongation factor GreA | 0.00e+00 | 1.88e-53 | 5.84e-27 | 0.8269 |
| 1. PBF | B3QV56 | Transcription elongation factor GreA | 0.00e+00 | 4.17e-50 | 4.31e-22 | 0.7498 |
| 1. PBF | Q97PT2 | Transcription elongation factor GreA | 0.00e+00 | 1.46e-51 | 8.88e-21 | 0.8836 |
| 1. PBF | Q2G656 | Transcription elongation factor GreA | 0.00e+00 | 2.90e-50 | 5.71e-28 | 0.7805 |
| 1. PBF | A4WVE8 | Transcription elongation factor GreA | 0.00e+00 | 2.23e-46 | 3.53e-29 | 0.8923 |
| 1. PBF | C1KVE3 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-51 | 1.10e-29 | 0.8904 |
| 1. PBF | Q0C4H1 | Transcription elongation factor GreA | 0.00e+00 | 1.54e-50 | 2.88e-25 | 0.9423 |
| 1. PBF | Q2GD99 | Transcription elongation factor GreA | 0.00e+00 | 1.42e-51 | 3.03e-23 | 0.8865 |
| 1. PBF | B2IHJ7 | Transcription elongation factor GreA | 0.00e+00 | 4.47e-55 | 5.44e-25 | 0.9195 |
| 1. PBF | Q9X232 | Transcription elongation factor GreA | 0.00e+00 | 1.55e-49 | 8.12e-24 | 0.8275 |
| 1. PBF | B8D7R9 | Transcription elongation factor GreA | 0.00e+00 | 1.79e-43 | 5.13e-29 | 0.9439 |
| 1. PBF | Q7VL00 | Transcription elongation factor GreA | 0.00e+00 | 1.59e-49 | 2.46e-23 | 0.9401 |
| 1. PBF | B9DTR1 | Transcription elongation factor GreA | 0.00e+00 | 1.91e-52 | 6.04e-24 | 0.8612 |
| 1. PBF | Q5SJG6 | Transcription inhibitor protein Gfh1 | 8.88e-16 | 1.18e-43 | 2.42e-10 | 0.7797 |
| 1. PBF | Q6F215 | Transcription elongation factor GreA | 0.00e+00 | 1.32e-71 | 1.44e-75 | 0.9791 |
| 1. PBF | Q8P7P8 | Transcription elongation factor GreB | 0.00e+00 | 6.60e-41 | 4.88e-15 | 0.8774 |
| 1. PBF | P64283 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8825 |
| 1. PBF | A0Q5P2 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9467 |
| 1. PBF | A9IRC3 | Transcription elongation factor GreA | 0.00e+00 | 2.92e-54 | 1.51e-26 | 0.8786 |
| 1. PBF | A6Q4L2 | Transcription elongation factor GreA | 0.00e+00 | 2.65e-45 | 8.69e-25 | 0.8126 |
| 1. PBF | Q88WQ9 | Transcription elongation factor GreA 2 | 0.00e+00 | 2.64e-57 | 2.28e-26 | 0.815 |
| 1. PBF | Q3A452 | Transcription elongation factor GreA | 0.00e+00 | 3.66e-54 | 2.59e-30 | 0.9231 |
| 1. PBF | Q8ZJH2 | Transcription elongation factor GreB | 0.00e+00 | 6.15e-26 | 4.21e-18 | 0.9021 |
| 1. PBF | Q0BKZ4 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9506 |
| 1. PBF | Q5WTH5 | Transcription elongation factor GreA | 0.00e+00 | 8.18e-49 | 1.83e-28 | 0.9495 |
| 1. PBF | B1ICT9 | Transcription elongation factor GreA | 0.00e+00 | 1.09e-50 | 2.68e-20 | 0.8905 |
| 1. PBF | A1KHL8 | Transcription elongation factor GreA | 2.43e-14 | 1.21e-49 | 6.78e-13 | 0.7396 |
