Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54690.1
JCVISYN3A_0263
Ribosome small subunit-dependent GTPase A.
M. mycoides homolog: Q6MTT9.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 9
Unique PROST Go: 1
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 288
Unique PROST Homologs: 7
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q3JQ14
(Small ribosomal subunit biogenesis GTPase RsgA) with a FATCAT P-Value: 0 and RMSD of 3.29 angstrom. The sequence alignment identity is 29.7%.
Structural alignment shown in left. Query protein AVX54690.1 colored as red in alignment, homolog Q3JQ14 colored as blue.
Query protein AVX54690.1 is also shown in right top, homolog Q3JQ14 showed in right bottom. They are colored based on secondary structures.
AVX54690.1 -------------------MQGILIKKDSNESYVFYKNN---IYKVYAKGNLKKELKPKVGDIVEF-SILEDGNGYIKEIKPRKNSL---D--RPKI--A 70 Q3JQ14 MKRAPTKQPAKPAARGGERAQGRVIAAHGRH-YIVAPADGGPMLQCFPRGK-KSEV--AVGDRVAYERTSAD-QGVIVEIGERRNLLYRSDQFKSKLFAA 95 AVX54690.1 NVDQVLIVTALYEPLFSSFLLNKYIMMLETLKIKPILIFTKVDLLKQTPYYQEVMHKINWYEKMHYEVLIINNK---DNLENKKAIIEKLKSFLENKISV 167 Q3JQ14 NLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARE---RLAPYRALGYDVLELSVKGAPDDART------QLAPRLAGHSTI 185 AVX54690.1 FTGQTGAGKSTTLNNFL--DMNNQIKTNEISKKLNRGKHTTTSIQLYNLENNIFIADTPGFSAFDLNNI-D--IEHILYSWETFIPFLNKCKFVDCTHTH 262 Q3JQ14 LLGQSGMGKS-TLVNLLVPDA--EAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLER---AFPEFRPLLAHCRFYNCHHLH 279 AVX54690.1 ESKCEVKKAVAE-HLLPTFIYNDYVKVYEELKQ-NRKNKY 300 Q3JQ14 EPGCAILEALADGRIAPTR-HALYAQLVHEASQIVR---- 314
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0003924 | GTPase activity |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0042274 | ribosomal small subunit biogenesis |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0019843 | rRNA binding |
| 1. PBF | GO:0005525 | GTP binding |
| 4. PB | GO:0097216 | guanosine tetraphosphate binding |
| 4. PB | GO:0005829 | cytosol |
| 5. P | GO:0042254 | ribosome biogenesis |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003723 | RNA binding |
| GO:0019843 | rRNA binding |
| GO:0003924 | GTPase activity |
| GO:0005737 | cytoplasm |
| GO:0042254 | ribosome biogenesis |
| GO:0042274 | ribosomal small subunit biogenesis |
| GO:0046872 | metal ion binding |
| GO:0016787 | hydrolase activity |
| GO:0000166 | nucleotide binding |
| GO:0005525 | GTP binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q62M59 | Small ribosomal subunit biogenesis GTPase RsgA | 1.28e-12 | 4.11e-46 | 1.37e-39 | 0.7375 |
| 1. PBF | Q4L5S2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.78e-68 | 6.81e-51 | 0.8411 |
| 1. PBF | A5ILF8 | Small ribosomal subunit biogenesis GTPase RsgA | 1.29e-14 | 7.71e-58 | 6.49e-44 | 0.8374 |
| 1. PBF | A3MHS6 | Small ribosomal subunit biogenesis GTPase RsgA | 1.52e-12 | 4.11e-46 | 1.37e-39 | 0.7329 |
| 1. PBF | A6GW90 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.62e-56 | 5.96e-32 | 0.7827 |
| 1. PBF | A9N420 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.91e-25 | 4.75e-39 | 0.7983 |
| 1. PBF | P67681 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.12e-67 | 2.44e-49 | 0.841 |
| 1. PBF | P52640 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.44e-28 | 3.23e-28 | 0.7293 |
| 1. PBF | A7FW69 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.95e-71 | 1.97e-51 | 0.8966 |
| 1. PBF | Q88DC4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.88e-18 | 2.59e-28 | 0.789 |
| 1. PBF | P0DF42 | Small ribosomal subunit biogenesis GTPase RsgA | 5.66e-15 | 3.23e-64 | 1.67e-59 | 0.8609 |
| 1. PBF | Q0VMD9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.14e-20 | 1.53e-27 | 0.8163 |
| 1. PBF | B5ZB25 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.88e-68 | 2.61e-42 | 0.847 |
| 1. PBF | B5R024 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.07e-25 | 5.45e-39 | 0.7974 |
| 1. PBF | Q66FC3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7795 |
