Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54691.1
JCVISYN3A_0264
Uncharacterized serine/threonine protein kinase.
M. mycoides homolog: Q6MTT8.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 1783
Unique PROST Go: 132
Unique BLAST Go: 1057
Unique Foldseek Go: 41
Total Homologs: 4006
Unique PROST Homologs: 32
Unique BLAST Homologs: 2732
Unique Foldseek Homologs: 61
Structures and Sequence Alignment
The best structural homolog that predicted by 3. BF was
A2BD05
(Serine/threonine-protein kinase Nek6) with a FATCAT P-Value: 0 and RMSD of 2.83 angstrom. The sequence alignment identity is 23.2%.
Structural alignment shown in left. Query protein AVX54691.1 colored as red in alignment, homolog A2BD05 colored as blue.
Query protein AVX54691.1 is also shown in right top, homolog A2BD05 showed in right bottom. They are colored based on secondary structures.
AVX54691.1 -------MPK--TKKDL----G-INKEELLN--QVVNNRYKL----I-KYLNSGAFAVVFKA--LDLD-ASV-LEKKDVFVAVKIILKAKNKNIETIKKR 75 A2BD05 MAGQPSHMPHGGSPNNLCHTPGPAHPPDPQRHPNALSFRCSLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFE----MMDAKARQ-DCVK-- 92 AVX54691.1 LFLETNTFAKLSFSKNIVKMKDVFSWQNYYVIVMELIEGADLS---KKFNAYNNVLSNKEFLY-YFLQITKGLKEIHDNNIIHRDVKPANILITNDSKVR 171 A2BD05 ---EIGLLKQLN-HPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPER-TVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVK 187 AVX54691.1 ISDFGISKIKSIILDD---HHNHISPGTPRYTAPEQFINFESRKDAFYFESDIYSIGVIMYEFLTGSMLYLN---YGSNHTSSKEKERTN-FQ--QHILK 262 A2BD05 LGDLGLGRFFS---SETTAAHSLV--GTPYYMSPERI-----HENGYNFKSDIWSLGCLLYE-----MAALQSPFYG---------DKMNLFSLCQKIEQ 263 AVX54691.1 -DITRPREINP--NISQALENII-MKCLAKDYKNRYHRFDQIIEDLEQAKQQPDVNIDFPNMWWEDENYLNIKNNNTLKYKYFFKNTNFKYFLFWISIVI 358 A2BD05 CDY--P-PL-PGEHYSEKLRELVSM-CIYPD-PNQ--RPD--IGYVHQVARQMHV--------WTSST-------------------------------- 313 AVX54691.1 SLFIIFLIVLILK 371 A2BD05 ------------- 313
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0008284 | positive regulation of cell population proliferation |
| 1. PBF | GO:0019901 | protein kinase binding |
| 1. PBF | GO:0106311 | |
| 1. PBF | GO:0005516 | calmodulin binding |
| 1. PBF | GO:0032147 | activation of protein kinase activity |
| 1. PBF | GO:0016055 | Wnt signaling pathway |
| 1. PBF | GO:0001707 | mesoderm formation |
| 1. PBF | GO:0097472 | cyclin-dependent protein kinase activity |
| 1. PBF | GO:0007231 | osmosensory signaling pathway |
| 1. PBF | GO:0004707 | MAP kinase activity |
| 1. PBF | GO:0050772 | positive regulation of axonogenesis |
| 1. PBF | GO:0005634 | nucleus |
| 1. PBF | GO:0097129 | cyclin D2-CDK4 complex |
| 1. PBF | GO:0045104 | intermediate filament cytoskeleton organization |
| 1. PBF | GO:0035174 | histone serine kinase activity |
| 1. PBF | GO:0004693 | cyclin-dependent protein serine/threonine kinase activity |
| 1. PBF | GO:0004679 | AMP-activated protein kinase activity |
| 1. PBF | GO:0006468 | protein phosphorylation |
| 1. PBF | GO:0004691 | cAMP-dependent protein kinase activity |
| 1. PBF | GO:0005576 | extracellular region |
| 1. PBF | GO:0090166 | Golgi disassembly |
| 1. PBF | GO:0030332 | cyclin binding |
| 1. PBF | GO:0051896 | regulation of protein kinase B signaling |
| 1. PBF | GO:0035175 | histone kinase activity (H3-S10 specific) |
| 1. PBF | GO:0009931 | calcium-dependent protein serine/threonine kinase activity |
| 1. PBF | GO:0043987 | histone H3-S10 phosphorylation |
| 1. PBF | GO:0070816 | phosphorylation of RNA polymerase II C-terminal domain |
| 1. PBF | GO:0018107 | peptidyl-threonine phosphorylation |
| 1. PBF | GO:0045667 | regulation of osteoblast differentiation |
| 1. PBF | GO:0046626 | regulation of insulin receptor signaling pathway |
| 1. PBF | GO:0050994 | regulation of lipid catabolic process |
| 1. PBF | GO:0004672 | protein kinase activity |
| 1. PBF | GO:0005815 | microtubule organizing center |
| 1. PBF | GO:0004708 | MAP kinase kinase activity |
| 1. PBF | GO:0010737 | protein kinase A signaling |
| 1. PBF | GO:0000086 | G2/M transition of mitotic cell cycle |
| 1. PBF | GO:0051256 | mitotic spindle midzone assembly |
| 1. PBF | GO:0046827 | positive regulation of protein export from nucleus |
| 1. PBF | GO:0051321 | meiotic cell cycle |
| 1. PBF | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 1. PBF | GO:0060291 | long-term synaptic potentiation |
| 1. PBF | GO:0070985 | transcription factor TFIIK complex |
| 1. PBF | GO:1905818 | regulation of chromosome separation |
| 1. PBF | GO:0007254 | JNK cascade |
| 1. PBF | GO:0018105 | peptidyl-serine phosphorylation |
| 1. PBF | GO:0000776 | kinetochore |
| 1. PBF | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PBF | GO:0034599 | cellular response to oxidative stress |
| 1. PBF | GO:0004689 | phosphorylase kinase activity |
| 1. PBF | GO:0030878 | thyroid gland development |
| 1. PBF | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 1. PBF | GO:0033598 | mammary gland epithelial cell proliferation |
| 1. PBF | GO:0071374 | cellular response to parathyroid hormone stimulus |
| 1. PBF | GO:0031143 | pseudopodium |
| 1. PBF | GO:0004715 | non-membrane spanning protein tyrosine kinase activity |
| 1. PBF | GO:0051233 | spindle midzone |
| 1. PBF | GO:0010520 | regulation of reciprocal meiotic recombination |
| 1. PBF | GO:2001165 | positive regulation of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues |
| 1. PBF | GO:0000307 | cyclin-dependent protein kinase holoenzyme complex |
| 1. PBF | GO:0042752 | regulation of circadian rhythm |
| 1. PBF | GO:0070849 | response to epidermal growth factor |
| 1. PBF | GO:0036091 | positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 1. PBF | GO:0004714 | transmembrane receptor protein tyrosine kinase activity |
| 1. PBF | GO:0005952 | cAMP-dependent protein kinase complex |
| 1. PBF | GO:0004712 | protein serine/threonine/tyrosine kinase activity |
| 1. PBF | GO:0010971 | positive regulation of G2/M transition of mitotic cell cycle |
| 1. PBF | GO:0106310 | protein serine kinase activity |
| 1. PBF | GO:0003723 | RNA binding |
| 1. PBF | GO:1904637 | cellular response to ionomycin |
| 1. PBF | GO:0036064 | ciliary basal body |
| 1. PBF | GO:0010972 | negative regulation of G2/M transition of mitotic cell cycle |
| 1. PBF | GO:0038066 | p38MAPK cascade |
| 1. PBF | GO:1900182 | positive regulation of protein localization to nucleus |
| 1. PBF | GO:1904628 | cellular response to phorbol 13-acetate 12-myristate |
| 1. PBF | GO:0010515 | negative regulation of induction of conjugation with cellular fusion |
| 1. PBF | GO:0070691 | P-TEFb complex |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:2000810 | regulation of bicellular tight junction assembly |
| 1. PBF | GO:0051403 | stress-activated MAPK cascade |
| 1. PBF | GO:0005964 | phosphorylase kinase complex |
| 1. PBF | GO:0034237 | protein kinase A regulatory subunit binding |
| 1. PBF | GO:0050852 | T cell receptor signaling pathway |
| 1. PBF | GO:0004674 | protein serine/threonine kinase activity |
| 1. PBF | GO:0051445 | regulation of meiotic cell cycle |
| 1. PBF | GO:0046777 | protein autophosphorylation |
| 1. PBF | GO:0004687 | myosin light chain kinase activity |
| 1. PBF | GO:0000165 | MAPK cascade |
| 1. PBF | GO:0030295 | protein kinase activator activity |
| 1. PBF | GO:0005813 | centrosome |
| 1. PBF | GO:0060324 | face development |
| 1. PBF | GO:0048538 | thymus development |
| 1. PBF | GO:0035556 | intracellular signal transduction |
| 1. PBF | GO:0075018 | positive regulation of appressorium formation |
| 1. PBF | GO:0043408 | regulation of MAPK cascade |
| 1. PBF | GO:0071958 | new mitotic spindle pole body |
| 1. PBF | GO:1903715 | regulation of aerobic respiration |
| 1. PBF | GO:0006974 | cellular response to DNA damage stimulus |
| 1. PBF | GO:0006915 | apoptotic process |
| 1. PBF | GO:0071620 | phosphorylation of RNA polymerase II C-terminal domain serine 5 residues |
| 1. PBF | GO:0016592 | mediator complex |
| 1. PBF | GO:0004683 | calmodulin-dependent protein kinase activity |
| 1. PBF | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 1. PBF | GO:0032133 | chromosome passenger complex |
| 1. PBF | GO:0004713 | protein tyrosine kinase activity |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0001669 | acrosomal vesicle |
| 1. PBF | GO:0045732 | positive regulation of protein catabolic process |
| 1. PBF | GO:0008353 | RNA polymerase II CTD heptapeptide repeat kinase activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0007165 | signal transduction |
| 1. PBF | GO:1902018 | negative regulation of cilium assembly |
| 1. PBF | GO:0032465 | regulation of cytokinesis |
| 1. PBF | GO:0042307 | positive regulation of protein import into nucleus |
| 1. PBF | GO:1901621 | negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning |
| 1. PBF | GO:0030010 | establishment of cell polarity |
| 1. PBF | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PBF | GO:0008024 | cyclin/CDK positive transcription elongation factor complex |
| 1. PBF | GO:0070613 | regulation of protein processing |
| 1. PBF | GO:0016607 | nuclear speck |
| 1. PBF | GO:1990625 | negative regulation of cytoplasmic translational initiation in response to stress |
| 1. PBF | GO:0048511 | rhythmic process |
| 1. PBF | GO:0050321 | tau-protein kinase activity |
| 1. PBF | GO:0005956 | protein kinase CK2 complex |
| 2. PF | GO:0051301 | cell division |
| 2. PF | GO:0036126 | sperm flagellum |
| 2. PF | GO:0007049 | cell cycle |
| 2. PF | GO:0106259 | cell-to-cell migration in host |
| 3. BF | GO:0051316 | attachment of spindle microtubules to kinetochore involved in meiotic chromosome segregation |
| 3. BF | GO:0030549 | acetylcholine receptor activator activity |
| 3. BF | GO:0043405 | regulation of MAP kinase activity |
| 3. BF | GO:0051296 | establishment of meiotic spindle orientation |
| 3. BF | GO:0010825 | positive regulation of centrosome duplication |
| 3. BF | GO:0060258 | negative regulation of filamentous growth |
| 3. BF | GO:0010827 | regulation of glucose transmembrane transport |
| 3. BF | GO:0030950 | establishment or maintenance of actin cytoskeleton polarity |
| 3. BF | GO:0033674 | positive regulation of kinase activity |
| 3. BF | GO:0070693 | P-TEFb-cap methyltransferase complex |
| 3. BF | GO:0010767 | regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage |
| 3. BF | GO:0072178 | nephric duct morphogenesis |
| 3. BF | GO:0032956 | regulation of actin cytoskeleton organization |
| 3. BF | GO:0097635 | extrinsic component of autophagosome membrane |
| 3. BF | GO:0043410 | positive regulation of MAPK cascade |
| 3. BF | GO:0046599 | regulation of centriole replication |
| 3. BF | GO:0031397 | negative regulation of protein ubiquitination |
| 3. BF | GO:0060341 | regulation of cellular localization |
| 3. BF | GO:0061908 | phagophore |
| 3. BF | GO:0004697 | protein kinase C activity |
| 3. BF | GO:0045087 | innate immune response |
| 3. BF | GO:1902103 | negative regulation of metaphase/anaphase transition of meiotic cell cycle |
| 3. BF | GO:0005975 | carbohydrate metabolic process |
| 3. BF | GO:0002029 | desensitization of G protein-coupled receptor signaling pathway |
| 3. BF | GO:0042113 | B cell activation |
| 3. BF | GO:0061709 | reticulophagy |
| 3. BF | GO:0005030 | neurotrophin receptor activity |
| 3. BF | GO:1901888 | regulation of cell junction assembly |
| 3. BF | GO:0007052 | mitotic spindle organization |
| 3. BF | GO:1905098 | negative regulation of guanyl-nucleotide exchange factor activity |
| 3. BF | GO:0009838 | abscission |
| 3. BF | GO:0048568 | embryonic organ development |
| 3. BF | GO:0004692 | cGMP-dependent protein kinase activity |
| 3. BF | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. BF | GO:0000186 | obsolete activation of MAPKK activity |
| 3. BF | GO:0005938 | cell cortex |
| 3. BF | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. BF | GO:0004709 | MAP kinase kinase kinase activity |
| 3. BF | GO:0007399 | nervous system development |
| 3. BF | GO:0032154 | cleavage furrow |
| 3. BF | GO:0042585 | germinal vesicle |
| 3. BF | GO:0051721 | protein phosphatase 2A binding |
| 3. BF | GO:0051497 | negative regulation of stress fiber assembly |
| 3. BF | GO:0036089 | cleavage furrow formation |
| 3. BF | GO:0097194 | execution phase of apoptosis |
| 3. BF | GO:0010831 | positive regulation of myotube differentiation |
| 3. BF | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. BF | GO:0098535 | de novo centriole assembly involved in multi-ciliated epithelial cell differentiation |
| 3. BF | GO:0031755 | Edg-2 lysophosphatidic acid receptor binding |
| 3. BF | GO:0045743 | positive regulation of fibroblast growth factor receptor signaling pathway |
| 3. BF | GO:2000251 | positive regulation of actin cytoskeleton reorganization |
| 3. BF | GO:0035773 | insulin secretion involved in cellular response to glucose stimulus |
| 3. BF | GO:0060828 | regulation of canonical Wnt signaling pathway |
| 3. BF | GO:0032467 | positive regulation of cytokinesis |
| 3. BF | GO:0007118 | budding cell apical bud growth |
| 3. BF | GO:0048011 | neurotrophin TRK receptor signaling pathway |
| 3. BF | GO:0007411 | axon guidance |