| 1. PBF | B8H1V7 | Transcription elongation factor GreA | 0.00e+00 | 5.48e-55 | 1.54e-27 | 0.9298 |
| 1. PBF | C1FNC6 | Transcription elongation factor GreA | 0.00e+00 | 2.63e-50 | 9.18e-26 | 0.8963 |
| 1. PBF | Q057J4 | Transcription elongation factor GreA | 0.00e+00 | 5.08e-43 | 1.10e-18 | 0.9203 |
| 1. PBF | A5FJJ8 | Transcription elongation factor GreA | 0.00e+00 | 1.77e-51 | 6.01e-22 | 0.8317 |
| 1. PBF | O83063 | Transcription elongation factor GreA | 0.00e+00 | 4.54e-43 | 1.23e-10 | 0.7786 |
| 1. PBF | B7ID86 | Transcription elongation factor GreA | 0.00e+00 | 5.31e-57 | 4.46e-27 | 0.8469 |
| 1. PBF | Q31H97 | Transcription elongation factor GreA | 0.00e+00 | 1.29e-50 | 6.44e-27 | 0.953 |
| 1. PBF | A5V3E1 | Transcription elongation factor GreA | 0.00e+00 | 5.29e-48 | 6.06e-24 | 0.8208 |
| 1. PBF | Q57C09 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9139 |
| 1. PBF | A5I7P5 | Transcription elongation factor GreA | 0.00e+00 | 3.20e-51 | 2.79e-25 | 0.8941 |
| 1. PBF | Q1QCJ2 | Transcription elongation factor GreA | 0.00e+00 | 9.77e-50 | 1.90e-23 | 0.9085 |
| 1. PBF | A5CE64 | Transcription elongation factor GreA | 0.00e+00 | 4.63e-44 | 4.11e-20 | 0.9304 |
| 1. PBF | Q07JJ7 | Transcription elongation factor GreA | 0.00e+00 | 2.12e-44 | 7.09e-26 | 0.9294 |
| 1. PBF | P64280 | Transcription elongation factor GreA | 8.66e-15 | 1.21e-49 | 6.78e-13 | 0.746 |
| 1. PBF | Q5LXA4 | Transcription elongation factor GreA | 0.00e+00 | 3.63e-47 | 1.63e-28 | 0.8682 |
| 1. PBF | B4UCU9 | Transcription elongation factor GreA | 0.00e+00 | 4.77e-36 | 5.40e-28 | 0.9493 |
| 1. PBF | Q8XZ82 | Transcription elongation factor GreA | 0.00e+00 | 6.43e-49 | 1.00e-26 | 0.881 |
| 1. PBF | B3PM73 | Transcription elongation factor GreA | 0.00e+00 | 1.06e-57 | 4.16e-39 | 0.8338 |
| 1. PBF | A9M6H1 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9149 |
| 1. PBF | A4IZ52 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9442 |
| 1. PBF | Q8ZBB3 | Transcription elongation factor GreA | 0.00e+00 | 6.85e-45 | 1.66e-30 | 0.9618 |
| 1. PBF | Q493U4 | Transcription elongation factor GreA | 0.00e+00 | 4.59e-47 | 2.51e-26 | 0.9403 |
| 1. PBF | Q68VQ2 | Transcription elongation factor GreA | 0.00e+00 | 1.46e-46 | 4.11e-29 | 0.9368 |
| 1. PBF | Q14GS9 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9503 |
| 1. PBF | Q04HS9 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-51 | 2.53e-21 | 0.8838 |
| 1. PBF | Q87TB8 | Transcription elongation factor GreB | 0.00e+00 | 2.95e-36 | 7.22e-11 | 0.8676 |
| 1. PBF | B5ZXG2 | Transcription elongation factor GreA | 0.00e+00 | 5.66e-56 | 5.90e-28 | 0.9087 |