| 1. PBF | Q87VI5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.07e-21 | 1.28e-27 | 0.7842 |
| 1. PBF | C1DLP4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 8.91e-20 | 3.45e-31 | 0.7904 |
| 1. PBF | B5Y341 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.88e-27 | 8.62e-38 | 0.7958 |
| 1. PBF | Q88WF3 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 5.55e-16 | 1.62e-29 | 1.54e-22 | 0.6977 |
| 1. PBF | B7MKW8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.7992 |
| 1. PBF | B5RLH3 | Small ribosomal subunit biogenesis GTPase RsgA | 1.93e-12 | 2.41e-51 | 1.70e-28 | 0.7606 |
| 1. PBF | Q8ZIX0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7807 |
| 1. PBF | Q8YUA3 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 2.22e-16 | 2.13e-27 | 6.62e-36 | 0.7453 |
| 1. PBF | B0UT89 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.85e-25 | 6.11e-40 | 0.7949 |
| 1. PBF | Q6D036 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.29e-26 | 8.39e-33 | 0.7866 |
| 1. PBF | Q46I43 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.79e-48 | 7.14e-29 | 0.737 |
| 1. PBF | Q1QY34 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 8.03e-22 | 9.48e-34 | 0.7962 |
| 1. PBF | Q65SE2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.88e-29 | 1.57e-36 | 0.764 |
| 1. PBF | Q82ZE1 | Small ribosomal subunit biogenesis GTPase RsgA | 4.44e-16 | 1.28e-67 | 2.62e-56 | 0.8502 |
| 1. PBF | Q1I439 | Small ribosomal subunit biogenesis GTPase RsgA | 6.05e-14 | 7.45e-19 | 2.26e-28 | 0.7945 |
| 1. PBF | Q5XDX3 | Small ribosomal subunit biogenesis GTPase RsgA | 2.00e-14 | 3.65e-64 | 5.63e-60 | 0.8437 |
| 1. PBF | Q8Y0V3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.28e-51 | 1.85e-31 | 0.7429 |
| 1. PBF | A9QYN9 | Small ribosomal subunit biogenesis GTPase RsgA | 4.09e-13 | 3.07e-29 | 3.15e-39 | 0.7799 |
| 1. PBF | Q8DVW1 | Small ribosomal subunit biogenesis GTPase RsgA | 1.11e-15 | 5.94e-58 | 7.79e-60 | 0.8576 |
| 1. PBF | B5FRL9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.07e-25 | 5.45e-39 | 0.7924 |
| 1. PBF | Q8P5H9 | Small ribosomal subunit biogenesis GTPase RsgA | 6.20e-09 | 7.96e-23 | 5.94e-23 | 0.6706 |
| 1. PBF | Q71ZZ0 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 4.30e-08 | 1.70e-24 | 4.37e-21 | 0.5722 |
| 1. PBF | O51126 | Small ribosomal subunit biogenesis GTPase RsgA | 1.66e-12 | 1.18e-49 | 6.06e-28 | 0.7504 |
| 1. PBF | Q0TPL7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.70e-67 | 3.61e-46 | 0.8755 |
| 1. PBF | B7NG98 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.7966 |
| 1. PBF | Q8EUL6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.46e-60 | 5.28e-45 | 0.8823 |
| 1. PBF | A8A7Q8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.7986 |
| 1. PBF | B1MXU5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.68e-68 | 4.49e-58 | 0.8395 |
| 1. PBF | A4TRP7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7791 |
| 1. PBF | B5RQS6 | Small ribosomal subunit biogenesis GTPase RsgA | 2.47e-12 | 2.41e-51 | 1.70e-28 | 0.7528 |
| 1. PBF | A2S4N1 | Small ribosomal subunit biogenesis GTPase RsgA | 1.15e-12 | 4.11e-46 | 1.37e-39 | 0.733 |
| 1. PBF | B7M8S4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.72e-26 | 6.18e-39 | 0.8013 |
| 1. PBF | Q044G6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.94e-59 | 7.44e-49 | 0.8315 |
| 1. PBF | Q02F66 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.71e-19 | 2.70e-23 | 0.7748 |
| 1. PBF | A7GRJ1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.25e-69 | 3.11e-58 | 0.8576 |
| 1. PBF | Q8DCV7 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 0.00e+00 | 1.44e-27 | 2.49e-42 | 0.7845 |
| 1. PBF | Q9KV18 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.96e-22 | 3.17e-36 | 0.7849 |
| 1. PBF | A4XPX8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.48e-18 | 2.39e-26 | 0.7624 |
| 1. PBF | Q2NW87 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.66e-26 | 2.11e-38 | 0.7488 |
| 1. PBF | B7V341 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.48e-18 | 2.70e-23 | 0.7783 |