| 3. BF | GO:0030054 | cell junction |
| 3. BF | GO:0046601 | positive regulation of centriole replication |
| 3. BF | GO:0007172 | signal complex assembly |
| 3. BF | GO:1902042 | negative regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. BF | GO:1905062 | positive regulation of cardioblast proliferation |
| 3. BF | GO:0004703 | G protein-coupled receptor kinase activity |
| 3. BF | GO:1904237 | positive regulation of substrate-dependent cell migration, cell attachment to substrate |
| 3. BF | GO:0004383 | guanylate cyclase activity |
| 3. BF | GO:0070495 | negative regulation of thrombin-activated receptor signaling pathway |
| 3. BF | GO:0051965 | positive regulation of synapse assembly |
| 3. BF | GO:0120095 | vacuole-isolation membrane contact site |
| 3. BF | GO:1901299 | negative regulation of hydrogen peroxide-mediated programmed cell death |
| 3. BF | GO:0003157 | endocardium development |
| 3. BF | GO:0017134 | fibroblast growth factor binding |
| 3. BF | GO:0047322 | [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity |
| 3. BF | GO:0019908 | nuclear cyclin-dependent protein kinase holoenzyme complex |
| 3. BF | GO:0005004 | GPI-linked ephrin receptor activity |
| 3. BF | GO:1905824 | positive regulation of mitotic sister chromatid arm separation |
| 3. BF | GO:0044774 | mitotic DNA integrity checkpoint signaling |
| 3. BF | GO:0043332 | mating projection tip |
| 3. BF | GO:0050254 | rhodopsin kinase activity |
| 3. BF | GO:1902033 | regulation of hematopoietic stem cell proliferation |
| 3. BF | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 3. BF | GO:0060800 | regulation of cell differentiation involved in embryonic placenta development |
| 3. BF | GO:0071226 | cellular response to molecule of fungal origin |
| 3. BF | GO:0020005 | symbiont-containing vacuole membrane |
| 3. BF | GO:0050770 | regulation of axonogenesis |
| 3. BF | GO:2000615 | regulation of histone H3-K9 acetylation |
| 3. BF | GO:0032515 | negative regulation of phosphoprotein phosphatase activity |
| 3. BF | GO:0005005 | transmembrane-ephrin receptor activity |
| 3. BF | GO:0042169 | SH2 domain binding |
| 3. BF | GO:0060215 | primitive hemopoiesis |
| 3. BF | GO:1902951 | negative regulation of dendritic spine maintenance |
| 3. BF | GO:0001100 | negative regulation of exit from mitosis |
| 3. BF | GO:0031647 | regulation of protein stability |
| 3. BF | GO:0042501 | serine phosphorylation of STAT protein |
| 3. BF | GO:0034727 | piecemeal microautophagy of the nucleus |
| 3. BF | GO:0000920 | septum digestion after cytokinesis |
| 3. BF | GO:0043005 | neuron projection |
| 3. BF | GO:2000401 | regulation of lymphocyte migration |
| 3. BF | GO:0071619 | phosphorylation of RNA polymerase II C-terminal domain serine 2 residues |
| 3. BF | GO:0034503 | protein localization to nucleolar rDNA repeats |
| 3. BF | GO:0043125 | ErbB-3 class receptor binding |
| 3. BF | GO:0030182 | neuron differentiation |
| 3. BF | GO:0000922 | spindle pole |
| 3. BF | GO:0051650 | establishment of vesicle localization |
| 3. BF | GO:0002554 | serotonin secretion by platelet |
| 3. BF | GO:0010829 | negative regulation of glucose transmembrane transport |
| 3. BF | GO:0046602 | regulation of mitotic centrosome separation |
| 3. BF | GO:0060397 | growth hormone receptor signaling pathway via JAK-STAT |
| 3. BF | GO:0004698 | calcium-dependent protein kinase C activity |
| 3. BF | GO:0033316 | meiotic spindle assembly checkpoint signaling |
| 3. BF | GO:0048755 | branching morphogenesis of a nerve |
| 3. BF | GO:0030424 | axon |
| 3. BF | GO:0002366 | leukocyte activation involved in immune response |
| 3. BF | GO:1990316 | Atg1/ULK1 kinase complex |
| 3. BF | GO:0034501 | protein localization to kinetochore |
| 3. BF | GO:0035173 | histone kinase activity |
| 3. BF | GO:0005525 | GTP binding |
| 3. BF | GO:0022407 | regulation of cell-cell adhesion |
| 3. BF | GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein |
| 3. BF | GO:0042327 | positive regulation of phosphorylation |
| 3. BF | GO:1990860 | Pho85-Pho80 CDK-cyclin complex |
| 3. BF | GO:0016941 | natriuretic peptide receptor activity |
| 3. BF | GO:0035994 | response to muscle stretch |
| 3. BF | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. BF | GO:1905664 | regulation of calcium ion import across plasma membrane |
| 3. BF | GO:0016323 | basolateral plasma membrane |
| 3. BF | GO:0005876 | spindle microtubule |
| 3. BF | GO:0017147 | Wnt-protein binding |
| 3. BF | GO:0035186 | syncytial blastoderm mitotic cell cycle |
| 3. BF | GO:1904967 | regulation of monopolar spindle attachment to meiosis I kinetochore |
| 3. BF | GO:0032971 | regulation of muscle filament sliding |
| 3. BF | GO:0010543 | regulation of platelet activation |
| 3. BF | GO:0034644 | cellular response to UV |
| 3. BF | GO:0002250 | adaptive immune response |
| 3. BF | GO:0000131 | incipient cellular bud site |
| 3. BF | GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway |
| 3. BF | GO:0050870 | positive regulation of T cell activation |
| 3. BF | GO:1901741 | positive regulation of myoblast fusion |
| 3. BF | GO:0009252 | peptidoglycan biosynthetic process |
| 3. BF | GO:0050853 | B cell receptor signaling pathway |
| 3. BF | GO:0140281 | positive regulation of mitotic division septum assembly |
| 3. BF | GO:0071224 | cellular response to peptidoglycan |
| 3. BF | GO:0050798 | activated T cell proliferation |
| 3. BF | GO:0004711 | ribosomal protein S6 kinase activity |
| 3. BF | GO:0090153 | regulation of sphingolipid biosynthetic process |
| 3. BF | GO:0051225 | spindle assembly |
| 3. BF | GO:0031616 | spindle pole centrosome |
| 3. BF | GO:0035260 | internal genitalia morphogenesis |
| 3. BF | GO:0099104 | potassium channel activator activity |
| 3. BF | GO:1904846 | negative regulation of establishment of bipolar cell polarity |
| 3. BF | GO:0006939 | smooth muscle contraction |
| 3. BF | GO:0031290 | retinal ganglion cell axon guidance |
| 3. BF | GO:1990385 | meiotic spindle midzone |
| 3. BF | GO:0060631 | regulation of meiosis I |
| 3. BF | GO:0001653 | peptide receptor activity |
| 3. BF | GO:0006909 | phagocytosis |
| 3. BF | GO:0032298 | positive regulation of DNA-dependent DNA replication initiation |
| 3. BF | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. BF | GO:0070848 | response to growth factor |
| 3. BF | GO:1902412 | regulation of mitotic cytokinesis |
| 3. BF | GO:0035402 | histone kinase activity (H3-T11 specific) |
| 3. BF | GO:0004706 | JUN kinase kinase kinase activity |
| 3. BF | GO:0050849 | negative regulation of calcium-mediated signaling |
| 3. BF | GO:1904668 | positive regulation of ubiquitin protein ligase activity |
| 3. BF | GO:0043087 | regulation of GTPase activity |
| 3. BF | GO:0090330 | regulation of platelet aggregation |
| 3. BF | GO:0071073 | positive regulation of phospholipid biosynthetic process |
| 3. BF | GO:0006972 | hyperosmotic response |
| 3. BF | GO:0044805 | late nucleophagy |
| 3. BF | GO:0032092 | positive regulation of protein binding |
| 3. BF | GO:0005008 | hepatocyte growth factor-activated receptor activity |
| 3. BF | GO:0043313 | regulation of neutrophil degranulation |
| 3. BF | GO:0008270 | zinc ion binding |
| 3. BF | GO:0043369 | CD4-positive or CD8-positive, alpha-beta T cell lineage commitment |
| 3. BF | GO:0000083 | regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 3. BF | GO:0043066 | negative regulation of apoptotic process |
| 3. BF | GO:0032095 | regulation of response to food |
| 3. BF | GO:0044878 | mitotic cytokinesis checkpoint signaling |
| 3. BF | GO:0072499 | photoreceptor cell axon guidance |
| 3. BF | GO:0032928 | regulation of superoxide anion generation |
| 3. BF | GO:0043235 | receptor complex |
| 3. BF | GO:0007095 | mitotic G2 DNA damage checkpoint signaling |
| 3. BF | GO:0005814 | centriole |
| 3. BF | GO:0035409 | histone H3-Y41 phosphorylation |
| 3. BF | GO:1901081 | negative regulation of relaxation of smooth muscle |
| 3. BF | GO:0043121 | neurotrophin binding |
| 3. BF | GO:0031016 | pancreas development |
| 3. BF | GO:0016241 | regulation of macroautophagy |
| 3. BF | GO:1903380 | positive regulation of mitotic chromosome condensation |
| 3. BF | GO:0060996 | dendritic spine development |
| 3. BF | GO:0050405 | [acetyl-CoA carboxylase] kinase activity |
| 3. BF | GO:0060997 | dendritic spine morphogenesis |
| 3. BF | GO:1901673 | regulation of mitotic spindle assembly |
| 3. BF | GO:0042976 | activation of Janus kinase activity |
| 3. BF | GO:0031434 | mitogen-activated protein kinase kinase binding |
| 3. BF | GO:2000707 | positive regulation of dense core granule biogenesis |
| 3. BF | GO:0120110 | interphase mitotic telomere clustering |
| 3. BF | GO:0070561 | vitamin D receptor signaling pathway |
| 3. BF | GO:0034307 | regulation of ascospore formation |
| 3. BF | GO:0000242 | pericentriolar material |
| 3. BF | GO:0097156 | fasciculation of motor neuron axon |
| 3. BF | GO:0030496 | midbody |
| 3. BF | GO:1900449 | regulation of glutamate receptor signaling pathway |
| 3. BF | GO:0140429 | positive regulation of mitotic sister chromatid biorientation |
| 3. BF | GO:0007147 | female meiosis II |
| 3. BF | GO:0002903 | negative regulation of B cell apoptotic process |
| 3. BF | GO:0000278 | mitotic cell cycle |
| 3. BF | GO:0055106 | ubiquitin-protein transferase regulator activity |
| 3. BF | GO:0030553 | cGMP binding |
| 3. BF | GO:0071526 | semaphorin-plexin signaling pathway |
| 3. BF | GO:0035329 | hippo signaling |
| 3. BF | GO:0014820 | tonic smooth muscle contraction |
| 3. BF | GO:0050681 | androgen receptor binding |
| 3. BF | GO:0045719 | negative regulation of glycogen biosynthetic process |
| 3. BF | GO:0018108 | peptidyl-tyrosine phosphorylation |
| 3. BF | GO:0007100 | mitotic centrosome separation |
| 3. BF | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. BF | GO:0030154 | cell differentiation |
| 3. BF | GO:0060237 | regulation of fungal-type cell wall organization |
| 3. BF | GO:0050918 | positive chemotaxis |
| 3. BF | GO:0045663 | positive regulation of myoblast differentiation |
| 3. BF | GO:0050861 | positive regulation of B cell receptor signaling pathway |
| 3. BF | GO:0072518 | Rho-dependent protein serine/threonine kinase activity |
| 3. BF | GO:0005176 | ErbB-2 class receptor binding |
| 3. BF | GO:0001042 | RNA polymerase I core binding |
| 3. BF | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 3. BF | GO:0033138 | positive regulation of peptidyl-serine phosphorylation |
| 3. BF | GO:0007140 | male meiotic nuclear division |
| 3. BF | GO:0006355 | regulation of transcription, DNA-templated |
| 3. BF | GO:0090237 | regulation of arachidonic acid secretion |
| 3. BF | GO:0047696 | beta-adrenergic receptor kinase activity |
| 3. BF | GO:0070851 | growth factor receptor binding |
| 3. BF | GO:0043988 | histone H3-S28 phosphorylation |
| 3. BF | GO:0032693 | negative regulation of interleukin-10 production |
| 3. BF | GO:0016477 | cell migration |
| 3. BF | GO:0003015 | heart process |
| 3. BF | GO:0002318 | myeloid progenitor cell differentiation |
| 3. BF | GO:0071550 | death-inducing signaling complex assembly |
| 3. BF | GO:0035038 | female pronucleus assembly |
| 3. BF | GO:1901925 | negative regulation of protein import into nucleus during spindle assembly checkpoint |
| 3. BF | GO:0000308 | cytoplasmic cyclin-dependent protein kinase holoenzyme complex |
| 3. BF | GO:0032466 | negative regulation of cytokinesis |
| 3. BF | GO:2000147 | positive regulation of cell motility |
| 3. BF | GO:0032886 | regulation of microtubule-based process |
| 3. BF | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 3. BF | GO:0042764 | ascospore-type prospore |
| 3. BF | GO:0035019 | somatic stem cell population maintenance |
| 3. BF | GO:0048265 | response to pain |
| 3. BF | GO:0000212 | meiotic spindle organization |
| 3. BF | GO:0005840 | ribosome |
| 3. BF | GO:0048803 | imaginal disc-derived male genitalia morphogenesis |
| 3. BF | GO:0031028 | septation initiation signaling |
| 3. BF | GO:0034045 | phagophore assembly site membrane |
| 3. BF | GO:0005007 | fibroblast growth factor-activated receptor activity |
| 3. BF | GO:0097155 | fasciculation of sensory neuron axon |
| 3. BF | GO:0048013 | ephrin receptor signaling pathway |
| 3. BF | GO:0042149 | cellular response to glucose starvation |
| 3. BF | GO:0010976 | positive regulation of neuron projection development |
| 3. BF | GO:0089700 | protein kinase D signaling |
| 3. BF | GO:0046641 | positive regulation of alpha-beta T cell proliferation |
| 3. BF | GO:0017154 | semaphorin receptor activity |
| 3. BF | GO:0005737 | cytoplasm |
| 3. BF | GO:0005954 | calcium- and calmodulin-dependent protein kinase complex |
| 3. BF | GO:0032878 | regulation of establishment or maintenance of cell polarity |
| 3. BF | GO:0009966 | regulation of signal transduction |
| 3. BF | GO:2001028 | positive regulation of endothelial cell chemotaxis |
| 3. BF | GO:0031234 | extrinsic component of cytoplasmic side of plasma membrane |
| 3. BF | GO:0000287 | magnesium ion binding |
| 3. BF | GO:0060706 | cell differentiation involved in embryonic placenta development |