| 1. PBF | B4S9B2 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 3.62e-25 | 0.8184 |
| 1. PBF | Q0AMQ6 | Transcription elongation factor GreA | 0.00e+00 | 9.06e-54 | 4.29e-23 | 0.934 |
| 1. PBF | Q81LK9 | Transcription elongation factor GreA | 0.00e+00 | 5.74e-57 | 3.96e-30 | 0.8446 |
| 1. PBF | A6U279 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8831 |
| 1. PBF | A9KIP3 | Transcription elongation factor GreA | 0.00e+00 | 6.53e-54 | 1.04e-24 | 0.9327 |
| 1. PBF | Q5XDQ7 | Transcription elongation factor GreA | 0.00e+00 | 7.47e-52 | 4.07e-25 | 0.8772 |
| 1. PBF | O50237 | Transcription elongation factor GreA | 0.00e+00 | 1.08e-47 | 9.89e-25 | 0.8446 |
| 1. PBF | C3KVU0 | Transcription elongation factor GreA | 0.00e+00 | 1.08e-51 | 2.07e-26 | 0.8989 |
| 1. PBF | Q1CT06 | Transcription elongation factor GreA | 0.00e+00 | 3.95e-40 | 7.14e-26 | 0.8261 |
| 1. PBF | P80240 | Transcription elongation factor GreA | 0.00e+00 | 1.53e-55 | 1.87e-31 | 0.8355 |
| 1. PBF | A8FFL6 | Transcription elongation factor GreA | 0.00e+00 | 2.60e-53 | 3.77e-25 | 0.8372 |
| 1. PBF | B8D9G7 | Transcription elongation factor GreA | 0.00e+00 | 1.79e-43 | 5.13e-29 | 0.9354 |
| 1. PBF | Q7UVA0 | Transcription elongation factor GreA | 0.00e+00 | 2.35e-53 | 1.89e-17 | 0.7877 |
| 1. PBF | B4SBF9 | Transcription elongation factor GreA | 0.00e+00 | 1.47e-54 | 2.36e-23 | 0.8028 |
| 1. PBF | A8ESG0 | Transcription elongation factor GreA | 0.00e+00 | 2.13e-46 | 1.31e-15 | 0.8496 |
| 1. PBF | Q4L6V7 | Transcription elongation factor GreA | 0.00e+00 | 4.14e-55 | 5.30e-26 | 0.877 |
| 1. PBF | Q49Y48 | Transcription elongation factor GreA | 0.00e+00 | 6.53e-54 | 6.94e-26 | 0.8703 |
| 1. PBF | A8AVM5 | Transcription elongation factor GreA | 0.00e+00 | 5.77e-51 | 7.48e-21 | 0.8881 |
| 1. PBF | B8G358 | Transcription elongation factor GreA | 0.00e+00 | 1.06e-54 | 1.30e-31 | 0.8819 |
| 1. PBF | B9L0L0 | Transcription elongation factor GreA | 0.00e+00 | 3.08e-57 | 2.96e-31 | 0.9257 |
| 1. PBF | B0CHU1 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.9132 |
| 1. PBF | Q1QJF3 | Transcription elongation factor GreA | 0.00e+00 | 1.02e-46 | 8.80e-28 | 0.9021 |
| 1. PBF | P9WMT8 | Transcription elongation factor GreA | 2.29e-14 | 1.21e-49 | 6.78e-13 | 0.7517 |
| 1. PBF | Q1RKI0 | Transcription elongation factor GreA | 0.00e+00 | 5.07e-50 | 2.78e-29 | 0.9402 |
| 1. PBF | A5N4L0 | Transcription elongation factor GreA | 0.00e+00 | 6.21e-51 | 1.14e-26 | 0.8868 |
| 1. PBF | A3CPS3 | Transcription elongation factor GreA | 0.00e+00 | 2.22e-49 | 4.61e-21 | 0.8919 |
| 1. PBF | B2GD90 | Transcription elongation factor GreA | 0.00e+00 | 1.82e-50 | 9.52e-30 | 0.896 |