| 1. PBF | Q8ETB7 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 5.43e-11 | 2.54e-33 | 1.56e-22 | 0.5893 |
| 1. PBF | B4RPG3 | Small ribosomal subunit biogenesis GTPase RsgA | 1.19e-13 | 1.52e-37 | 1.77e-29 | 0.7087 |
| 1. PBF | Q5WFL1 | Small ribosomal subunit biogenesis GTPase RsgA | 2.22e-16 | 1.00e-67 | 8.58e-60 | 0.8807 |
| 1. PBF | A8G8U1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.47e-27 | 1.21e-36 | 0.7926 |
| 1. PBF | C5D8S1 | Small ribosomal subunit biogenesis GTPase RsgA | 1.78e-15 | 4.77e-69 | 2.45e-63 | 0.8433 |
| 1. PBF | B1AIK5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.34e-60 | 9.94e-44 | 0.8361 |
| 1. PBF | Q8EZ61 | Small ribosomal subunit biogenesis GTPase RsgA | 1.46e-12 | 2.88e-29 | 2.92e-14 | 0.6934 |
| 1. PBF | Q6G9Z2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.12e-67 | 2.44e-49 | 0.8373 |
| 1. PBF | B2U8L7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.30e-56 | 2.75e-32 | 0.7473 |
| 1. PBF | Q82LC4 | Small ribosomal subunit biogenesis GTPase RsgA | 2.22e-10 | 1.63e-25 | 1.86e-17 | 0.7232 |
| 1. PBF | Q4UYJ6 | Small ribosomal subunit biogenesis GTPase RsgA | 1.20e-10 | 7.96e-23 | 5.94e-23 | 0.6657 |
| 1. PBF | Q74IN3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.18e-56 | 1.96e-46 | 0.8269 |
| 1. PBF | B4TF97 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.91e-25 | 4.75e-39 | 0.805 |
| 1. PBF | B2TY39 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.789 |
| 1. PBF | A1V6I6 | Small ribosomal subunit biogenesis GTPase RsgA | 9.49e-13 | 4.11e-46 | 1.37e-39 | 0.7358 |
| 1. PBF | C4K3T8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.43e-23 | 5.35e-30 | 0.7677 |
| 1. PBF | B3R0A1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.61e-59 | 3.13e-54 | 0.8192 |
| 1. PBF | Q8A5I9 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 0.00e+00 | 3.26e-56 | 3.54e-37 | 0.8072 |
| 1. PBF | Q7VEJ4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.20e-40 | 2.15e-27 | 0.7316 |
| 1. PBF | P75523 | Small ribosomal subunit biogenesis GTPase RsgA | 1.67e-15 | 2.45e-52 | 4.93e-22 | 0.8327 |
| 1. PBF | C1ABL6 | Small ribosomal subunit biogenesis GTPase RsgA | 1.51e-13 | 7.94e-44 | 7.70e-33 | 0.7877 |
| 1. PBF | P0DF43 | Small ribosomal subunit biogenesis GTPase RsgA | 1.55e-15 | 3.23e-64 | 1.67e-59 | 0.8605 |
| 1. PBF | B0RNZ3 | Small ribosomal subunit biogenesis GTPase RsgA | 1.89e-10 | 7.96e-23 | 5.94e-23 | 0.6601 |
| 1. PBF | Q8PTZ6 | Small ribosomal subunit biogenesis GTPase RsgA | 6.89e-12 | 2.59e-22 | 1.42e-22 | 0.711 |
| 1. PBF | Q0SS84 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.03e-66 | 1.39e-45 | 0.8758 |
| 1. PBF | C4ZEV1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.90e-60 | 2.16e-48 | 0.7913 |
| 1. PBF | Q8DK79 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.32e-31 | 1.33e-30 | 0.7316 |
| 1. PBF | Q2SBB3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.49e-23 | 7.64e-36 | 0.8109 |
| 1. PBF | Q3A0G9 | Small ribosomal subunit biogenesis GTPase RsgA | 2.40e-09 | 1.57e-28 | 6.63e-24 | 0.6908 |
| 1. PBF | Q82Y12 | Small ribosomal subunit biogenesis GTPase RsgA | 1.96e-12 | 5.77e-59 | 2.69e-39 | 0.7252 |
| 1. PBF | Q4ZYY9 | Small ribosomal subunit biogenesis GTPase RsgA | 1.27e-12 | 2.33e-20 | 1.24e-28 | 0.768 |
| 1. PBF | B2T600 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.27e-53 | 1.66e-33 | 0.7546 |
| 1. PBF | Q8R685 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.53e-60 | 3.37e-34 | 0.8369 |
| 1. PBF | Q64YJ1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.57e-58 | 2.73e-32 | 0.7674 |
| 1. PBF | Q7MGZ6 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 0.00e+00 | 1.44e-27 | 2.49e-42 | 0.7807 |
| 1. PBF | B0KL04 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.35e-19 | 2.06e-28 | 0.7969 |
| 1. PBF | Q8E3D9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.45e-58 | 1.23e-55 | 0.8521 |
| 1. PBF | A5IY02 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.59e-62 | 2.80e-49 | 0.8676 |