| 3. BF | GO:0000435 | positive regulation of transcription from RNA polymerase II promoter by galactose |
| 3. BF | GO:0098536 | deuterosome |
| 3. BF | GO:0035408 | histone H3-T6 phosphorylation |
| 3. BF | GO:0034351 | negative regulation of glial cell apoptotic process |
| 3. BF | GO:0005856 | cytoskeleton |
| 3. BF | GO:0035403 | histone kinase activity (H3-T6 specific) |
| 3. BF | GO:1902542 | regulation of protein localization to mitotic spindle pole body |
| 3. BF | GO:1990023 | mitotic spindle midzone |
| 3. BF | GO:0005003 | ephrin receptor activity |
| 3. BF | GO:0120186 | negative regulation of protein localization to chromatin |
| 3. BF | GO:0000422 | autophagy of mitochondrion |
| 3. BF | GO:0035401 | histone kinase activity (H3-Y41 specific) |
| 3. BF | GO:0048804 | imaginal disc-derived female genitalia morphogenesis |
| 3. BF | GO:0007099 | centriole replication |
| 3. BF | GO:0050764 | regulation of phagocytosis |
| 3. BF | GO:0009272 | fungal-type cell wall biogenesis |
| 3. BF | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. BF | GO:0009925 | basal plasma membrane |
| 4. PB | GO:0003677 | DNA binding |
| 4. PB | GO:0051447 | negative regulation of meiotic cell cycle |
| 4. PB | GO:1902935 | protein localization to septin ring |
| 4. PB | GO:0043065 | positive regulation of apoptotic process |
| 4. PB | GO:0060069 | Wnt signaling pathway, regulating spindle positioning |
| 4. PB | GO:0051147 | regulation of muscle cell differentiation |
| 4. PB | GO:0019912 | cyclin-dependent protein kinase activating kinase activity |
| 4. PB | GO:0030177 | positive regulation of Wnt signaling pathway |
| 4. PB | GO:0010800 | positive regulation of peptidyl-threonine phosphorylation |
| 4. PB | GO:0072686 | mitotic spindle |
| 4. PB | GO:0007166 | cell surface receptor signaling pathway |
| 4. PB | GO:0004705 | JUN kinase activity |
| 4. PB | GO:0042473 | outer ear morphogenesis |
| 4. PB | GO:2000657 | negative regulation of apolipoprotein binding |
| 4. PB | GO:0097546 | ciliary base |
| 4. PB | GO:0005977 | glycogen metabolic process |
| 4. PB | GO:0005901 | caveola |
| 4. PB | GO:0060020 | Bergmann glial cell differentiation |
| 4. PB | GO:0006897 | endocytosis |
| 4. PB | GO:0071622 | regulation of granulocyte chemotaxis |
| 4. PB | GO:0031594 | neuromuscular junction |
| 4. PB | GO:0000935 | division septum |
| 4. PB | GO:0090333 | regulation of stomatal closure |
| 4. PB | GO:0009738 | abscisic acid-activated signaling pathway |
| 4. PB | GO:0044773 | mitotic DNA damage checkpoint signaling |
| 4. PB | GO:0043204 | perikaryon |
| 4. PB | GO:0032869 | cellular response to insulin stimulus |
| 4. PB | GO:0051019 | mitogen-activated protein kinase binding |
| 4. PB | GO:1903839 | positive regulation of mRNA 3'-UTR binding |
| 4. PB | GO:0097484 | dendrite extension |
| 4. PB | GO:0048146 | positive regulation of fibroblast proliferation |
| 4. PB | GO:1904424 | regulation of GTP binding |
| 4. PB | GO:0030877 | beta-catenin destruction complex |
| 4. PB | GO:0048286 | lung alveolus development |
| 4. PB | GO:0051090 | regulation of DNA-binding transcription factor activity |
| 4. PB | GO:0034614 | cellular response to reactive oxygen species |
| 4. PB | GO:0071507 | pheromone response MAPK cascade |
| 4. PB | GO:0061308 | cardiac neural crest cell development involved in heart development |
| 4. PB | GO:1903351 | cellular response to dopamine |
| 4. PB | GO:0032675 | regulation of interleukin-6 production |
| 4. PB | GO:0033129 | positive regulation of histone phosphorylation |
| 4. PB | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 4. PB | GO:0051973 | positive regulation of telomerase activity |
| 4. PB | GO:0030307 | positive regulation of cell growth |
| 4. PB | GO:0032496 | response to lipopolysaccharide |
| 4. PB | GO:0044351 | macropinocytosis |
| 4. PB | GO:0071243 | cellular response to arsenic-containing substance |
| 4. PB | GO:0032839 | dendrite cytoplasm |
| 4. PB | GO:2000377 | regulation of reactive oxygen species metabolic process |
| 4. PB | GO:1900407 | regulation of cellular response to oxidative stress |
| 4. PB | GO:0072584 | caveolin-mediated endocytosis |
| 4. PB | GO:0071356 | cellular response to tumor necrosis factor |
| 4. PB | GO:0010759 | positive regulation of macrophage chemotaxis |
| 4. PB | GO:0097192 | extrinsic apoptotic signaling pathway in absence of ligand |
| 4. PB | GO:0080136 | priming of cellular response to stress |
| 4. PB | GO:0060267 | positive regulation of respiratory burst |
| 4. PB | GO:0072709 | cellular response to sorbitol |
| 4. PB | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 4. PB | GO:0016301 | kinase activity |
| 4. PB | GO:0032880 | regulation of protein localization |
| 4. PB | GO:0010389 | regulation of G2/M transition of mitotic cell cycle |
| 4. PB | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 4. PB | GO:0005654 | nucleoplasm |
| 4. PB | GO:0051257 | meiotic spindle midzone assembly |
| 4. PB | GO:0044877 | protein-containing complex binding |
| 4. PB | GO:0015459 | potassium channel regulator activity |
| 4. PB | GO:0003016 | respiratory system process |
| 4. PB | GO:0000082 | G1/S transition of mitotic cell cycle |
| 4. PB | GO:0032872 | regulation of stress-activated MAPK cascade |
| 4. PB | GO:0071276 | cellular response to cadmium ion |
| 4. PB | GO:0009636 | response to toxic substance |
| 4. PB | GO:0060425 | lung morphogenesis |
| 4. PB | GO:1904417 | positive regulation of xenophagy |
| 4. PB | GO:0043330 | response to exogenous dsRNA |
| 4. PB | GO:0006975 | DNA damage induced protein phosphorylation |
| 4. PB | GO:0045793 | positive regulation of cell size |
| 4. PB | GO:0019902 | phosphatase binding |
| 4. PB | GO:0030278 | regulation of ossification |
| 4. PB | GO:0031435 | mitogen-activated protein kinase kinase kinase binding |
| 4. PB | GO:0071333 | cellular response to glucose stimulus |
| 4. PB | GO:0051726 | regulation of cell cycle |
| 4. PB | GO:0001944 | vasculature development |
| 4. PB | GO:0097011 | cellular response to granulocyte macrophage colony-stimulating factor stimulus |
| 4. PB | GO:0050804 | modulation of chemical synaptic transmission |
| 4. PB | GO:0048471 | perinuclear region of cytoplasm |
| 4. PB | GO:0038127 | ERBB signaling pathway |
| 4. PB | GO:0051493 | regulation of cytoskeleton organization |
| 4. PB | GO:0043402 | glucocorticoid mediated signaling pathway |
| 4. PB | GO:0001784 | phosphotyrosine residue binding |
| 4. PB | GO:0071470 | cellular response to osmotic stress |
| 4. PB | GO:1905868 | regulation of 3'-UTR-mediated mRNA stabilization |
| 4. PB | GO:0090170 | regulation of Golgi inheritance |
| 4. PB | GO:0019907 | cyclin-dependent protein kinase activating kinase holoenzyme complex |
| 4. PB | GO:0007346 | regulation of mitotic cell cycle |
| 4. PB | GO:0072740 | cellular response to anisomycin |
| 4. PB | GO:0031588 | nucleotide-activated protein kinase complex |
| 4. PB | GO:0070371 | ERK1 and ERK2 cascade |
| 4. PB | GO:1901610 | positive regulation of vesicle transport along microtubule |
| 4. PB | GO:2000641 | regulation of early endosome to late endosome transport |
| 4. PB | GO:1990443 | peptidyl-threonine autophosphorylation |
| 4. PB | GO:0019858 | cytosine metabolic process |
| 4. PB | GO:0038083 | peptidyl-tyrosine autophosphorylation |
| 4. PB | GO:0060440 | trachea formation |
| 4. PB | GO:0005886 | plasma membrane |
| 4. PB | GO:0010468 | regulation of gene expression |
| 4. PB | GO:0002039 | p53 binding |
| 4. PB | GO:0010508 | positive regulation of autophagy |
| 4. PB | GO:0023052 | signaling |
| 4. PB | GO:0032793 | positive regulation of CREB transcription factor activity |
| 4. PB | GO:0046890 | regulation of lipid biosynthetic process |
| 4. PB | GO:0070498 | interleukin-1-mediated signaling pathway |
| 4. PB | GO:0006970 | response to osmotic stress |
| 4. PB | GO:0002224 | toll-like receptor signaling pathway |
| 4. PB | GO:0036290 | protein trans-autophosphorylation |
| 4. PB | GO:1901985 | positive regulation of protein acetylation |
| 4. PB | GO:0093002 | response to nematicide |
| 4. PB | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 4. PB | GO:0031281 | positive regulation of cyclase activity |
| 4. PB | GO:0009651 | response to salt stress |
| 4. PB | GO:2000247 | positive regulation of establishment or maintenance of bipolar cell polarity regulating cell shape |
| 4. PB | GO:0007258 | JUN phosphorylation |
| 4. PB | GO:0000750 | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 4. PB | GO:0051149 | positive regulation of muscle cell differentiation |
| 4. PB | GO:0048814 | regulation of dendrite morphogenesis |
| 4. PB | GO:1904355 | positive regulation of telomere capping |
| 4. PB | GO:0120041 | positive regulation of macrophage proliferation |
| 4. PB | GO:0043276 | anoikis |
| 4. PB | GO:0030641 | regulation of cellular pH |
| 4. PB | GO:2001168 | positive regulation of histone H2B ubiquitination |
| 4. PB | GO:0034198 | cellular response to amino acid starvation |
| 4. PB | GO:0009934 | regulation of meristem structural organization |
| 4. PB | GO:0048010 | vascular endothelial growth factor receptor signaling pathway |
| 4. PB | GO:0031991 | regulation of actomyosin contractile ring contraction |
| 4. PB | GO:0016605 | PML body |
| 4. PB | GO:0106057 | negative regulation of calcineurin-mediated signaling |
| 4. PB | GO:0016572 | histone phosphorylation |
| 4. PB | GO:0071244 | cellular response to carbon dioxide |
| 4. PB | GO:0043393 | regulation of protein binding |
| 4. PB | GO:1900181 | negative regulation of protein localization to nucleus |
| 4. PB | GO:0001558 | regulation of cell growth |
| 5. P | GO:0034605 | cellular response to heat |
| 5. P | GO:0000439 | transcription factor TFIIH core complex |
| 5. P | GO:0005675 | transcription factor TFIIH holo complex |
| 5. P | GO:0098725 | symmetric cell division |
| 5. P | GO:0071345 | cellular response to cytokine stimulus |
| 5. P | GO:1990935 | splicing factor binding |
| 5. P | GO:0000751 | mitotic cell cycle G1 arrest in response to pheromone |
| 5. P | GO:0051984 | positive regulation of chromosome segregation |
| 5. P | GO:0044853 | plasma membrane raft |
| 5. P | GO:0010288 | response to lead ion |
| 5. P | GO:0031493 | obsolete nucleosomal histone binding |
| 5. P | GO:0046825 | regulation of protein export from nucleus |
| 5. P | GO:0006356 | regulation of transcription by RNA polymerase I |
| 5. P | GO:0051835 | positive regulation of synapse structural plasticity |
| 5. P | GO:0010895 | negative regulation of ergosterol biosynthetic process |
| 5. P | GO:1900432 | negative regulation of filamentous growth of a population of unicellular organisms in response to heat |
| 5. P | GO:0035092 | sperm DNA condensation |
| 5. P | GO:0030030 | cell projection organization |
| 5. P | GO:0006611 | protein export from nucleus |
| 5. P | GO:0045445 | myoblast differentiation |
| 5. P | GO:0014032 | neural crest cell development |
| 5. P | GO:0035095 | behavioral response to nicotine |
| 5. P | GO:0072355 | histone H3-T3 phosphorylation |
| 5. P | GO:1903356 | positive regulation of distal tip cell migration |
| 5. P | GO:0071493 | cellular response to UV-B |
| 5. P | GO:0097421 | liver regeneration |
| 5. P | GO:0071472 | cellular response to salt stress |
| 5. P | GO:0044022 | histone kinase activity (H3-S28 specific) |
| 5. P | GO:0001894 | tissue homeostasis |
| 5. P | GO:2000271 | positive regulation of fibroblast apoptotic process |
| 5. P | GO:1904809 | regulation of dense core granule transport |
| 5. P | GO:0106279 | negative regulation of UDP-N-acetylglucosamine biosynthetic process |
| 5. P | GO:0090023 | positive regulation of neutrophil chemotaxis |
| 5. P | GO:0098770 | FBXO family protein binding |
| 5. P | GO:0046898 | response to cycloheximide |
| 5. P | GO:0045023 | G0 to G1 transition |
| 5. P | GO:0007286 | spermatid development |
| 5. P | GO:0016580 | Sin3 complex |
| 5. P | GO:0043697 | cell dedifferentiation |
| 5. P | GO:0033574 | response to testosterone |
| 5. P | GO:0032933 | SREBP signaling pathway |
| 5. P | GO:1903936 | cellular response to sodium arsenite |
| 5. P | GO:0006282 | regulation of DNA repair |
| 5. P | GO:0008023 | transcription elongation factor complex |
| 5. P | GO:0048082 | regulation of adult chitin-containing cuticle pigmentation |
| 5. P | GO:0015966 | diadenosine tetraphosphate biosynthetic process |
| 5. P | GO:0071598 | neuronal ribonucleoprotein granule |
| 5. P | GO:0030275 | LRR domain binding |
| 5. P | GO:0047485 | protein N-terminus binding |
| 5. P | GO:0006359 | regulation of transcription by RNA polymerase III |
| 5. P | GO:1900443 | regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus |
| 5. P | GO:0060612 | adipose tissue development |
| 5. P | GO:0008348 | negative regulation of antimicrobial humoral response |
| 5. P | GO:0048792 | spontaneous exocytosis of neurotransmitter |
| 5. P | GO:0043457 | regulation of cellular respiration |
| 5. P | GO:0060716 | labyrinthine layer blood vessel development |
| 5. P | GO:0055093 | response to hyperoxia |
| 5. P | GO:0071353 | cellular response to interleukin-4 |