| 1. PBF | B9JYZ7 | Transcription elongation factor GreA | 0.00e+00 | 8.41e-53 | 7.83e-30 | 0.9116 |
| 1. PBF | A4F866 | Transcription elongation factor GreA | 2.94e-14 | 3.58e-45 | 2.12e-10 | 0.6791 |
| 1. PBF | Q6HDE6 | Transcription elongation factor GreA | 0.00e+00 | 5.74e-57 | 3.96e-30 | 0.8744 |
| 1. PBF | A6LMS3 | Transcription elongation factor GreA | 0.00e+00 | 9.13e-57 | 2.69e-26 | 0.8633 |
| 1. PBF | Q92FZ5 | Transcription elongation factor GreA | 0.00e+00 | 1.70e-47 | 6.99e-29 | 0.9427 |
| 1. PBF | A1TE43 | Transcription elongation factor GreA | 3.14e-14 | 6.85e-51 | 6.71e-15 | 0.7446 |
| 1. PBF | Q8R7N0 | Transcription elongation factor GreA | 0.00e+00 | 2.76e-56 | 5.00e-36 | 0.8814 |
| 1. PBF | Q8DBW9 | Transcription elongation factor GreA | 0.00e+00 | 1.45e-41 | 1.46e-19 | 0.9342 |
| 1. PBF | B1LAX5 | Transcription elongation factor GreA | 0.00e+00 | 2.91e-48 | 1.28e-23 | 0.8303 |
| 1. PBF | C4K7K9 | Transcription elongation factor GreA | 0.00e+00 | 8.97e-51 | 1.23e-27 | 0.9377 |
| 1. PBF | B9K7Y7 | Transcription elongation factor GreA | 0.00e+00 | 2.56e-50 | 4.09e-23 | 0.8218 |
| 1. PBF | Q7VJT9 | Transcription elongation factor GreA | 0.00e+00 | 2.43e-40 | 3.72e-26 | 0.8496 |
| 1. PBF | B5Z7M6 | Transcription elongation factor GreA | 0.00e+00 | 3.95e-40 | 7.14e-26 | 0.8259 |
| 1. PBF | P64271 | Transcription elongation factor GreA | 0.00e+00 | 1.24e-49 | 5.99e-28 | 0.916 |
| 1. PBF | Q0TMI6 | Transcription elongation factor GreA | 0.00e+00 | 7.37e-51 | 1.36e-27 | 0.8756 |
| 1. PBF | B2UXU9 | Transcription elongation factor GreA | 0.00e+00 | 9.89e-51 | 1.41e-25 | 0.8758 |
| 1. PBF | P64278 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-51 | 1.10e-29 | 0.8899 |
| 1. PBF | A5CVW9 | Transcription elongation factor GreA | 0.00e+00 | 7.94e-48 | 7.26e-25 | 0.9599 |
| 1. PBF | B7HQD7 | Transcription elongation factor GreA | 0.00e+00 | 5.89e-57 | 6.61e-31 | 0.7899 |
| 1. PBF | Q98I49 | Transcription elongation factor GreA | 0.00e+00 | 1.03e-52 | 3.40e-29 | 0.8844 |
| 1. PBF | A0R2X1 | Transcription elongation factor GreA | 4.33e-15 | 3.79e-50 | 6.10e-13 | 0.7578 |
| 1. PBF | A0PXN3 | Transcription elongation factor GreA | 0.00e+00 | 3.74e-52 | 7.54e-30 | 0.8401 |
| 1. PBF | Q4FTJ2 | Transcription elongation factor GreA | 0.00e+00 | 6.95e-50 | 3.70e-23 | 0.8864 |
| 1. PBF | A1ST36 | Transcription elongation factor GreA | 0.00e+00 | 3.61e-49 | 5.87e-26 | 0.9447 |
| 1. PBF | Q3J822 | Transcription elongation factor GreA | 0.00e+00 | 3.52e-50 | 2.09e-28 | 0.951 |
| 1. PBF | B2SDF5 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.9505 |