| 1. PBF | B1V9R1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.33e-59 | 1.87e-43 | 0.8501 |
| 1. PBF | C3KDV4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.29e-19 | 2.76e-27 | 0.7851 |
| 1. PBF | A6VN14 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.95e-26 | 4.47e-42 | 0.7787 |
| 1. PBF | B7LC22 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.7994 |
| 1. PBF | Q11RI7 | Small ribosomal subunit biogenesis GTPase RsgA | 1.01e-12 | 1.77e-50 | 6.97e-29 | 0.7712 |
| 1. PBF | A6L1H7 | Small ribosomal subunit biogenesis GTPase RsgA | 2.02e-14 | 4.18e-59 | 2.43e-34 | 0.7948 |
| 1. PBF | Q9HUL3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.19e-19 | 2.62e-23 | 0.773 |
| 1. PBF | Q5L0R8 | Small ribosomal subunit biogenesis GTPase RsgA | 1.22e-15 | 3.68e-68 | 1.54e-59 | 0.8559 |
| 1. PBF | Q9EV05 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.95e-27 | 5.95e-41 | 0.7807 |
| 1. PBF | Q49X02 | Small ribosomal subunit biogenesis GTPase RsgA | 1.52e-14 | 1.99e-61 | 1.87e-50 | 0.8412 |
| 1. PBF | O66555 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.18e-60 | 6.05e-43 | 0.7742 |
| 1. PBF | B6I268 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.8003 |
| 1. PBF | B1ZUH7 | Small ribosomal subunit biogenesis GTPase RsgA | 4.44e-16 | 1.57e-24 | 1.28e-23 | 0.7476 |
| 1. PBF | P67680 | Small ribosomal subunit biogenesis GTPase RsgA | 1.15e-12 | 2.45e-68 | 2.87e-40 | 0.7216 |
| 1. PBF | Q5FJH9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.44e-68 | 8.16e-50 | 0.8382 |
| 1. PBF | B6YS07 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.84e-58 | 1.31e-27 | 0.7926 |
| 1. PBF | Q8EJ79 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.91e-24 | 9.88e-38 | 0.8237 |
| 1. PBF | B2GD51 | Small ribosomal subunit biogenesis GTPase RsgA | 1.45e-14 | 7.47e-66 | 2.61e-51 | 0.8108 |
| 1. PBF | Q7UUZ6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.92e-32 | 1.65e-32 | 0.7534 |
| 1. PBF | A5FML2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.06e-57 | 1.46e-33 | 0.7799 |
| 1. PBF | Q2NIT9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.25e-56 | 7.43e-43 | 0.849 |
| 1. PBF | Q8XJL9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.89e-65 | 7.63e-46 | 0.8689 |
| 1. PBF | Q2RK09 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.77e-63 | 2.01e-43 | 0.8356 |
| 1. PBF | B7LLU5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.77e-26 | 4.15e-39 | 0.7994 |
| 1. PBF | Q1CEE7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7826 |
| 1. PBF | Q3MG79 | Small ribosomal subunit biogenesis GTPase RsgA | 1.11e-16 | 4.60e-29 | 6.41e-36 | 0.7457 |
| 1. PBF | Q895P5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.46e-68 | 5.58e-53 | 0.875 |
| 1. PBF | B1IIL4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.10e-70 | 7.17e-50 | 0.8813 |
| 1. PBF | A2BZC2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.96e-48 | 4.82e-29 | 0.7342 |
| 1. PBF | B1KX53 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.81e-71 | 1.33e-50 | 0.9014 |
| 1. PBF | Q21H92 | Small ribosomal subunit biogenesis GTPase RsgA | 9.66e-14 | 6.85e-24 | 9.16e-36 | 0.7972 |
| 1. PBF | B2RLV5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.43e-52 | 2.55e-27 | 0.7718 |
| 1. PBF | Q63S39 | Small ribosomal subunit biogenesis GTPase RsgA | 9.23e-13 | 8.09e-47 | 8.59e-40 | 0.7289 |
| 1. PBF | P47356 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.13e-53 | 4.38e-31 | 0.8381 |
| 1. PBF | Q48P11 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.95e-20 | 4.32e-28 | 0.7875 |
| 1. PBF | Q3AC25 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.14e-64 | 2.40e-47 | 0.828 |
| 1. PBF | Q8Y7F0 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 7.99e-11 | 2.46e-27 | 6.94e-23 | 0.5799 |
| 1. PBF | Q8DXR9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.19e-57 | 6.72e-56 | 0.8519 |
| 1. PBF | B2SLQ8 | Small ribosomal subunit biogenesis GTPase RsgA | 2.14e-14 | 7.31e-22 | 8.78e-23 | 0.6618 |