| 5. P | GO:0043055 | maintenance of dauer |
| 5. P | GO:0046173 | polyol biosynthetic process |
| 5. P | GO:0009414 | response to water deprivation |
| 5. P | GO:0099003 | vesicle-mediated transport in synapse |
| 5. P | GO:0010212 | response to ionizing radiation |
| 5. P | GO:1901409 | positive regulation of phosphorylation of RNA polymerase II C-terminal domain |
| 5. P | GO:2001242 | regulation of intrinsic apoptotic signaling pathway |
| 5. P | GO:0070516 | CAK-ERCC2 complex |
| 5. P | GO:0048263 | determination of dorsal identity |
| 5. P | GO:0045646 | regulation of erythrocyte differentiation |
| 5. P | GO:0097132 | cyclin D2-CDK6 complex |
| 5. P | GO:2000424 | positive regulation of eosinophil chemotaxis |
| 5. P | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway |
| 5. P | GO:0045596 | negative regulation of cell differentiation |
| 5. P | GO:0022404 | molting cycle process |
| 5. P | GO:0031297 | replication fork processing |
| 5. P | GO:0034097 | response to cytokine |
| 5. P | GO:0005798 | Golgi-associated vesicle |
| 5. P | GO:0016581 | NuRD complex |
| 5. P | GO:2000659 | regulation of interleukin-1-mediated signaling pathway |
| 5. P | GO:0071485 | cellular response to absence of light |
| 5. P | GO:0072354 | histone kinase activity (H3-T3 specific) |
| 5. P | GO:0040014 | regulation of multicellular organism growth |
| 5. P | GO:0097338 | response to clozapine |
| 5. P | GO:1904262 | negative regulation of TORC1 signaling |
| 5. P | GO:0070935 | 3'-UTR-mediated mRNA stabilization |
| 5. P | GO:0046697 | decidualization |
| 5. P | GO:0070817 | P-TEFb-cap methyltransferase complex localization |
| 5. P | GO:0043021 | ribonucleoprotein complex binding |
| 5. P | GO:1904789 | regulation of mitotic actomyosin contractile ring maintenance |
| 5. P | GO:0001843 | neural tube closure |
| 5. P | GO:0031431 | Dbf4-dependent protein kinase complex |
| 5. P | GO:0001223 | transcription coactivator binding |
| 5. P | GO:0019233 | sensory perception of pain |
| 5. P | GO:1905342 | positive regulation of protein localization to kinetochore |
| 5. P | GO:0034423 | autophagosome lumen |
| 5. P | GO:0031056 | regulation of histone modification |
| 5. P | GO:0016043 | cellular component organization |
| 5. P | GO:0005795 | Golgi stack |
| 5. P | GO:0030448 | hyphal growth |
| 5. P | GO:1902413 | negative regulation of mitotic cytokinesis |
| 5. P | GO:1900444 | negative regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus |
| 5. P | GO:0060143 | positive regulation of syncytium formation by plasma membrane fusion |
| 5. P | GO:0060999 | positive regulation of dendritic spine development |
| 5. P | GO:0045786 | negative regulation of cell cycle |
| 5. P | GO:1900364 | negative regulation of mRNA polyadenylation |
| 5. P | GO:0038001 | paracrine signaling |
| 5. P | GO:0035094 | response to nicotine |
| 5. P | GO:0097322 | 7SK snRNA binding |
| 5. P | GO:0030999 | linear element assembly |
| 5. P | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 5. P | GO:1904746 | negative regulation of apoptotic process involved in development |
| 5. P | GO:1905263 | positive regulation of meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 5. P | GO:0010845 | positive regulation of reciprocal meiotic recombination |
| 5. P | GO:0051755 | meiotic sister chromatid arm separation |
| 5. P | GO:0098969 | neurotransmitter receptor transport to postsynaptic membrane |
| 5. P | GO:0030588 | pseudocleavage |
| 5. P | GO:0097225 | sperm midpiece |
| 5. P | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator |
| 5. P | GO:0032680 | regulation of tumor necrosis factor production |
| 5. P | GO:0048240 | sperm capacitation |
| 5. P | GO:1901076 | positive regulation of engulfment of apoptotic cell |
| 5. P | GO:0051645 | Golgi localization |
| 5. P | GO:0035066 | positive regulation of histone acetylation |
| 5. P | GO:0045059 | positive thymic T cell selection |
| 5. P | GO:0006973 | intracellular accumulation of glycerol |
| 5. P | GO:0060770 | negative regulation of epithelial cell proliferation involved in prostate gland development |
| 5. P | GO:0010620 | negative regulation of transcription by transcription factor catabolism |
| 5. P | GO:1904968 | positive regulation of monopolar spindle attachment to meiosis I kinetochore |
| 5. P | GO:0045656 | negative regulation of monocyte differentiation |
| 5. P | GO:0042063 | gliogenesis |
| 5. P | GO:0080026 | response to indolebutyric acid |
| 5. P | GO:0061136 | regulation of proteasomal protein catabolic process |
| 5. P | GO:1902457 | negative regulation of stomatal opening |
| 6. F | GO:0001889 | liver development |
| 6. F | GO:0010200 | response to chitin |
| 6. F | GO:1901799 | negative regulation of proteasomal protein catabolic process |
| 6. F | GO:0051228 | mitotic spindle disassembly |
| 6. F | GO:0019236 | response to pheromone |
| 6. F | GO:0044344 | cellular response to fibroblast growth factor stimulus |
| 6. F | GO:0071168 | protein localization to chromatin |
| 6. F | GO:0048232 | male gamete generation |
| 6. F | GO:0007413 | axonal fasciculation |
| 6. F | GO:0045936 | negative regulation of phosphate metabolic process |
| 6. F | GO:0000939 | inner kinetochore |
| 6. F | GO:0080154 | regulation of fertilization |
| 6. F | GO:0021963 | spinothalamic tract morphogenesis |
| 6. F | GO:0007143 | female meiotic nuclear division |
| 6. F | GO:2000301 | negative regulation of synaptic vesicle exocytosis |
| 6. F | GO:0090267 | positive regulation of mitotic cell cycle spindle assembly checkpoint |
| 6. F | GO:0007288 | sperm axoneme assembly |
| 6. F | GO:0033262 | regulation of nuclear cell cycle DNA replication |
| 6. F | GO:1903139 | positive regulation of cell wall integrity MAPK cascade |
| 6. F | GO:0000045 | autophagosome assembly |
| 6. F | GO:0007168 | receptor guanylyl cyclase signaling pathway |
| 6. F | GO:0046822 | regulation of nucleocytoplasmic transport |
| 6. F | GO:0045144 | meiotic sister chromatid segregation |
| 6. F | GO:0140530 | MCM complex loading |
| 6. F | GO:0001886 | endothelial cell morphogenesis |
| 6. F | GO:0006182 | cGMP biosynthetic process |
| 6. F | GO:0051262 | protein tetramerization |
| 6. F | GO:0120200 | rod photoreceptor outer segment |
| 6. F | GO:0030374 | nuclear receptor coactivator activity |
| 6. F | GO:0043367 | CD4-positive, alpha-beta T cell differentiation |
| 6. F | GO:0032258 | cytoplasm to vacuole transport by the Cvt pathway |
| 6. F | GO:0050708 | regulation of protein secretion |
| 6. F | GO:0010795 | regulation of ubiquinone biosynthetic process |
| 6. F | GO:0070938 | contractile ring |
| 6. F | GO:0001959 | regulation of cytokine-mediated signaling pathway |
| 6. F | GO:0005828 | kinetochore microtubule |
| 6. F | GO:0008910 | kanamycin kinase activity |
| 6. F | GO:0007089 | traversing start control point of mitotic cell cycle |
| 6. F | GO:1904145 | negative regulation of meiotic cell cycle process involved in oocyte maturation |
| 6. F | GO:0004860 | protein kinase inhibitor activity |
| 6. F | GO:1900194 | negative regulation of oocyte maturation |
| 7. B | GO:0099183 | trans-synaptic signaling by BDNF, modulating synaptic transmission |
| 7. B | GO:0071364 | cellular response to epidermal growth factor stimulus |
| 7. B | GO:0099091 | postsynaptic specialization, intracellular component |
| 7. B | GO:0038131 | neuregulin receptor activity |
| 7. B | GO:0001837 | epithelial to mesenchymal transition |
| 7. B | GO:0043560 | insulin receptor substrate binding |
| 7. B | GO:0045725 | positive regulation of glycogen biosynthetic process |
| 7. B | GO:0010183 | pollen tube guidance |
| 7. B | GO:0045143 | homologous chromosome segregation |
| 7. B | GO:0072300 | positive regulation of metanephric glomerulus development |
| 7. B | GO:1903202 | negative regulation of oxidative stress-induced cell death |
| 7. B | GO:0070194 | synaptonemal complex disassembly |
| 7. B | GO:0015031 | protein transport |
| 7. B | GO:0010863 | positive regulation of phospholipase C activity |
| 7. B | GO:2000753 | positive regulation of glucosylceramide catabolic process |
| 7. B | GO:0048489 | synaptic vesicle transport |
| 7. B | GO:2000773 | negative regulation of cellular senescence |
| 7. B | GO:0150105 | protein localization to cell-cell junction |
| 7. B | GO:0006807 | nitrogen compound metabolic process |
| 7. B | GO:0005024 | transforming growth factor beta-activated receptor activity |
| 7. B | GO:0005739 | mitochondrion |
| 7. B | GO:1903076 | regulation of protein localization to plasma membrane |
| 7. B | GO:2000811 | negative regulation of anoikis |
| 7. B | GO:0045821 | positive regulation of glycolytic process |
| 7. B | GO:0034613 | cellular protein localization |
| 7. B | GO:2000379 | positive regulation of reactive oxygen species metabolic process |
| 7. B | GO:0061298 | retina vasculature development in camera-type eye |
| 7. B | GO:0090188 | negative regulation of pancreatic juice secretion |
| 7. B | GO:0001403 | invasive growth in response to glucose limitation |
| 7. B | GO:1990776 | response to angiotensin |
| 7. B | GO:0060502 | epithelial cell proliferation involved in lung morphogenesis |
| 7. B | GO:0021553 | olfactory nerve development |
| 7. B | GO:0031959 | mineralocorticoid receptor signaling pathway |
| 7. B | GO:0033091 | positive regulation of immature T cell proliferation |
| 7. B | GO:0030145 | manganese ion binding |
| 7. B | GO:1904929 | coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway |
| 7. B | GO:0010629 | negative regulation of gene expression |
| 7. B | GO:0090398 | cellular senescence |
| 7. B | GO:0050431 | transforming growth factor beta binding |
| 7. B | GO:0045879 | negative regulation of smoothened signaling pathway |
| 7. B | GO:0043536 | positive regulation of blood vessel endothelial cell migration |
| 7. B | GO:1903902 | positive regulation of viral life cycle |
| 7. B | GO:0030036 | actin cytoskeleton organization |
| 7. B | GO:0090336 | positive regulation of brown fat cell differentiation |
| 7. B | GO:0070555 | response to interleukin-1 |
| 7. B | GO:0051091 | positive regulation of DNA-binding transcription factor activity |
| 7. B | GO:1902097 | positive regulation of transcription from RNA polymerase II promoter involved in defense response to Gram-negative bacterium |
| 7. B | GO:0007228 | positive regulation of hh target transcription factor activity |
| 7. B | GO:0045859 | regulation of protein kinase activity |
| 7. B | GO:0036016 | cellular response to interleukin-3 |
| 7. B | GO:0071264 | positive regulation of translational initiation in response to starvation |
| 7. B | GO:0030003 | cellular cation homeostasis |
| 7. B | GO:0051770 | positive regulation of nitric-oxide synthase biosynthetic process |
| 7. B | GO:0015935 | small ribosomal subunit |
| 7. B | GO:0140467 | integrated stress response signaling |
| 7. B | GO:0048691 | positive regulation of axon extension involved in regeneration |
| 7. B | GO:0008219 | cell death |
| 7. B | GO:0007057 | spindle assembly involved in female meiosis I |
| 7. B | GO:0021545 | cranial nerve development |
| 7. B | GO:0097242 | amyloid-beta clearance |
| 7. B | GO:0097125 | cyclin B1-CDK1 complex |
| 7. B | GO:0060021 | roof of mouth development |
| 7. B | GO:0051346 | negative regulation of hydrolase activity |
| 7. B | GO:0060175 | brain-derived neurotrophic factor-activated receptor activity |
| 7. B | GO:0048439 | flower morphogenesis |
| 7. B | GO:0060709 | glycogen cell differentiation involved in embryonic placenta development |
| 7. B | GO:0031252 | cell leading edge |
| 7. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 7. B | GO:1902178 | fibroblast growth factor receptor apoptotic signaling pathway |
| 7. B | GO:1904646 | cellular response to amyloid-beta |
| 7. B | GO:0007178 | transmembrane receptor protein serine/threonine kinase signaling pathway |
| 7. B | GO:2000573 | positive regulation of DNA biosynthetic process |
| 7. B | GO:1902911 | protein kinase complex |
| 7. B | GO:0080092 | regulation of pollen tube growth |
| 7. B | GO:0070723 | response to cholesterol |
| 7. B | GO:0050730 | regulation of peptidyl-tyrosine phosphorylation |
| 7. B | GO:0071469 | cellular response to alkaline pH |
| 7. B | GO:2001240 | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 7. B | GO:0007498 | mesoderm development |
| 7. B | GO:0042025 | host cell nucleus |
| 7. B | GO:0043423 | 3-phosphoinositide-dependent protein kinase binding |
| 7. B | GO:0048437 | floral organ development |
| 7. B | GO:1904428 | negative regulation of tubulin deacetylation |
| 7. B | GO:0045892 | negative regulation of transcription, DNA-templated |
| 7. B | GO:0071260 | cellular response to mechanical stimulus |
| 7. B | GO:0007639 | homeostasis of number of meristem cells |
| 7. B | GO:0009411 | response to UV |
| 7. B | GO:0030246 | carbohydrate binding |
| 7. B | GO:0007252 | I-kappaB phosphorylation |
| 7. B | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity |
| 7. B | GO:0051146 | striated muscle cell differentiation |
| 7. B | GO:0035866 | alphav-beta3 integrin-PKCalpha complex |