| 1. PBF | Q9CHT2 | Transcription elongation factor GreA | 0.00e+00 | 1.96e-52 | 1.98e-32 | 0.8786 |
| 1. PBF | Q88KH5 | Transcription elongation factor GreB | 0.00e+00 | 8.19e-38 | 8.58e-13 | 0.8792 |
| 1. PBF | C3L5Y5 | Transcription elongation factor GreA | 0.00e+00 | 5.74e-57 | 3.96e-30 | 0.7758 |
| 1. PBF | B0U8M0 | Transcription elongation factor GreA | 0.00e+00 | 1.13e-47 | 9.94e-30 | 0.8831 |
| 1. PBF | Q3ATA7 | Transcription elongation factor GreA | 0.00e+00 | 1.49e-56 | 7.66e-24 | 0.808 |
| 1. PBF | B1AIU2 | Transcription elongation factor GreA | 0.00e+00 | 1.95e-54 | 6.83e-29 | 0.8287 |
| 1. PBF | Q8DDU7 | Transcription elongation factor GreB | 0.00e+00 | 1.35e-39 | 8.16e-13 | 0.807 |
| 1. PBF | B1MX52 | Transcription elongation factor GreA | 0.00e+00 | 4.51e-53 | 3.50e-23 | 0.9102 |
| 1. PBF | Q6GG93 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.881 |
| 1. PBF | Q9JVD0 | Transcription elongation factor GreB | 0.00e+00 | 3.14e-44 | 3.65e-14 | 0.9213 |
| 1. PBF | C1A2Y4 | Transcription elongation factor GreA | 2.98e-14 | 2.07e-49 | 1.32e-12 | 0.7431 |
| 1. PBF | Q1MDR7 | Transcription elongation factor GreA | 0.00e+00 | 4.06e-56 | 1.14e-27 | 0.8935 |
| 1. PBF | Q8DY80 | Transcription elongation factor GreA | 0.00e+00 | 5.84e-52 | 6.01e-25 | 0.8841 |
| 1. PBF | Q9HV46 | Transcription elongation factor GreA | 0.00e+00 | 3.32e-46 | 1.51e-24 | 0.9546 |
| 1. PBF | A8F083 | Transcription elongation factor GreA | 0.00e+00 | 2.10e-47 | 4.34e-29 | 0.9308 |
| 1. PBF | B9KDP9 | Transcription elongation factor GreA | 0.00e+00 | 6.11e-48 | 4.94e-24 | 0.8048 |
| 1. PBF | B3QPT8 | Transcription elongation factor GreA | 0.00e+00 | 8.40e-54 | 3.17e-22 | 0.8071 |
| 1. PBF | A6H247 | Transcription elongation factor GreA | 0.00e+00 | 6.79e-50 | 8.05e-20 | 0.8461 |
| 1. PBF | A7I2X0 | Transcription elongation factor GreA | 0.00e+00 | 1.09e-45 | 7.32e-22 | 0.7565 |
| 1. PBF | Q9KU89 | Transcription elongation factor GreA | 0.00e+00 | 4.63e-44 | 3.21e-21 | 0.9413 |
| 1. PBF | Q6MTU9 | Transcription elongation factor GreA | 0.00e+00 | 1.82e-108 | 1.45e-106 | 0.9948 |
| 1. PBF | P59489 | Transcription elongation factor GreA | 0.00e+00 | 2.71e-45 | 9.01e-29 | 0.9012 |
| 1. PBF | B3EPH3 | Transcription elongation factor GreA | 0.00e+00 | 4.48e-54 | 1.96e-22 | 0.7875 |
| 1. PBF | Q88ZS9 | Transcription elongation factor GreA 1 | 0.00e+00 | 1.93e-46 | 4.61e-05 | 0.8951 |
| 1. PBF | B9DNJ3 | Transcription elongation factor GreA | 0.00e+00 | 1.31e-57 | 8.99e-28 | 0.8987 |
| 1. PBF | Q3JZS3 | Transcription elongation factor GreA | 0.00e+00 | 5.84e-52 | 6.01e-25 | 0.8773 |
| 1. PBF | Q6G8V9 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8761 |