| 1. PBF | Q8Y680 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 0.00e+00 | 6.48e-67 | 3.04e-60 | 0.859 |
| 1. PBF | A7FMY8 | Small ribosomal subunit biogenesis GTPase RsgA | 3.61e-13 | 3.07e-29 | 3.15e-39 | 0.7784 |
| 1. PBF | Q5HPX0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 9.54e-69 | 2.76e-51 | 0.8414 |
| 1. PBF | Q9KX08 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.63e-67 | 6.34e-49 | 0.8377 |
| 1. PBF | B2THS4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.90e-60 | 9.42e-45 | 0.8623 |
| 1. PBF | B7UPY1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.7961 |
| 1. PBF | Q8CSV8 | Small ribosomal subunit biogenesis GTPase RsgA | 1.35e-14 | 3.59e-69 | 1.39e-51 | 0.8385 |
| 1. PBF | B7NTM0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.8008 |
| 1. PBF | P59946 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.60e-53 | 9.89e-28 | 0.766 |
| 1. PBF | B0JW21 | Small ribosomal subunit biogenesis GTPase RsgA | 1.32e-10 | 4.91e-24 | 4.98e-34 | 0.749 |
| 1. PBF | A6LSK4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.33e-65 | 3.62e-41 | 0.8465 |
| 1. PBF | Q83IK0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.03e-25 | 5.34e-39 | 0.7986 |
| 1. PBF | Q3KIZ8 | Small ribosomal subunit biogenesis GTPase RsgA | 4.64e-13 | 1.32e-19 | 8.10e-29 | 0.7697 |
| 1. PBF | Q7MYS7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.21e-27 | 3.06e-35 | 0.7723 |
| 1. PBF | Q38XT2 | Small ribosomal subunit biogenesis GTPase RsgA | 7.33e-15 | 1.55e-67 | 1.18e-57 | 0.8459 |
| 1. PBF | P67682 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.12e-67 | 2.44e-49 | 0.8414 |
| 1. PBF | A1KRU2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.84e-38 | 7.05e-29 | 0.7115 |
| 1. PBF | Q0IE58 | Small ribosomal subunit biogenesis GTPase RsgA | 1.11e-16 | 2.64e-44 | 2.19e-26 | 0.7176 |
| 1. PBF | Q3ANM7 | Small ribosomal subunit biogenesis GTPase RsgA | 1.11e-16 | 6.91e-47 | 8.01e-29 | 0.729 |
| 1. PBF | Q4KJ82 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.10e-20 | 1.58e-30 | 0.777 |
| 1. PBF | Q9K9Z1 | Small ribosomal subunit biogenesis GTPase RsgA | 2.66e-15 | 8.20e-59 | 3.65e-57 | 0.8706 |
| 1. PBF | B3QL20 | Small ribosomal subunit biogenesis GTPase RsgA | 3.54e-13 | 4.50e-38 | 4.98e-35 | 0.7561 |
| 1. PBF | Q9X242 | Small ribosomal subunit biogenesis GTPase RsgA | 1.22e-14 | 4.13e-57 | 5.77e-45 | 0.8081 |
| 1. PBF | Q03W20 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.60e-71 | 2.15e-56 | 0.8389 |
| 1. PBF | O34530 | Small ribosomal subunit biogenesis GTPase RsgA | 1.08e-14 | 1.91e-69 | 3.23e-52 | 0.8556 |
| 1. PBF | Q732K9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 8.53e-61 | 1.60e-57 | 0.8564 |
| 1. PBF | A7Z4J8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.67e-62 | 1.08e-53 | 0.8574 |
| 1. PBF | Q7V9C6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.19e-44 | 1.52e-22 | 0.7622 |
| 1. PBF | Q5F633 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.25e-39 | 2.03e-29 | 0.7196 |
| 1. PBF | Q9CEB7 | Small ribosomal subunit biogenesis GTPase RsgA | 9.77e-15 | 1.70e-66 | 4.92e-55 | 0.8294 |
| 1. PBF | B1IT42 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.50e-25 | 2.69e-39 | 0.8004 |
| 1. PBF | Q0SP65 | Small ribosomal subunit biogenesis GTPase RsgA | 1.02e-13 | 1.87e-50 | 3.93e-27 | 0.771 |
| 1. PBF | A0LY86 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.74e-54 | 5.09e-32 | 0.7905 |
| 1. PBF | A5EV96 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.80e-32 | 2.25e-22 | 0.7444 |
| 1. PBF | A7ZV32 | Small ribosomal subunit biogenesis GTPase RsgA | 1.85e-13 | 1.01e-25 | 4.15e-39 | 0.7963 |
| 1. PBF | Q8TKG2 | Small ribosomal subunit biogenesis GTPase RsgA | 7.52e-12 | 3.93e-22 | 4.12e-22 | 0.7172 |
| 1. PBF | Q8FAL3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.7992 |
| 1. PBF | A0Q109 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.23e-68 | 1.25e-45 | 0.8537 |
| 1. PBF | Q9ZBT9 | Small ribosomal subunit biogenesis GTPase RsgA | 7.40e-12 | 1.28e-29 | 5.82e-15 | 0.6966 |