| 7. B | GO:0002862 | negative regulation of inflammatory response to antigenic stimulus |
| 7. B | GO:0001402 | signal transduction involved in filamentous growth |
| 7. B | GO:0001946 | lymphangiogenesis |
| 7. B | GO:0036289 | peptidyl-serine autophosphorylation |
| 7. B | GO:1904887 | Wnt signalosome assembly |
| 7. B | GO:0008543 | fibroblast growth factor receptor signaling pathway |
| 7. B | GO:0140058 | neuron projection arborization |
| 7. B | GO:0003108 | negative regulation of the force of heart contraction by chemical signal |
| 7. B | GO:0031272 | regulation of pseudopodium assembly |
| 7. B | GO:1901216 | positive regulation of neuron death |
| 7. B | GO:0007424 | open tracheal system development |
| 7. B | GO:0097022 | lymphocyte migration into lymph node |
| 7. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 7. B | GO:0010078 | maintenance of root meristem identity |
| 7. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 7. B | GO:1902533 | positive regulation of intracellular signal transduction |
| 7. B | GO:0060176 | regulation of aggregation involved in sorocarp development |
| 7. B | GO:0043407 | negative regulation of MAP kinase activity |
| 7. B | GO:1902596 | negative regulation of DNA replication origin binding |
| 7. B | GO:0006954 | inflammatory response |
| 7. B | GO:1904339 | negative regulation of dopaminergic neuron differentiation |
| 7. B | GO:0071902 | positive regulation of protein serine/threonine kinase activity |
| 7. B | GO:0046006 | regulation of activated T cell proliferation |
| 7. B | GO:0002063 | chondrocyte development |
| 7. B | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 7. B | GO:2001235 | positive regulation of apoptotic signaling pathway |
| 7. B | GO:0051082 | unfolded protein binding |
| 7. B | GO:0097489 | multivesicular body, internal vesicle lumen |
| 7. B | GO:2000670 | positive regulation of dendritic cell apoptotic process |
| 7. B | GO:0007167 | enzyme linked receptor protein signaling pathway |
| 7. B | GO:0097028 | dendritic cell differentiation |
| 7. B | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 7. B | GO:0001938 | positive regulation of endothelial cell proliferation |
| 7. B | GO:0009535 | chloroplast thylakoid membrane |
| 7. B | GO:0007612 | learning |
| 7. B | GO:0002944 | cyclin K-CDK12 complex |
| 7. B | GO:0060978 | angiogenesis involved in coronary vascular morphogenesis |
| 7. B | GO:0002221 | pattern recognition receptor signaling pathway |
| 7. B | GO:0010359 | regulation of anion channel activity |
| 7. B | GO:0019211 | phosphatase activator activity |
| 7. B | GO:0016740 | transferase activity |
| 7. B | GO:0071901 | negative regulation of protein serine/threonine kinase activity |
| 7. B | GO:0070050 | neuron cellular homeostasis |
| 7. B | GO:0060915 | mesenchymal cell differentiation involved in lung development |
| 7. B | GO:1901528 | hydrogen peroxide mediated signaling pathway involved in stomatal movement |
| 7. B | GO:1904716 | positive regulation of chaperone-mediated autophagy |
| 7. B | GO:2000755 | positive regulation of sphingomyelin catabolic process |
| 7. B | GO:0110094 | polyphosphate-mediated signaling |
| 7. B | GO:0005020 | stem cell factor receptor activity |
| 7. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 7. B | GO:0150033 | negative regulation of protein localization to lysosome |
| 7. B | GO:0033633 | negative regulation of cell-cell adhesion mediated by integrin |
| 7. B | GO:0002053 | positive regulation of mesenchymal cell proliferation |
| 7. B | GO:0007256 | obsolete activation of JNKK activity |
| 7. B | GO:0060043 | regulation of cardiac muscle cell proliferation |
| 7. B | GO:0021952 | central nervous system projection neuron axonogenesis |
| 7. B | GO:0035404 | histone-serine phosphorylation |
| 7. B | GO:2000352 | negative regulation of endothelial cell apoptotic process |
| 7. B | GO:0007232 | osmosensory signaling pathway via Sho1 osmosensor |
| 7. B | GO:0030212 | hyaluronan metabolic process |
| 7. B | GO:0055003 | cardiac myofibril assembly |
| 7. B | GO:0150019 | basal dendrite morphogenesis |
| 7. B | GO:0009249 | protein lipoylation |
| 7. B | GO:0006412 | translation |
| 7. B | GO:1901532 | regulation of hematopoietic progenitor cell differentiation |
| 7. B | GO:0016239 | positive regulation of macroautophagy |
| 7. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 7. B | GO:0035306 | positive regulation of dephosphorylation |
| 7. B | GO:0061067 | negative regulation of dauer larval development |
| 7. B | GO:0098696 | regulation of neurotransmitter receptor localization to postsynaptic specialization membrane |
| 7. B | GO:0016192 | vesicle-mediated transport |
| 7. B | GO:0010595 | positive regulation of endothelial cell migration |
| 7. B | GO:0000011 | vacuole inheritance |
| 7. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 7. B | GO:0001827 | inner cell mass cell fate commitment |
| 7. B | GO:0075044 | positive regulation by symbiont of host autophagy |
| 7. B | GO:0019199 | transmembrane receptor protein kinase activity |
| 7. B | GO:0044879 | mitotic morphogenesis checkpoint signaling |
| 7. B | GO:0043542 | endothelial cell migration |
| 7. B | GO:0002902 | regulation of B cell apoptotic process |
| 7. B | GO:0016151 | nickel cation binding |
| 7. B | GO:0048273 | mitogen-activated protein kinase p38 binding |
| 7. B | GO:0042060 | wound healing |
| 7. B | GO:0110031 | negative regulation of G2/MI transition of meiotic cell cycle |
| 7. B | GO:0060399 | positive regulation of growth hormone receptor signaling pathway |
| 7. B | GO:0021697 | cerebellar cortex formation |
| 7. B | GO:0032792 | negative regulation of CREB transcription factor activity |
| 7. B | GO:0071109 | superior temporal gyrus development |
| 7. B | GO:0002042 | cell migration involved in sprouting angiogenesis |
| 7. B | GO:0010907 | positive regulation of glucose metabolic process |
| 7. B | GO:0048709 | oligodendrocyte differentiation |
| 7. B | GO:0015934 | large ribosomal subunit |
| 7. B | GO:0042997 | negative regulation of Golgi to plasma membrane protein transport |
| 7. B | GO:0055089 | fatty acid homeostasis |
| 7. B | GO:0005884 | actin filament |
| 7. B | GO:0034711 | inhibin binding |
| 7. B | GO:0010628 | positive regulation of gene expression |
| 7. B | GO:2000739 | regulation of mesenchymal stem cell differentiation |
| 7. B | GO:2000758 | positive regulation of peptidyl-lysine acetylation |
| 7. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 7. B | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress |
| 7. B | GO:0014911 | positive regulation of smooth muscle cell migration |
| 7. B | GO:0005102 | signaling receptor binding |
| 7. B | GO:0034332 | adherens junction organization |
| 7. B | GO:0030217 | T cell differentiation |
| 7. B | GO:0106071 | positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 7. B | GO:1905075 | positive regulation of tight junction disassembly |
| 7. B | GO:0042597 | periplasmic space |
| 7. B | GO:1902731 | negative regulation of chondrocyte proliferation |
| 7. B | GO:0010570 | regulation of filamentous growth |
| 7. B | GO:0031100 | animal organ regeneration |
| 7. B | GO:0030291 | protein serine/threonine kinase inhibitor activity |
| 7. B | GO:0030425 | dendrite |
| 7. B | GO:0005929 | cilium |
| 7. B | GO:0030097 | hemopoiesis |
| 7. B | GO:0030318 | melanocyte differentiation |
| 7. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 7. B | GO:0070926 | regulation of ATP:ADP antiporter activity |
| 7. B | GO:0034673 | inhibin-betaglycan-ActRII complex |
| 7. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 7. B | GO:0099551 | trans-synaptic signaling by neuropeptide, modulating synaptic transmission |
| 7. B | GO:0009789 | positive regulation of abscisic acid-activated signaling pathway |
| 7. B | GO:0060667 | branch elongation involved in salivary gland morphogenesis |
| 7. B | GO:0100002 | negative regulation of protein kinase activity by protein phosphorylation |
| 7. B | GO:1905244 | regulation of modification of synaptic structure |
| 7. B | GO:0010632 | regulation of epithelial cell migration |
| 7. B | GO:0051894 | positive regulation of focal adhesion assembly |
| 7. B | GO:0048156 | tau protein binding |
| 7. B | GO:0071322 | cellular response to carbohydrate stimulus |
| 7. B | GO:0014069 | postsynaptic density |
| 7. B | GO:0009556 | microsporogenesis |
| 7. B | GO:0032007 | negative regulation of TOR signaling |
| 7. B | GO:0008022 | protein C-terminus binding |
| 7. B | GO:0070671 | response to interleukin-12 |
| 7. B | GO:0002119 | nematode larval development |
| 7. B | GO:0046330 | positive regulation of JNK cascade |
| 7. B | GO:0008380 | RNA splicing |
| 7. B | GO:0042593 | glucose homeostasis |
| 7. B | GO:0043244 | regulation of protein-containing complex disassembly |
| 7. B | GO:0042274 | ribosomal small subunit biogenesis |
| 7. B | GO:1905224 | clathrin-coated pit assembly |
| 7. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 7. B | GO:0036122 | BMP binding |
| 7. B | GO:0001545 | primary ovarian follicle growth |
| 7. B | GO:1990682 | CSF1-CSF1R complex |
| 7. B | GO:0035607 | fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development |
| 7. B | GO:0051389 | obsolete inactivation of MAPKK activity |
| 7. B | GO:0038061 | NIK/NF-kappaB signaling |
| 7. B | GO:0010103 | stomatal complex morphogenesis |
| 7. B | GO:0032752 | positive regulation of interleukin-3 production |
| 7. B | GO:0072223 | metanephric glomerular mesangium development |
| 7. B | GO:0010518 | positive regulation of phospholipase activity |
| 7. B | GO:0060389 | pathway-restricted SMAD protein phosphorylation |
| 7. B | GO:1901002 | positive regulation of response to salt stress |
| 7. B | GO:0090288 | negative regulation of cellular response to growth factor stimulus |
| 7. B | GO:0031138 | negative regulation of conjugation with cellular fusion |
| 7. B | GO:0097134 | cyclin E1-CDK2 complex |
| 7. B | GO:0048679 | regulation of axon regeneration |
| 7. B | GO:0045428 | regulation of nitric oxide biosynthetic process |
| 7. B | GO:0106096 | response to ceramide |
| 7. B | GO:0051250 | negative regulation of lymphocyte activation |
| 7. B | GO:0060981 | cell migration involved in coronary angiogenesis |
| 7. B | GO:0007409 | axonogenesis |
| 7. B | GO:0035855 | megakaryocyte development |
| 7. B | GO:2000171 | negative regulation of dendrite development |
| 7. B | GO:1990579 | peptidyl-serine trans-autophosphorylation |
| 7. B | GO:0060437 | lung growth |
| 7. B | GO:0048701 | embryonic cranial skeleton morphogenesis |
| 7. B | GO:0060463 | lung lobe morphogenesis |
| 7. B | GO:0000281 | mitotic cytokinesis |
| 7. B | GO:0002327 | immature B cell differentiation |
| 7. B | GO:0061003 | positive regulation of dendritic spine morphogenesis |
| 7. B | GO:1905223 | epicardium morphogenesis |
| 7. B | GO:0010362 | negative regulation of anion channel activity by blue light |
| 7. B | GO:0036119 | response to platelet-derived growth factor |
| 7. B | GO:0048769 | sarcomerogenesis |
| 7. B | GO:0019955 | cytokine binding |
| 7. B | GO:0005774 | vacuolar membrane |
| 7. B | GO:0042803 | protein homodimerization activity |
| 7. B | GO:0048514 | blood vessel morphogenesis |
| 7. B | GO:0001945 | lymph vessel development |
| 7. B | GO:0036492 | eiF2alpha phosphorylation in response to endoplasmic reticulum stress |
| 7. B | GO:0043548 | phosphatidylinositol 3-kinase binding |
| 7. B | GO:0060840 | artery development |
| 7. B | GO:0097326 | melanocyte adhesion |
| 7. B | GO:0002553 | histamine secretion by mast cell |
| 7. B | GO:1902036 | regulation of hematopoietic stem cell differentiation |
| 7. B | GO:1905430 | cellular response to glycine |
| 7. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 7. B | GO:0051510 | regulation of unidimensional cell growth |
| 7. B | GO:0043524 | negative regulation of neuron apoptotic process |
| 7. B | GO:0030155 | regulation of cell adhesion |
| 7. B | GO:0019081 | viral translation |
| 7. B | GO:0097343 | ripoptosome assembly |
| 7. B | GO:0097110 | scaffold protein binding |
| 7. B | GO:0071773 | cellular response to BMP stimulus |
| 7. B | GO:0009749 | response to glucose |
| 7. B | GO:0045860 | positive regulation of protein kinase activity |
| 7. B | GO:0060665 | regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling |
| 7. B | GO:0038109 | Kit signaling pathway |
| 7. B | GO:0045429 | positive regulation of nitric oxide biosynthetic process |
| 7. B | GO:0042610 | CD8 receptor binding |
| 7. B | GO:0043491 | protein kinase B signaling |
| 7. B | GO:0007224 | smoothened signaling pathway |
| 7. B | GO:0044027 | hypermethylation of CpG island |
| 7. B | GO:0016321 | female meiosis chromosome segregation |
| 7. B | GO:0097284 | hepatocyte apoptotic process |
| 7. B | GO:0071940 | fungal-type cell wall assembly |
| 7. B | GO:0048812 | neuron projection morphogenesis |
| 7. B | GO:0035912 | dorsal aorta morphogenesis |
| 7. B | GO:0045471 | response to ethanol |
| 7. B | GO:1905116 | positive regulation of lateral attachment of mitotic spindle microtubules to kinetochore |
| 7. B | GO:0071476 | cellular hypotonic response |