| 1. PBF | B8IZM4 | Transcription elongation factor GreA | 0.00e+00 | 1.70e-41 | 1.65e-19 | 0.7882 |
| 1. PBF | B0VSL8 | Transcription elongation factor GreA | 0.00e+00 | 1.54e-50 | 7.28e-21 | 0.8832 |
| 1. PBF | B0KCE3 | Transcription elongation factor GreA | 0.00e+00 | 4.73e-56 | 8.73e-35 | 0.8736 |
| 1. PBF | Q9L4D3 | Transcription elongation factor GreA | 0.00e+00 | 3.82e-46 | 5.48e-26 | 0.8366 |
| 1. PBF | B0K5B9 | Transcription elongation factor GreA | 0.00e+00 | 4.73e-56 | 8.73e-35 | 0.879 |
| 1. PBF | A9WK05 | Transcription elongation factor GreA | 0.00e+00 | 4.86e-53 | 7.06e-30 | 0.9088 |
| 1. PBF | Q3Z8E7 | Transcription elongation factor GreA | 0.00e+00 | 9.34e-52 | 4.49e-15 | 0.8715 |
| 1. PBF | Q8D2W9 | Transcription elongation factor GreA | 0.00e+00 | 8.83e-54 | 9.00e-26 | 0.9618 |
| 1. PBF | B1IGJ3 | Transcription elongation factor GreA | 0.00e+00 | 1.08e-51 | 2.07e-26 | 0.8968 |
| 1. PBF | A6QHF1 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | 0.8833 |
| 1. PBF | B0U568 | Transcription elongation factor GreA | 0.00e+00 | 1.68e-46 | 2.40e-25 | 0.8558 |
| 1. PBF | A7NDI1 | Transcription elongation factor GreA | 0.00e+00 | 2.19e-55 | 1.77e-24 | 0.944 |
| 1. PBF | A4VX43 | Transcription elongation factor GreA | 0.00e+00 | 1.42e-53 | 2.62e-22 | 0.8889 |
| 1. PBF | A9NGN4 | Transcription elongation factor GreA | 0.00e+00 | 1.93e-64 | 1.19e-33 | 0.8572 |
| 1. PBF | P43881 | Transcription elongation factor GreA | 0.00e+00 | 4.34e-52 | 8.04e-31 | 0.9352 |
| 1. PBF | Q8PLD9 | Transcription elongation factor GreA | 0.00e+00 | 8.58e-49 | 5.91e-27 | 0.8339 |
| 1. PBF | A4W3E8 | Transcription elongation factor GreA | 0.00e+00 | 1.42e-53 | 2.62e-22 | 0.8888 |
| 1. PBF | Q28V47 | Transcription elongation factor GreA | 0.00e+00 | 1.72e-46 | 1.56e-28 | 0.8424 |
| 1. PBF | Q9PIK9 | Transcription elongation factor GreA | 0.00e+00 | 8.49e-47 | 6.98e-24 | 0.7839 |
| 1. PBF | A1V9Q2 | Transcription elongation factor GreA | 0.00e+00 | 8.57e-36 | 7.50e-22 | 0.817 |
| 1. PBF | Q82I57 | Transcription elongation factor GreA | 1.46e-13 | 3.65e-52 | 1.81e-11 | 0.7469 |
| 1. PBF | Q65GT4 | Transcription elongation factor GreA | 0.00e+00 | 1.42e-53 | 8.82e-30 | 0.8574 |
| 1. PBF | B5YJG9 | Transcription elongation factor GreA | 0.00e+00 | 3.09e-62 | 1.43e-30 | 0.9157 |
| 1. PBF | P78019 | Transcription elongation factor GreA | 0.00e+00 | 1.31e-60 | 1.23e-40 | 0.9527 |
| 1. PBF | A3PGS3 | Transcription elongation factor GreA | 0.00e+00 | 2.23e-46 | 7.45e-29 | 0.8723 |
| 1. PBF | Q3J5L0 | Transcription elongation factor GreA | 0.00e+00 | 5.61e-40 | 9.81e-29 | 0.8821 |