| 1. PBF | Q8Z193 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.28e-25 | 1.26e-39 | 0.7958 |
| 1. PBF | B4T2Q8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.91e-25 | 4.75e-39 | 0.8075 |
| 1. PBF | Q662R3 | Small ribosomal subunit biogenesis GTPase RsgA | 2.80e-13 | 1.20e-46 | 4.22e-27 | 0.7351 |
| 1. PBF | Q8R9T7 | Small ribosomal subunit biogenesis GTPase RsgA | 3.89e-15 | 1.51e-62 | 4.78e-59 | 0.8535 |
| 1. PBF | A3NXT4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.68e-46 | 9.45e-40 | 0.759 |
| 1. PBF | Q5H3X2 | Small ribosomal subunit biogenesis GTPase RsgA | 8.15e-09 | 2.27e-22 | 6.91e-23 | 0.6719 |
| 1. PBF | Q3JQ14 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.28e-47 | 6.40e-39 | 0.7435 |
| 1. PBF | A5W9T9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.88e-18 | 2.59e-28 | 0.7926 |
| 1. PBF | P67683 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.12e-67 | 2.44e-49 | 0.8383 |
| 1. PBF | B5F378 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.91e-25 | 4.75e-39 | 0.8074 |
| 1. PBF | A8YVV8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.25e-67 | 2.77e-49 | 0.8345 |
| 1. PBF | B1XDR5 | Small ribosomal subunit biogenesis GTPase RsgA | 2.14e-13 | 1.50e-25 | 2.69e-39 | 0.7908 |
| 1. PBF | P67684 | Small ribosomal subunit biogenesis GTPase RsgA | 2.33e-15 | 4.63e-57 | 4.17e-62 | 0.8399 |
| 1. PBF | B4F1Z6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.07e-27 | 8.45e-36 | 0.7872 |
| 1. PBF | Q9K1A4 | Small ribosomal subunit biogenesis GTPase RsgA | 2.34e-11 | 2.02e-37 | 6.76e-29 | 0.7022 |
| 1. PBF | A9M3C0 | Small ribosomal subunit biogenesis GTPase RsgA | 4.25e-13 | 1.97e-37 | 2.74e-29 | 0.704 |
| 1. PBF | P67679 | Small ribosomal subunit biogenesis GTPase RsgA | 1.37e-12 | 2.45e-68 | 2.87e-40 | 0.7162 |
| 1. PBF | B9DPK4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.81e-64 | 7.46e-52 | 0.8386 |
| 1. PBF | Q6GHL4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.56e-68 | 9.72e-50 | 0.8409 |
| 1. PBF | P45339 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.44e-28 | 1.64e-43 | 0.7992 |
| 1. PBF | Q5LHL3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.29e-59 | 1.91e-32 | 0.7627 |
| 1. PBF | B1LQI4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.23e-25 | 2.69e-39 | 0.8108 |
| 1. PBF | Q819U6 | Small ribosomal subunit biogenesis GTPase RsgA | 7.66e-15 | 2.54e-59 | 8.31e-57 | 0.857 |
| 1. PBF | B3GZX2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.68e-30 | 1.57e-44 | 0.7708 |
| 1. PBF | A1U4D3 | Small ribosomal subunit biogenesis GTPase RsgA | 1.81e-13 | 2.78e-24 | 2.34e-24 | 0.7979 |
| 1. PBF | A4IM52 | Small ribosomal subunit biogenesis GTPase RsgA | 3.11e-15 | 3.69e-72 | 4.55e-56 | 0.8556 |
| 1. PBF | A5UBG2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.82e-28 | 1.59e-43 | 0.7973 |
| 1. PBF | B2K1Z6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7774 |
| 1. PBF | B8I262 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.94e-58 | 2.46e-46 | 0.7948 |
| 1. PBF | B0BS35 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.68e-30 | 1.57e-44 | 0.77 |
| 1. PBF | Q97IC1 | Small ribosomal subunit biogenesis GTPase RsgA | 6.66e-16 | 4.08e-69 | 3.42e-50 | 0.8628 |
| 1. PBF | A7GG89 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.10e-70 | 7.17e-50 | 0.8982 |
| 1. PBF | C1FSS3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.50e-71 | 8.22e-51 | 0.8943 |
| 1. PBF | A5UFF1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.85e-28 | 1.80e-44 | 0.796 |
| 1. PBF | A5VKQ1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.91e-67 | 1.67e-56 | 0.8637 |
| 1. PBF | Q4A8L3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.48e-63 | 3.10e-45 | 0.8556 |
| 1. PBF | B1JMP8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7779 |
| 1. PBF | A8FD43 | Small ribosomal subunit biogenesis GTPase RsgA | 2.56e-14 | 2.24e-66 | 3.65e-53 | 0.8397 |
| 1. PBF | Q2YB53 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.65e-53 | 4.46e-39 | 0.7148 |