| 7. B | GO:1905007 | positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation |
| 7. B | GO:0005819 | spindle |
| 7. B | GO:0031333 | negative regulation of protein-containing complex assembly |
| 7. B | GO:0036498 | IRE1-mediated unfolded protein response |
| 7. B | GO:0060917 | regulation of (1->6)-beta-D-glucan biosynthetic process |
| 7. B | GO:0042386 | hemocyte differentiation |
| 7. B | GO:0031914 | negative regulation of synaptic plasticity |
| 7. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 7. B | GO:0046677 | response to antibiotic |
| 7. B | GO:0050855 | regulation of B cell receptor signaling pathway |
| 7. B | GO:0060734 | regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 7. B | GO:0019221 | cytokine-mediated signaling pathway |
| 7. B | GO:0005759 | mitochondrial matrix |
| 7. B | GO:0110099 | negative regulation of calcium import into the mitochondrion |
| 7. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 7. B | GO:0072046 | establishment of planar polarity involved in nephron morphogenesis |
| 7. B | GO:0038146 | chemokine (C-X-C motif) ligand 12 signaling pathway |
| 7. B | GO:0150101 | regulation of microtubule anchoring at centrosome |
| 7. B | GO:0016310 | phosphorylation |
| 7. B | GO:2000570 | positive regulation of T-helper 2 cell activation |
| 7. B | GO:0032060 | bleb assembly |
| 7. B | GO:0051081 | nuclear membrane disassembly |
| 7. B | GO:0070301 | cellular response to hydrogen peroxide |
| 7. B | GO:0035771 | interleukin-4-mediated signaling pathway |
| 7. B | GO:0031532 | actin cytoskeleton reorganization |
| 7. B | GO:0007179 | transforming growth factor beta receptor signaling pathway |
| 7. B | GO:2001056 | positive regulation of cysteine-type endopeptidase activity |
| 7. B | GO:0030334 | regulation of cell migration |
| 7. B | GO:1990418 | response to insulin-like growth factor stimulus |
| 7. B | GO:0035309 | wing and notum subfield formation |
| 7. B | GO:0031012 | extracellular matrix |
| 7. B | GO:0070375 | ERK5 cascade |
| 7. B | GO:0007430 | terminal branching, open tracheal system |
| 7. B | GO:0090050 | positive regulation of cell migration involved in sprouting angiogenesis |
| 7. B | GO:1905408 | negative regulation of creatine transmembrane transporter activity |
| 7. B | GO:1904414 | positive regulation of cardiac ventricle development |
| 7. B | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 7. B | GO:0060252 | positive regulation of glial cell proliferation |
| 7. B | GO:0031702 | type 1 angiotensin receptor binding |
| 7. B | GO:0007218 | neuropeptide signaling pathway |
| 7. B | GO:2000672 | negative regulation of motor neuron apoptotic process |
| 7. B | GO:0021954 | central nervous system neuron development |
| 7. B | GO:0035331 | negative regulation of hippo signaling |
| 7. B | GO:0071375 | cellular response to peptide hormone stimulus |
| 7. B | GO:0050679 | positive regulation of epithelial cell proliferation |
| 7. B | GO:0002774 | Fc receptor mediated inhibitory signaling pathway |
| 7. B | GO:0030282 | bone mineralization |
| 7. B | GO:0031116 | positive regulation of microtubule polymerization |
| 7. B | GO:0099400 | caveola neck |
| 7. B | GO:1904881 | cellular response to hydrogen sulfide |
| 7. B | GO:0006260 | DNA replication |
| 7. B | GO:0038091 | positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway |
| 7. B | GO:0004704 | NF-kappaB-inducing kinase activity |
| 7. B | GO:0071407 | cellular response to organic cyclic compound |
| 7. B | GO:0050920 | regulation of chemotaxis |
| 7. B | GO:0061312 | BMP signaling pathway involved in heart development |
| 7. B | GO:0099171 | presynaptic modulation of chemical synaptic transmission |
| 7. B | GO:0031103 | axon regeneration |
| 7. B | GO:0010830 | regulation of myotube differentiation |
| 7. B | GO:1903465 | positive regulation of mitotic cell cycle DNA replication |
| 7. B | GO:0048671 | negative regulation of collateral sprouting |
| 7. B | GO:0007260 | tyrosine phosphorylation of STAT protein |
| 7. B | GO:0097161 | DH domain binding |
| 7. B | GO:0090272 | negative regulation of fibroblast growth factor production |
| 7. B | GO:0019899 | enzyme binding |
| 7. B | GO:0002028 | regulation of sodium ion transport |
| 7. B | GO:0010661 | positive regulation of muscle cell apoptotic process |
| 7. B | GO:0048403 | brain-derived neurotrophic factor binding |
| 7. B | GO:0008545 | JUN kinase kinase activity |
| 7. B | GO:0003181 | atrioventricular valve morphogenesis |
| 7. B | GO:0022400 | regulation of rhodopsin mediated signaling pathway |
| 7. B | GO:1903288 | positive regulation of potassium ion import across plasma membrane |
| 7. B | GO:0001556 | oocyte maturation |
| 7. B | GO:0043197 | dendritic spine |
| 7. B | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 7. B | GO:0045651 | positive regulation of macrophage differentiation |
| 7. B | GO:0009570 | chloroplast stroma |
| 7. B | GO:1902961 | positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process |
| 7. B | GO:0031850 | delta-type opioid receptor binding |
| 7. B | GO:0060048 | cardiac muscle contraction |
| 7. B | GO:2000107 | negative regulation of leukocyte apoptotic process |
| 7. B | GO:0043053 | dauer entry |
| 7. B | GO:0030027 | lamellipodium |
| 7. B | GO:0016004 | phospholipase activator activity |
| 7. B | GO:0043068 | positive regulation of programmed cell death |
| 7. B | GO:0009620 | response to fungus |
| 7. B | GO:1902043 | positive regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 7. B | GO:0072655 | establishment of protein localization to mitochondrion |
| 7. B | GO:0001702 | gastrulation with mouth forming second |
| 7. B | GO:0010717 | regulation of epithelial to mesenchymal transition |
| 7. B | GO:0071801 | regulation of podosome assembly |
| 7. B | GO:0060444 | branching involved in mammary gland duct morphogenesis |
| 7. B | GO:0002066 | columnar/cuboidal epithelial cell development |
| 7. B | GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator |
| 7. B | GO:0030430 | host cell cytoplasm |
| 7. B | GO:0071559 | response to transforming growth factor beta |
| 7. B | GO:2000145 | regulation of cell motility |
| 7. B | GO:0005025 | transforming growth factor beta receptor activity, type I |
| 7. B | GO:1902749 | regulation of cell cycle G2/M phase transition |
| 7. B | GO:0022038 | corpus callosum development |
| 7. B | GO:0008360 | regulation of cell shape |
| 7. B | GO:0010465 | nerve growth factor receptor activity |
| 7. B | GO:0048699 | generation of neurons |
| 7. B | GO:0002431 | Fc receptor mediated stimulatory signaling pathway |
| 7. B | GO:2001241 | positive regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 7. B | GO:0042594 | response to starvation |
| 7. B | GO:0036120 | cellular response to platelet-derived growth factor stimulus |
| 7. B | GO:0061351 | neural precursor cell proliferation |
| 7. B | GO:0048565 | digestive tract development |
| 7. B | GO:1901897 | regulation of relaxation of cardiac muscle |
| 7. B | GO:0005026 | transforming growth factor beta receptor activity, type II |
| 7. B | GO:0042981 | regulation of apoptotic process |
| 7. B | GO:0010763 | positive regulation of fibroblast migration |
| 7. B | GO:0035407 | histone H3-T11 phosphorylation |
| 7. B | GO:0009755 | hormone-mediated signaling pathway |
| 7. B | GO:0060841 | venous blood vessel development |
| 7. B | GO:0007124 | pseudohyphal growth |
| 7. B | GO:0001525 | angiogenesis |
| 7. B | GO:0071300 | cellular response to retinoic acid |
| 7. B | GO:0042542 | response to hydrogen peroxide |
| 7. B | GO:0061302 | smooth muscle cell-matrix adhesion |
| 7. B | GO:0033003 | regulation of mast cell activation |
| 7. B | GO:0007265 | Ras protein signal transduction |
| 7. B | GO:0005783 | endoplasmic reticulum |
| 7. B | GO:0008046 | axon guidance receptor activity |
| 7. B | GO:0048407 | platelet-derived growth factor binding |
| 7. B | GO:0061052 | negative regulation of cell growth involved in cardiac muscle cell development |
| 7. B | GO:0009594 | detection of nutrient |
| 7. B | GO:0030247 | polysaccharide binding |
| 7. B | GO:0043025 | neuronal cell body |
| 7. B | GO:0070436 | Grb2-EGFR complex |
| 7. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 7. B | GO:0003186 | tricuspid valve morphogenesis |
| 7. B | GO:0090331 | negative regulation of platelet aggregation |
| 7. B | GO:1902235 | regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
| 7. B | GO:0007173 | epidermal growth factor receptor signaling pathway |
| 7. B | GO:0038143 | ERBB3:ERBB2 complex |
| 7. B | GO:0046328 | regulation of JNK cascade |
| 7. B | GO:0004519 | endonuclease activity |
| 7. B | GO:1903008 | organelle disassembly |
| 7. B | GO:0007476 | imaginal disc-derived wing morphogenesis |
| 7. B | GO:0038162 | erythropoietin-mediated signaling pathway |
| 7. B | GO:0002945 | cyclin K-CDK13 complex |
| 7. B | GO:0019838 | growth factor binding |
| 7. B | GO:0010631 | epithelial cell migration |
| 7. B | GO:0045780 | positive regulation of bone resorption |
| 7. B | GO:2001237 | negative regulation of extrinsic apoptotic signaling pathway |
| 7. B | GO:0010310 | regulation of hydrogen peroxide metabolic process |
| 7. B | GO:1900163 | positive regulation of phospholipid scramblase activity |
| 7. B | GO:1990911 | response to psychosocial stress |
| 7. B | GO:0031267 | small GTPase binding |
| 7. B | GO:1905208 | negative regulation of cardiocyte differentiation |
| 7. B | GO:0007623 | circadian rhythm |
| 7. B | GO:0000749 | response to pheromone triggering conjugation with cellular fusion |
| 7. B | GO:0044025 | histone kinase activity (H2B-S14 specific) |
| 7. B | GO:0036332 | placental growth factor-activated receptor activity |
| 7. B | GO:1901796 | regulation of signal transduction by p53 class mediator |
| 7. B | GO:0008582 | regulation of synaptic assembly at neuromuscular junction |
| 7. B | GO:0001841 | neural tube formation |
| 7. B | GO:0060249 | anatomical structure homeostasis |
| 7. B | GO:0051247 | positive regulation of protein metabolic process |
| 7. B | GO:0043203 | axon hillock |
| 7. B | GO:0007394 | dorsal closure, elongation of leading edge cells |
| 7. B | GO:0031152 | aggregation involved in sorocarp development |
| 7. B | GO:0002931 | response to ischemia |
| 7. B | GO:0120072 | positive regulation of pyloric antrum smooth muscle contraction |
| 7. B | GO:0034405 | response to fluid shear stress |
| 7. B | GO:0043406 | positive regulation of MAP kinase activity |
| 7. B | GO:0007098 | centrosome cycle |
| 7. B | GO:0000077 | DNA damage checkpoint signaling |
| 7. B | GO:0003416 | endochondral bone growth |
| 7. B | GO:0002528 | regulation of vascular permeability involved in acute inflammatory response |
| 7. B | GO:0008385 | IkappaB kinase complex |
| 7. B | GO:1903955 | positive regulation of protein targeting to mitochondrion |
| 7. B | GO:0005021 | vascular endothelial growth factor-activated receptor activity |
| 7. B | GO:0003676 | nucleic acid binding |
| 7. B | GO:1900436 | positive regulation of filamentous growth of a population of unicellular organisms in response to starvation |
| 7. B | GO:0021847 | ventricular zone neuroblast division |
| 7. B | GO:0045931 | positive regulation of mitotic cell cycle |
| 7. B | GO:0072577 | endothelial cell apoptotic process |
| 7. B | GO:0060443 | mammary gland morphogenesis |
| 7. B | GO:0090627 | plant epidermal cell differentiation |
| 7. B | GO:0043278 | response to morphine |
| 7. B | GO:0035612 | AP-2 adaptor complex binding |
| 7. B | GO:0006351 | transcription, DNA-templated |
| 7. B | GO:0051496 | positive regulation of stress fiber assembly |
| 7. B | GO:0090400 | stress-induced premature senescence |
| 7. B | GO:0045121 | membrane raft |
| 7. B | GO:0098989 | NMDA selective glutamate receptor signaling pathway |
| 7. B | GO:1904227 | negative regulation of glycogen synthase activity, transferring glucose-1-phosphate |
| 7. B | GO:2000541 | positive regulation of protein geranylgeranylation |
| 7. B | GO:0090404 | pollen tube tip |
| 7. B | GO:0060374 | mast cell differentiation |
| 7. B | GO:0042493 | |
| 7. B | GO:0002731 | negative regulation of dendritic cell cytokine production |
| 7. B | GO:1990138 | neuron projection extension |
| 7. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 7. B | GO:2000588 | positive regulation of platelet-derived growth factor receptor-beta signaling pathway |
| 7. B | GO:0032148 | activation of protein kinase B activity |
| 7. B | GO:0001819 | positive regulation of cytokine production |
| 7. B | GO:0007229 | integrin-mediated signaling pathway |
| 7. B | GO:0032057 | negative regulation of translational initiation in response to stress |
| 7. B | GO:0051490 | negative regulation of filopodium assembly |
| 7. B | GO:0007616 | long-term memory |
| 7. B | GO:0060484 | lung-associated mesenchyme development |
| 7. B | GO:0046875 | ephrin receptor binding |
| 7. B | GO:0010857 | calcium-dependent protein kinase activity |
| 7. B | GO:0034236 | protein kinase A catalytic subunit binding |
| 7. B | GO:0045453 | bone resorption |
| 7. B | GO:0007010 | cytoskeleton organization |