| 2. PF | P65096 | Uncharacterized protein Mb3817 | 1.05e-08 | 1.60e-40 | NA | 0.4265 |
| 2. PF | P0AFW5 | Regulator of nucleoside diphosphate kinase | 3.01e-07 | 3.54e-05 | NA | 0.4936 |
| 2. PF | P9WKW6 | Uncharacterized protein MT3896 | 1.72e-07 | 1.60e-40 | NA | 0.427 |
| 2. PF | P0AFW6 | Regulator of nucleoside diphosphate kinase | 9.53e-07 | 3.54e-05 | NA | 0.4933 |
| 2. PF | P0AFW7 | Regulator of nucleoside diphosphate kinase | 9.48e-07 | 3.54e-05 | NA | 0.4934 |
| 3. BF | O51157 | Transcription elongation factor GreA | 3.72e-06 | NA | 3.39e-10 | 0.7726 |
| 3. BF | Q9PLU1 | Transcription elongation factor GreA | 1.64e-06 | NA | 3.55e-07 | 0.7363 |
| 3. BF | O84641 | Transcription elongation factor GreA | 1.17e-06 | NA | 1.65e-07 | 0.7642 |
| 3. BF | Q9Z7G4 | Transcription elongation factor GreA | 1.72e-06 | NA | 8.82e-11 | 0.7537 |
| 4. PB | Q2FXW7 | Transcription elongation factor GreA | 0.00e+00 | 8.23e-55 | 6.80e-27 | NA |
| 4. PB | P0A6W5 | Transcription elongation factor GreA | 0.00e+00 | 2.38e-51 | 1.18e-28 | NA |
| 4. PB | P30128 | Transcription elongation factor GreB | 0.00e+00 | 2.90e-42 | 2.26e-16 | NA |
| 4. PB | P9WMT9 | Transcription elongation factor GreA | 2.50e-14 | 1.21e-49 | 6.78e-13 | NA |
| 5. P | P9WKW7 | Uncharacterized protein Rv3788 | 1.05e-08 | 1.60e-40 | NA | NA |
| 5. P | B8ZQ95 | 50S ribosomal protein L9 | 4.97e-02 | 4.28e-02 | NA | NA |
| 5. P | B1IA16 | 50S ribosomal protein L9 | 4.93e-02 | 4.28e-02 | NA | NA |
| 5. P | Q3II29 | Transcription antitermination protein NusB | 4.76e-02 | 1.61e-02 | NA | NA |
| 5. P | P06023 | Putative DNA ends protecting protein gam | NA | 3.03e-08 | NA | NA |
| 5. P | P54464 | Uncharacterized protein YqeY | 3.02e-02 | 2.06e-04 | NA | NA |
| 5. P | Q3Z709 | Transcription antitermination protein NusB | 1.35e-02 | 3.87e-02 | NA | NA |
| 5. P | A5IY26 | 50S ribosomal protein L9 | 4.54e-02 | 3.94e-02 | NA | NA |
| 5. P | P0A1S3 | DNA-binding protein H-NS | 1.14e-02 | 3.71e-03 | NA | NA |
| 5. P | Q5PCT5 | DNA-binding protein H-NS | 1.11e-02 | 9.87e-04 | NA | NA |
| 5. P | B8I4B5 | 50S ribosomal protein L9 | 3.32e-02 | 4.21e-02 | NA | NA |
| 5. P | A5FQ51 | Transcription antitermination protein NusB | 1.45e-02 | 2.25e-02 | NA | NA |
| 5. P | B2INM2 | 50S ribosomal protein L9 | 6.02e-02 | 4.28e-02 | NA | NA |
| 5. P | Q04HX2 | 50S ribosomal protein L9 | 5.26e-02 | 4.28e-02 | NA | NA |
| 5. P | Q5M252 | 50S ribosomal protein L9 | 5.50e-02 | 2.69e-02 | NA | NA |
| 5. P | O31739 | Uncharacterized protein YlqD | 1.69e-03 | 1.49e-05 | NA | NA |
| 5. P | P0ACG0 | DNA-binding protein H-NS | 1.20e-02 | 4.44e-03 | NA | NA |
| 5. P | B5ZAW6 | ATP synthase subunit delta | 8.11e-02 | 1.82e-02 | NA | NA |