| 1. PBF | Q8ER21 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 1.11e-16 | 9.84e-65 | 5.77e-65 | 0.8664 |
| 1. PBF | B7MSX6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.96e-26 | 1.77e-39 | 0.7981 |
| 1. PBF | A3MYK2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.68e-30 | 1.57e-44 | 0.7615 |
| 1. PBF | Q8XDP1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.7965 |
| 1. PBF | Q1C0Z2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.07e-29 | 3.15e-39 | 0.7866 |
| 1. PBF | Q8ZKB0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.91e-25 | 4.75e-39 | 0.8042 |
| 1. PBF | C5CSN3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.84e-53 | 7.49e-36 | 0.7505 |
| 1. PBF | B2VCV1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 6.72e-26 | 4.17e-31 | 0.8119 |
| 1. PBF | Q7UA74 | Small ribosomal subunit biogenesis GTPase RsgA | 1.11e-16 | 5.22e-54 | 2.87e-24 | 0.735 |
| 1. PBF | Q7VMF1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.55e-28 | 1.12e-37 | 0.7759 |
| 1. PBF | Q72MK0 | Small ribosomal subunit biogenesis GTPase RsgA | 4.54e-10 | 5.45e-29 | 1.25e-14 | 0.6886 |
| 1. PBF | B4TSE3 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.88e-25 | 4.33e-39 | 0.8053 |
| 1. PBF | Q8YK41 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 6.83e-12 | 7.17e-27 | 2.05e-18 | 0.5863 |
| 1. PBF | Q9PQS5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.47e-59 | 3.84e-42 | 0.8344 |
| 1. PBF | Q98PN8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.11e-62 | 2.74e-49 | 0.8349 |
| 1. PBF | Q8PGW9 | Small ribosomal subunit biogenesis GTPase RsgA | 1.03e-14 | 5.03e-23 | 1.30e-22 | 0.6673 |
| 1. PBF | Q601H2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.92e-62 | 8.44e-50 | 0.8297 |
| 1. PBF | Q88WK9 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 0.00e+00 | 4.48e-69 | 6.27e-54 | 0.8385 |
| 1. PBF | Q0I447 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.05e-25 | 7.01e-40 | 0.7964 |
| 1. PBF | B2JF36 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.61e-43 | 1.03e-36 | 0.7638 |
| 1. PBF | A5N7Y7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.86e-70 | 3.44e-49 | 0.887 |
| 1. PBF | Q9A1H9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.70e-64 | 8.62e-59 | 0.8425 |
| 1. PBF | B9K7Z8 | Small ribosomal subunit biogenesis GTPase RsgA | 3.45e-14 | 1.35e-54 | 1.93e-43 | 0.8315 |
| 1. PBF | Q8P2N7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.65e-64 | 5.63e-60 | 0.8517 |
| 1. PBF | A6TRW0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.21e-58 | 1.27e-55 | 0.8451 |
| 1. PBF | Q13VF6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.62e-53 | 3.37e-34 | 0.7426 |
| 1. PBF | A5I4T1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.95e-71 | 1.97e-51 | 0.8792 |
| 1. PBF | Q6YR36 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.51e-53 | 1.25e-41 | 0.838 |
| 1. PBF | C5A1F5 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.50e-25 | 2.69e-39 | 0.7973 |
| 1. PBF | B2V4B8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.18e-61 | 2.62e-44 | 0.8667 |
| 1. PBF | Q98JM4 | Small ribosomal subunit biogenesis GTPase RsgA | 1.71e-14 | 1.92e-29 | 1.31e-17 | 0.689 |
| 1. PBF | B5Z2H0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.01e-25 | 4.15e-39 | 0.7977 |
| 1. PBF | A6LHB6 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.57e-57 | 2.64e-28 | 0.7973 |
| 1. PBF | Q81WH7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.97e-61 | 1.71e-57 | 0.849 |
| 1. PBF | B9E1E8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.86e-70 | 3.44e-49 | 0.8928 |
| 1. PBF | Q71YJ7 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 0.00e+00 | 1.54e-66 | 1.01e-60 | 0.884 |
| 1. PBF | Q9CMD1 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.91e-26 | 1.15e-39 | 0.7757 |
| 1. PBF | Q8KC52 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 7.99e-38 | 6.16e-36 | 0.7388 |
| 1. PBF | B7J132 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.18e-49 | 6.06e-28 | 0.7597 |