| 7. B | GO:0010082 | regulation of root meristem growth |
| 7. B | GO:0021998 | neural plate mediolateral regionalization |
| 7. B | GO:0038062 | protein tyrosine kinase collagen receptor activity |
| 7. B | GO:0060350 | endochondral bone morphogenesis |
| 7. B | GO:0032723 | positive regulation of connective tissue growth factor production |
| 7. B | GO:0005829 | cytosol |
| 7. B | GO:0046332 | SMAD binding |
| 7. B | GO:0009506 | plasmodesma |
| 7. B | GO:0061445 | endocardial cushion cell fate commitment |
| 7. B | GO:0032743 | positive regulation of interleukin-2 production |
| 7. B | GO:0048012 | hepatocyte growth factor receptor signaling pathway |
| 7. B | GO:1902456 | regulation of stomatal opening |
| 7. B | GO:0003223 | ventricular compact myocardium morphogenesis |
| 7. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 7. B | GO:0060384 | innervation |
| 7. B | GO:0045167 | asymmetric protein localization involved in cell fate determination |
| 7. B | GO:0005911 | cell-cell junction |
| 7. B | GO:0007217 | tachykinin receptor signaling pathway |
| 7. B | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation |
| 7. B | GO:0035701 | hematopoietic stem cell migration |
| 7. B | GO:0035604 | fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow |
| 7. B | GO:0016170 | interleukin-15 receptor binding |
| 7. B | GO:0071670 | smooth muscle cell chemotaxis |
| 7. B | GO:0060391 | positive regulation of SMAD protein signal transduction |
| 7. B | GO:0010748 | negative regulation of long-chain fatty acid import across plasma membrane |
| 7. B | GO:0043622 | cortical microtubule organization |
| 7. B | GO:0002576 | platelet degranulation |
| 7. B | GO:0005011 | macrophage colony-stimulating factor receptor activity |
| 7. B | GO:0000226 | microtubule cytoskeleton organization |
| 7. B | GO:1901727 | positive regulation of histone deacetylase activity |
| 7. B | GO:0032006 | regulation of TOR signaling |
| 7. B | GO:0038084 | vascular endothelial growth factor signaling pathway |
| 7. B | GO:1905784 | regulation of anaphase-promoting complex-dependent catabolic process |
| 7. B | GO:0048639 | positive regulation of developmental growth |
| 7. B | GO:1902306 | negative regulation of sodium ion transmembrane transport |
| 7. B | GO:1901030 | positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway |
| 7. B | GO:0046620 | regulation of organ growth |
| 7. B | GO:0003183 | mitral valve morphogenesis |
| 7. B | GO:0005078 | MAP-kinase scaffold activity |
| 7. B | GO:0035509 | negative regulation of myosin-light-chain-phosphatase activity |
| 7. B | GO:0150034 | distal axon |
| 7. B | GO:0005080 | protein kinase C binding |
| 7. B | GO:0007395 | dorsal closure, spreading of leading edge cells |
| 7. B | GO:0051964 | negative regulation of synapse assembly |
| 7. B | GO:0060412 | ventricular septum morphogenesis |
| 7. B | GO:0016324 | apical plasma membrane |
| 7. B | GO:0060434 | bronchus morphogenesis |
| 7. B | GO:1903347 | negative regulation of bicellular tight junction assembly |
| 7. B | GO:0070853 | myosin VI binding |
| 7. B | GO:0044843 | cell cycle G1/S phase transition |
| 7. B | GO:0014065 | phosphatidylinositol 3-kinase signaling |
| 7. B | GO:0060385 | axonogenesis involved in innervation |
| 7. B | GO:0022904 | respiratory electron transport chain |
| 7. B | GO:0019869 | chloride channel inhibitor activity |
| 7. B | GO:0007528 | neuromuscular junction development |
| 7. B | GO:1905188 | positive regulation of metaphase/anaphase transition of meiosis I |
| 7. B | GO:0010975 | regulation of neuron projection development |
| 7. B | GO:0032753 | positive regulation of interleukin-4 production |
| 7. B | GO:2000772 | regulation of cellular senescence |
| 7. B | GO:1902595 | regulation of DNA replication origin binding |
| 7. B | GO:0009729 | detection of brassinosteroid stimulus |
| 7. B | GO:0045221 | negative regulation of FasL production |
| 7. B | GO:0071593 | lymphocyte aggregation |
| 7. B | GO:0045500 | sevenless signaling pathway |
| 7. B | GO:0035669 | TRAM-dependent toll-like receptor 4 signaling pathway |
| 7. B | GO:0048009 | insulin-like growth factor receptor signaling pathway |
| 7. B | GO:0010119 | regulation of stomatal movement |
| 7. B | GO:0002732 | positive regulation of dendritic cell cytokine production |
| 7. B | GO:0002223 | stimulatory C-type lectin receptor signaling pathway |
| 7. B | GO:0032156 | septin cytoskeleton |
| 7. B | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 7. B | GO:0030324 | lung development |
| 7. B | GO:2000124 | regulation of endocannabinoid signaling pathway |
| 7. B | GO:0000917 | division septum assembly |
| 7. B | GO:0043015 | gamma-tubulin binding |
| 7. B | GO:0070667 | negative regulation of mast cell proliferation |
| 7. B | GO:1901017 | negative regulation of potassium ion transmembrane transporter activity |
| 7. B | GO:2000370 | positive regulation of clathrin-dependent endocytosis |
| 7. B | GO:0010998 | regulation of translational initiation by eIF2 alpha phosphorylation |
| 7. B | GO:0032079 | positive regulation of endodeoxyribonuclease activity |
| 7. B | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 7. B | GO:0019903 | protein phosphatase binding |
| 7. B | GO:0048352 | paraxial mesoderm structural organization |
| 7. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 7. B | GO:0071363 | cellular response to growth factor stimulus |
| 7. B | GO:0003700 | DNA-binding transcription factor activity |
| 7. B | GO:0048813 | dendrite morphogenesis |
| 7. B | GO:1990837 | sequence-specific double-stranded DNA binding |
| 7. B | GO:0071889 | 14-3-3 protein binding |
| 7. B | GO:0071223 | cellular response to lipoteichoic acid |
| 7. B | GO:0046986 | negative regulation of hemoglobin biosynthetic process |
| 7. B | GO:0071380 | cellular response to prostaglandin E stimulus |
| 7. B | GO:1903926 | cellular response to bisphenol A |
| 7. B | GO:0061626 | pharyngeal arch artery morphogenesis |
| 7. B | GO:0097191 | extrinsic apoptotic signaling pathway |
| 7. B | GO:0045124 | regulation of bone resorption |
| 7. B | GO:0008384 | IkappaB kinase activity |
| 7. B | GO:0005615 | extracellular space |
| 7. B | GO:0060068 | vagina development |
| 7. B | GO:0010803 | regulation of tumor necrosis factor-mediated signaling pathway |
| 7. B | GO:0043555 | regulation of translation in response to stress |
| 7. B | GO:0062028 | regulation of stress granule assembly |
| 7. B | GO:0043559 | insulin binding |
| 7. B | GO:0035063 | nuclear speck organization |
| 7. B | GO:0045887 | positive regulation of synaptic assembly at neuromuscular junction |
| 7. B | GO:0045880 | positive regulation of smoothened signaling pathway |
| 7. B | GO:1901563 | response to camptothecin |
| 7. B | GO:0060836 | lymphatic endothelial cell differentiation |
| 7. B | GO:0019227 | neuronal action potential propagation |
| 7. B | GO:0006633 | fatty acid biosynthetic process |
| 7. B | GO:0009615 | response to virus |
| 7. B | GO:0035790 | platelet-derived growth factor receptor-alpha signaling pathway |
| 7. B | GO:0009875 | pollen-pistil interaction |
| 7. B | GO:0036479 | peroxidase inhibitor activity |
| 7. B | GO:0034352 | positive regulation of glial cell apoptotic process |
| 7. B | GO:0033612 | receptor serine/threonine kinase binding |
| 7. B | GO:0009737 | response to abscisic acid |
| 7. B | GO:0032940 | secretion by cell |
| 7. B | GO:0046529 | imaginal disc fusion, thorax closure |
| 7. B | GO:0046605 | regulation of centrosome cycle |
| 7. B | GO:0090025 | regulation of monocyte chemotaxis |
| 7. B | GO:1903109 | positive regulation of mitochondrial transcription |
| 7. B | GO:0000398 | mRNA splicing, via spliceosome |
| 7. B | GO:0046621 | negative regulation of organ growth |
| 7. B | GO:0070054 | mRNA splicing, via endonucleolytic cleavage and ligation |
| 7. B | GO:0060235 | lens induction in camera-type eye |
| 7. B | GO:0030889 | negative regulation of B cell proliferation |
| 7. B | GO:1903669 | positive regulation of chemorepellent activity |
| 7. B | GO:2000100 | regulation of establishment or maintenance of bipolar cell polarity regulating cell shape |
| 7. B | GO:1901485 | positive regulation of transcription factor catabolic process |
| 7. B | GO:0033017 | sarcoplasmic reticulum membrane |
| 7. B | GO:0005009 | insulin-activated receptor activity |
| 7. B | GO:0048179 | activin receptor complex |
| 7. B | GO:0046326 | positive regulation of glucose import |
| 7. B | GO:0045773 | positive regulation of axon extension |
| 7. B | GO:1990869 | cellular response to chemokine |
| 7. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 7. B | GO:0010752 | regulation of cGMP-mediated signaling |
| 7. B | GO:0051893 | regulation of focal adhesion assembly |
| 7. B | GO:0004694 | eukaryotic translation initiation factor 2alpha kinase activity |
| 7. B | GO:0009742 | brassinosteroid mediated signaling pathway |
| 7. B | GO:0090303 | positive regulation of wound healing |
| 7. B | GO:0051174 | regulation of phosphorus metabolic process |
| 7. B | GO:0038093 | Fc receptor signaling pathway |
| 7. B | GO:0038132 | neuregulin binding |
| 7. B | GO:1902065 | response to L-glutamate |
| 7. B | GO:0001779 | natural killer cell differentiation |
| 7. B | GO:0003197 | endocardial cushion development |
| 7. B | GO:1901215 | negative regulation of neuron death |
| 7. B | GO:0008286 | insulin receptor signaling pathway |
| 7. B | GO:1900150 | regulation of defense response to fungus |
| 7. B | GO:1905448 | positive regulation of mitochondrial ATP synthesis coupled electron transport |
| 7. B | GO:1990604 | IRE1-TRAF2-ASK1 complex |
| 7. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 7. B | GO:0043990 | histone H2A-S1 phosphorylation |
| 7. B | GO:0070724 | BMP receptor complex |
| 7. B | GO:0002040 | sprouting angiogenesis |
| 7. B | GO:0005010 | insulin-like growth factor-activated receptor activity |
| 7. B | GO:0046501 | protoporphyrinogen IX metabolic process |
| 7. B | GO:0042177 | negative regulation of protein catabolic process |
| 7. B | GO:0007121 | bipolar cellular bud site selection |
| 7. B | GO:0005154 | epidermal growth factor receptor binding |
| 7. B | GO:0110061 | regulation of angiotensin-activated signaling pathway |
| 7. B | GO:0010862 | positive regulation of pathway-restricted SMAD protein phosphorylation |
| 7. B | GO:0071499 | cellular response to laminar fluid shear stress |
| 7. B | GO:0003690 | double-stranded DNA binding |
| 7. B | GO:0007391 | dorsal closure |
| 7. B | GO:2001226 | negative regulation of chloride transport |
| 7. B | GO:0043586 | tongue development |
| 7. B | GO:1900745 | positive regulation of p38MAPK cascade |
| 7. B | GO:0048015 | phosphatidylinositol-mediated signaling |
| 7. B | GO:0014042 | positive regulation of neuron maturation |
| 7. B | GO:0035690 | |
| 7. B | GO:1903067 | negative regulation of protein localization to cell tip |
| 7. B | GO:0043327 | chemotaxis to cAMP |
| 7. B | GO:0001828 | inner cell mass cellular morphogenesis |
| 7. B | GO:0050850 | positive regulation of calcium-mediated signaling |
| 7. B | GO:0038096 | Fc-gamma receptor signaling pathway involved in phagocytosis |
| 7. B | GO:0010311 | lateral root formation |
| 7. B | GO:0042127 | regulation of cell population proliferation |
| 7. B | GO:0016242 | negative regulation of macroautophagy |
| 7. B | GO:0061098 | positive regulation of protein tyrosine kinase activity |
| 7. B | GO:0009638 | phototropism |
| 7. B | GO:0010918 | positive regulation of mitochondrial membrane potential |
| 7. B | GO:0072262 | metanephric glomerular mesangial cell proliferation involved in metanephros development |
| 7. B | GO:0034612 | response to tumor necrosis factor |
| 7. B | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 7. B | GO:0005765 | lysosomal membrane |
| 7. B | GO:0098821 | BMP receptor activity |
| 7. B | GO:0097528 | execution phase of necroptosis |
| 7. B | GO:0050773 | regulation of dendrite development |
| 7. B | GO:0030866 | cortical actin cytoskeleton organization |
| 7. B | GO:0031929 | TOR signaling |
| 7. B | GO:2001239 | regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 7. B | GO:0048597 | post-embryonic camera-type eye morphogenesis |
| 7. B | GO:0035441 | cell migration involved in vasculogenesis |
| 7. B | GO:1903800 | positive regulation of production of miRNAs involved in gene silencing by miRNA |
| 7. B | GO:0099523 | presynaptic cytosol |
| 7. B | GO:0038116 | chemokine (C-C motif) ligand 21 signaling pathway |
| 7. B | GO:0010074 | maintenance of meristem identity |
| 7. B | GO:0010656 | negative regulation of muscle cell apoptotic process |
| 7. B | GO:0031625 | ubiquitin protein ligase binding |
| 7. B | GO:0043084 | penile erection |
| 7. B | GO:0038191 | neuropilin binding |
| 7. B | GO:1905205 | positive regulation of connective tissue replacement |
| 7. B | GO:0020002 | host cell plasma membrane |
| 7. B | GO:0010933 | positive regulation of macrophage tolerance induction |
| 7. B | GO:0005618 | cell wall |
| 7. B | GO:0032091 | negative regulation of protein binding |