| 5. P | P0ACF8 | DNA-binding protein H-NS | 1.15e-02 | 4.44e-03 | NA | NA |
| 5. P | P43841 | DNA-binding protein H-NS homolog | 1.74e-02 | 5.29e-04 | NA | NA |
| 5. P | Q5LXK2 | 50S ribosomal protein L9 | 5.43e-02 | 2.69e-02 | NA | NA |
| 5. P | Q9CHI6 | 50S ribosomal protein L9 | 5.07e-02 | 4.78e-02 | NA | NA |
| 5. P | P09120 | DNA-binding protein H-NS | 1.14e-02 | 4.44e-03 | NA | NA |
| 5. P | C1CBI1 | 50S ribosomal protein L9 | 5.33e-02 | 4.28e-02 | NA | NA |
| 5. P | P18818 | DNA-binding protein H-NS | 1.94e-02 | 3.44e-02 | NA | NA |
| 5. P | P0ACF9 | DNA-binding protein H-NS | 1.19e-02 | 4.44e-03 | NA | NA |
| 5. P | P66320 | 50S ribosomal protein L9 | 5.61e-02 | 4.28e-02 | NA | NA |
| 5. P | P0AFW4 | Regulator of nucleoside diphosphate kinase | 9.63e-07 | 3.54e-05 | NA | NA |
| 5. P | C1CNH8 | 50S ribosomal protein L9 | 5.38e-02 | 4.28e-02 | NA | NA |
| 5. P | P0A1S2 | DNA-binding protein H-NS | 1.15e-02 | 3.71e-03 | NA | NA |
| 5. P | P66321 | 50S ribosomal protein L9 | 5.53e-02 | 4.28e-02 | NA | NA |
| 5. P | B1AIC3 | ATP synthase subunit delta | 8.40e-02 | 1.57e-02 | NA | NA |
| 5. P | Q9PQZ1 | Uncharacterized protein UU153 | 1.11e-03 | 2.99e-03 | NA | NA |
| 5. P | A7NP12 | Transcription antitermination protein NusB | 3.45e-02 | 2.45e-02 | NA | NA |
| 5. P | Q9L5H8 | DNA-binding protein H-NS, plasmid | 1.37e-02 | 1.18e-02 | NA | NA |
| 5. P | Q3ZYI9 | Transcription antitermination protein NusB | 1.29e-02 | 2.25e-02 | NA | NA |
| 5. P | Q8RI10 | 50S ribosomal protein L9 | 3.82e-02 | 3.97e-02 | NA | NA |
| 5. P | Q9PR10 | ATP synthase subunit delta | 8.25e-02 | 1.57e-02 | NA | NA |
| 5. P | C1CHK3 | 50S ribosomal protein L9 | 5.06e-02 | 4.28e-02 | NA | NA |
| 5. P | C1CUC1 | 50S ribosomal protein L9 | 5.51e-02 | 4.28e-02 | NA | NA |
| 5. P | A1JNS2 | Transcription antitermination protein NusB | 7.03e-02 | 2.79e-02 | NA | NA |
| 5. P | A0A0F6B244 | DNA-binding protein H-NS | 1.23e-02 | 3.71e-03 | NA | NA |
| 5. P | O05070 | Mu-like prophage FluMu host-nuclease inhibitor protein gam | 5.59e-03 | 5.45e-07 | NA | NA |
| 5. P | O55736 | Uncharacterized protein 122R | NA | 1.74e-03 | NA | NA |
| 5. P | A0A0H3NBY9 | DNA-binding protein H-NS | 1.18e-02 | 3.71e-03 | NA | NA |
| 5. P | P18955 | DNA-binding protein H-NS | 5.46e-03 | 2.23e-02 | NA | NA |
| 5. P | P0DOA5 | DNA-binding protein H-NS | 4.32e-03 | 2.53e-03 | NA | NA |
| 5. P | Q02XA2 | ATP synthase subunit delta | 1.26e-01 | 2.86e-02 | NA | NA |
| 5. P | A5URZ1 | Transcription antitermination protein NusB | 3.59e-02 | 2.98e-02 | NA | NA |
| 5. P | B5E3V0 | 50S ribosomal protein L9 | 5.69e-02 | 4.28e-02 | NA | NA |