| 1. PBF | C3L0K4 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.90e-70 | 1.95e-51 | 0.8715 |
| 1. PBF | A1JIQ7 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 3.56e-29 | 1.05e-38 | 0.7846 |
| 1. PBF | Q4QJM9 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.35e-28 | 1.73e-43 | 0.7922 |
| 1. PBF | Q4AAI2 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.84e-60 | 9.70e-50 | 0.8538 |
| 1. PBF | Q9JSM2 | Small ribosomal subunit biogenesis GTPase RsgA | 2.87e-13 | 4.69e-39 | 2.89e-29 | 0.7057 |
| 1. PBF | Q3BPG1 | Small ribosomal subunit biogenesis GTPase RsgA | 2.32e-14 | 5.22e-23 | 1.52e-22 | 0.666 |
| 1. PBF | A6TH78 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.15e-26 | 1.02e-36 | 0.7966 |
| 1. PBF | Q92AI9 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 0.00e+00 | 3.48e-69 | 5.77e-59 | 0.8717 |
| 1. PBF | Q87L00 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 0.00e+00 | 7.38e-28 | 3.50e-40 | 0.7924 |
| 1. PBF | Q03FX9 | Small ribosomal subunit biogenesis GTPase RsgA | 2.66e-15 | 9.38e-56 | 4.15e-53 | 0.841 |
| 1. PBF | C6DFN0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.97e-25 | 7.93e-34 | 0.7842 |
| 1. PBF | A3NBZ8 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.68e-46 | 9.45e-40 | 0.7527 |
| 1. PBF | P67678 | Small ribosomal subunit biogenesis GTPase RsgA | 1.29e-12 | 2.45e-68 | 2.87e-40 | 0.7199 |
| 1. PBF | P67685 | Small ribosomal subunit biogenesis GTPase RsgA | 1.23e-14 | 4.63e-57 | 4.17e-62 | 0.8414 |
| 1. PBF | B1JAE3 | Small ribosomal subunit biogenesis GTPase RsgA | 1.64e-13 | 5.61e-19 | 1.29e-28 | 0.786 |
| 1. PBF | Q92C22 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 1.35e-14 | 1.31e-29 | 1.29e-21 | 0.6924 |
| 1. PBF | Q2P6S9 | Small ribosomal subunit biogenesis GTPase RsgA | 1.03e-10 | 2.27e-22 | 6.91e-23 | 0.6631 |
| 1. PBF | A2C5M0 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 4.19e-44 | 1.63e-21 | 0.7656 |
| 1. PBF | P59945 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 2.58e-54 | 2.96e-34 | 0.8382 |
| 1. PBF | B2G835 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 5.91e-67 | 1.67e-56 | 0.8628 |
| 4. PB | B2I7R5 | Small ribosomal subunit biogenesis GTPase RsgA | 1.19e-14 | 2.99e-26 | 6.93e-19 | NA |
| 4. PB | Q7MGA2 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 1.03e-14 | 6.59e-25 | 2.60e-18 | NA |
| 4. PB | Q9PFV1 | Small ribosomal subunit biogenesis GTPase RsgA | 6.88e-15 | 2.42e-21 | 4.28e-19 | NA |
| 4. PB | Q4V399 | Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial | 6.92e-11 | 6.27e-10 | 3.87e-19 | NA |
| 4. PB | B0U466 | Small ribosomal subunit biogenesis GTPase RsgA | 2.78e-14 | 3.56e-27 | 6.03e-19 | NA |
| 4. PB | Q87B73 | Small ribosomal subunit biogenesis GTPase RsgA | 8.60e-11 | 5.57e-21 | 9.79e-19 | NA |
| 4. PB | Q8A8H7 | Small ribosomal subunit biogenesis GTPase RsgA 1 | 1.11e-16 | 2.49e-33 | 2.39e-22 | NA |
| 4. PB | P39286 | Small ribosomal subunit biogenesis GTPase RsgA | 0.00e+00 | 1.50e-25 | 2.69e-39 | NA |
| 4. PB | Q87FP9 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 1.77e-14 | 3.42e-23 | 9.77e-20 | NA |
| 4. PB | Q8D4Q0 | Small ribosomal subunit biogenesis GTPase RsgA 2 | 1.03e-14 | 8.06e-26 | 6.08e-18 | NA |
| 5. P | O74776 | Mitochondrial GTPase 1 | 1.35e-02 | 4.26e-03 | NA | NA |
| 5. P | Q8H1F6 | DAR GTPase 3, chloroplastic | 4.69e-03 | 9.46e-04 | NA | NA |
| 5. P | B7GGD6 | Ribosome biogenesis GTPase A | 1.30e-03 | 1.97e-02 | NA | NA |
| 5. P | Q8SUT1 | Guanine nucleotide-binding protein-like 3-like protein | 6.62e-03 | 1.39e-04 | NA | NA |
| 5. P | P54453 | Uncharacterized protein YqeH | 6.47e-02 | 4.76e-03 | NA | NA |
| 5. P | C5D8U8 | Ribosome biogenesis GTPase A | 2.70e-03 | 4.95e-03 | NA | NA |
| 5. P | D5DJL5 | Ribosome biogenesis GTPase A | 1.38e-03 | 2.45e-02 | NA | NA |
| 7. B | Q03QN8 | Probable GTP-binding protein EngB | 7.93e-03 | NA | 0.011 | NA |
| 7. B | Q0I1G1 | Probable GTP-binding protein EngB | 2.97e-03 | NA | 0.030 | NA |