| 7. B | GO:0043525 | positive regulation of neuron apoptotic process |
| 7. B | GO:0016567 | protein ubiquitination |
| 7. B | GO:0030218 | erythrocyte differentiation |
| 7. B | GO:0060037 | pharyngeal system development |
| 7. B | GO:0010973 | positive regulation of division septum assembly |
| 7. B | GO:2000491 | positive regulation of hepatic stellate cell activation |
| 7. B | GO:0036323 | vascular endothelial growth factor receptor-1 signaling pathway |
| 7. B | GO:2001222 | regulation of neuron migration |
| 7. B | GO:0050927 | positive regulation of positive chemotaxis |
| 7. B | GO:1905065 | positive regulation of vascular associated smooth muscle cell differentiation |
| 7. B | GO:0072687 | meiotic spindle |
| 7. B | GO:0050793 | regulation of developmental process |
| 7. B | GO:0106028 | neuron projection retraction |
| 7. B | GO:0048598 | embryonic morphogenesis |
| 7. B | GO:1905426 | positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation |
| 7. B | GO:0000806 | Y chromosome |
| 7. B | GO:0051602 | response to electrical stimulus |
| 7. B | GO:2000538 | positive regulation of B cell chemotaxis |
| 7. B | GO:0050801 | ion homeostasis |
| 7. B | GO:1904526 | regulation of microtubule binding |
| 7. B | GO:2000052 | positive regulation of non-canonical Wnt signaling pathway |
| 7. B | GO:0034115 | negative regulation of heterotypic cell-cell adhesion |
| 7. B | GO:0034666 | integrin alpha2-beta1 complex |
| 7. B | GO:0004675 | transmembrane receptor protein serine/threonine kinase activity |
| 7. B | GO:0033630 | positive regulation of cell adhesion mediated by integrin |
| 7. B | GO:0051087 | chaperone binding |
| 7. B | GO:0009507 | chloroplast |
| 7. B | GO:0038092 | nodal signaling pathway |
| 7. B | GO:0140469 | GCN2-mediated signaling |
| 7. B | GO:0021766 | hippocampus development |
| 7. B | GO:0061178 | regulation of insulin secretion involved in cellular response to glucose stimulus |
| 7. B | GO:1903038 | negative regulation of leukocyte cell-cell adhesion |
| 7. B | GO:0021885 | forebrain cell migration |
| 7. B | GO:1903096 | protein localization to meiotic spindle midzone |
| 7. B | GO:0048008 | platelet-derived growth factor receptor signaling pathway |
| 7. B | GO:2000303 | regulation of ceramide biosynthetic process |
| 7. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 7. B | GO:0005006 | epidermal growth factor-activated receptor activity |
| 7. B | GO:1905564 | positive regulation of vascular endothelial cell proliferation |
| 7. B | GO:0070059 | intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress |
| 7. B | GO:0060562 | epithelial tube morphogenesis |
| 7. B | GO:0008285 | negative regulation of cell population proliferation |
| 7. B | GO:0061072 | iris morphogenesis |
| 7. B | GO:0071803 | positive regulation of podosome assembly |
| 7. B | GO:0045588 | positive regulation of gamma-delta T cell differentiation |
| 7. B | GO:0005899 | insulin receptor complex |
| 7. B | GO:0007257 | obsolete activation of JUN kinase activity |
| 7. B | GO:1990315 | Mcs4 RR-MAPKKK complex |
| 7. B | GO:0051279 | regulation of release of sequestered calcium ion into cytosol |
| 7. B | GO:0034988 | Fc-gamma receptor I complex binding |
| 7. B | GO:0048041 | focal adhesion assembly |
| 7. B | GO:0001672 | regulation of chromatin assembly or disassembly |
| 7. B | GO:0000161 | osmosensory signaling MAPK cascade |
| 7. B | GO:0030949 | positive regulation of vascular endothelial growth factor receptor signaling pathway |
| 7. B | GO:0097300 | programmed necrotic cell death |
| 7. B | GO:0051272 | positive regulation of cellular component movement |
| 7. B | GO:1902017 | regulation of cilium assembly |
| 7. B | GO:0003203 | endocardial cushion morphogenesis |
| 7. B | GO:0010229 | inflorescence development |
| 7. B | GO:0071555 | cell wall organization |
| 7. B | GO:1903126 | negative regulation of centriole-centriole cohesion |
| 7. B | GO:0005161 | platelet-derived growth factor receptor binding |
| 7. B | GO:0008340 | determination of adult lifespan |
| 7. B | GO:0004699 | calcium-independent protein kinase C activity |
| 7. B | GO:0002651 | positive regulation of tolerance induction to self antigen |
| 7. B | GO:2000452 | regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation |
| 7. B | GO:0038033 | positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway |
| 7. B | GO:0005789 | endoplasmic reticulum membrane |
| 7. B | GO:0043022 | ribosome binding |
| 7. B | GO:0060601 | lateral sprouting from an epithelium |
| 7. B | GO:0002229 | defense response to oomycetes |
| 7. B | GO:0072656 | maintenance of protein location in mitochondrion |
| 7. B | GO:0071447 | cellular response to hydroperoxide |
| 7. B | GO:1900195 | positive regulation of oocyte maturation |
| 7. B | GO:1902532 | negative regulation of intracellular signal transduction |
| 7. B | GO:0005935 | cellular bud neck |
| 7. B | GO:0050910 | detection of mechanical stimulus involved in sensory perception of sound |
| 7. B | GO:0050732 | negative regulation of peptidyl-tyrosine phosphorylation |
| 7. B | GO:0097324 | melanocyte migration |
| 7. B | GO:0017002 | activin-activated receptor activity |
| 7. B | GO:0022408 | negative regulation of cell-cell adhesion |
| 7. B | GO:0008283 | cell population proliferation |
| 7. B | GO:0008045 | motor neuron axon guidance |
| 7. B | GO:0010540 | basipetal auxin transport |
| 7. B | GO:0000187 | obsolete activation of MAPK activity |
| 7. B | GO:0007611 | learning or memory |
| 7. B | GO:0033605 | positive regulation of catecholamine secretion |
| 7. B | GO:0061146 | Peyer's patch morphogenesis |
| 7. B | GO:0043304 | regulation of mast cell degranulation |
| 7. B | GO:0030296 | protein tyrosine kinase activator activity |
| 7. B | GO:0036006 | cellular response to macrophage colony-stimulating factor stimulus |
| 7. B | GO:0033628 | regulation of cell adhesion mediated by integrin |
| 7. B | GO:0061144 | alveolar secondary septum development |
| 7. B | GO:0000976 | transcription cis-regulatory region binding |
| 7. B | GO:0010966 | regulation of phosphate transport |
| 7. B | GO:0032927 | positive regulation of activin receptor signaling pathway |
| 7. B | GO:0010657 | muscle cell apoptotic process |
| 7. B | GO:0043539 | protein serine/threonine kinase activator activity |
| 7. B | GO:0042770 | signal transduction in response to DNA damage |
| 7. B | GO:0003924 | GTPase activity |
| 7. B | GO:0036035 | osteoclast development |
| 7. B | GO:0048508 | embryonic meristem development |
| 7. B | GO:0106137 | IkappaB kinase complex binding |
| 7. B | GO:0097123 | cyclin A1-CDK2 complex |
| 7. B | GO:0004676 | 3-phosphoinositide-dependent protein kinase activity |
| 7. B | GO:1905145 | cellular response to acetylcholine |
| 7. B | GO:0043274 | phospholipase binding |
| 7. B | GO:0035789 | metanephric mesenchymal cell migration |
| 7. B | GO:1903125 | negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation |
| 7. B | GO:0060529 | squamous basal epithelial stem cell differentiation involved in prostate gland acinus development |
| 7. B | GO:0048544 | recognition of pollen |
| 7. B | GO:0030316 | osteoclast differentiation |
| 7. B | GO:0005743 | mitochondrial inner membrane |
| 7. B | GO:0051425 | PTB domain binding |
| 7. B | GO:0003274 | endocardial cushion fusion |
| 7. B | GO:0014722 | regulation of skeletal muscle contraction by calcium ion signaling |
| 7. B | GO:0010999 | regulation of eIF2 alpha phosphorylation by heme |
| 7. B | GO:0045840 | positive regulation of mitotic nuclear division |
| 7. B | GO:0048378 | regulation of lateral mesodermal cell fate specification |
| 7. B | GO:0042802 | identical protein binding |
| 7. B | GO:0009611 | response to wounding |
| 7. B | GO:0016533 | protein kinase 5 complex |
| 7. B | GO:0003824 | catalytic activity |
| 7. B | GO:0016361 | activin receptor activity, type I |
| 7. B | GO:0098883 | synapse pruning |
| 7. B | GO:0001934 | positive regulation of protein phosphorylation |
| 7. B | GO:0060923 | cardiac muscle cell fate commitment |
| 7. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 7. B | GO:0007163 | establishment or maintenance of cell polarity |
| 7. B | GO:0097473 | retinal rod cell apoptotic process |
| 7. B | GO:1904707 | positive regulation of vascular associated smooth muscle cell proliferation |
| 7. B | GO:1904781 | positive regulation of protein localization to centrosome |
| 7. B | GO:0006814 | sodium ion transport |
| 7. B | GO:0031175 | neuron projection development |
| 7. B | GO:0140468 | HRI-mediated signaling |
| 7. B | GO:0042490 | mechanoreceptor differentiation |
| 7. B | GO:0036481 | intrinsic apoptotic signaling pathway in response to hydrogen peroxide |
| 7. B | GO:1903340 | positive regulation of cell wall organization or biogenesis |
| 7. B | GO:0044819 | mitotic G1/S transition checkpoint signaling |
| 7. B | GO:0071323 | cellular response to chitin |
| 7. B | GO:0003149 | membranous septum morphogenesis |
| 7. B | GO:0032991 | protein-containing complex |
| 7. B | GO:0048661 | positive regulation of smooth muscle cell proliferation |
| 7. B | GO:0046627 | negative regulation of insulin receptor signaling pathway |
| 7. B | GO:0002663 | positive regulation of B cell tolerance induction |
| 7. B | GO:0110115 | Cdr2 medial cortical node complex |
| 7. B | GO:0042641 | actomyosin |
| 7. B | GO:0030325 | adrenal gland development |
| 7. B | GO:0048762 | mesenchymal cell differentiation |
| 7. B | GO:0030501 | positive regulation of bone mineralization |
| 7. B | GO:0035162 | embryonic hemopoiesis |
| 7. B | GO:2001031 | positive regulation of cellular glucuronidation |
| 7. B | GO:0042698 | ovulation cycle |
| 7. B | GO:0043507 | positive regulation of JUN kinase activity |
| 7. B | GO:0039525 | modulation by virus of host chromatin organization |
| 7. B | GO:0031569 | mitotic G2 cell size control checkpoint signaling |
| 7. B | GO:0071393 | cellular response to progesterone stimulus |
| 7. B | GO:0003148 | outflow tract septum morphogenesis |
| 7. B | GO:0001914 | regulation of T cell mediated cytotoxicity |
| 7. B | GO:0007507 | heart development |
| 7. B | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 7. B | GO:0038095 | Fc-epsilon receptor signaling pathway |
| 7. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 7. B | GO:0030509 | BMP signaling pathway |
| 7. B | GO:0032765 | positive regulation of mast cell cytokine production |
| 7. B | GO:0010666 | positive regulation of cardiac muscle cell apoptotic process |
| 7. B | GO:0002333 | transitional one stage B cell differentiation |
| 7. B | GO:0043366 | beta selection |
| 7. B | GO:0021860 | pyramidal neuron development |
| 7. B | GO:0005018 | platelet-derived growth factor alpha-receptor activity |
| 7. B | GO:0018298 | protein-chromophore linkage |
| 7. B | GO:0002030 | inhibitory G protein-coupled receptor phosphorylation |
| 7. B | GO:0046959 | habituation |
| 7. B | GO:0097431 | mitotic spindle pole |
| 7. B | GO:0000049 | tRNA binding |
| 7. B | GO:0045766 | positive regulation of angiogenesis |
| 7. B | GO:0031589 | cell-substrate adhesion |
| 7. B | GO:0061026 | cardiac muscle tissue regeneration |
| 7. B | GO:0009791 | post-embryonic development |
| 7. B | GO:0071879 | positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway |
| 7. B | GO:0061368 | behavioral response to formalin induced pain |
| 7. B | GO:0060326 | cell chemotaxis |
| 7. B | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 7. B | GO:2000017 | positive regulation of determination of dorsal identity |
| 7. B | GO:0045822 | negative regulation of heart contraction |
| 7. B | GO:0044732 | mitotic spindle pole body |
| 7. B | GO:0035603 | fibroblast growth factor receptor signaling pathway involved in hemopoiesis |
| 7. B | GO:0032960 | regulation of inositol trisphosphate biosynthetic process |
| 7. B | GO:0010715 | regulation of extracellular matrix disassembly |
| 7. B | GO:0010765 | positive regulation of sodium ion transport |
| 7. B | GO:0031032 | actomyosin structure organization |
| 7. B | GO:0060369 | positive regulation of Fc receptor mediated stimulatory signaling pathway |
| 7. B | GO:0003289 | atrial septum primum morphogenesis |
| 7. B | GO:1900424 | regulation of defense response to bacterium |
| 7. B | GO:0045839 | negative regulation of mitotic nuclear division |
| 7. B | GO:0006402 | mRNA catabolic process |
| 7. B | GO:0140537 | transcription regulator activator activity |
| 7. B | GO:0006281 | DNA repair |
| 7. B | GO:0061049 | cell growth involved in cardiac muscle cell development |
| 7. B | GO:2001108 | positive regulation of Rho guanyl-nucleotide exchange factor activity |
| 7. B | GO:1902728 | positive regulation of growth factor dependent skeletal muscle satellite cell proliferation |
| 7. B | GO:0010360 | negative regulation of anion channel activity |
| 7. B | GO:0030900 | forebrain development |
| 7. B | GO:1904776 | regulation of protein localization to cell cortex |
| 7. B | GO:1904062 | regulation of cation transmembrane transport |
| 7. B | GO:0048705 | skeletal system morphogenesis |
| 7. B | GO:0003729 | mRNA binding |
| 7. B | GO:0006508 | proteolysis |
| 7. B | GO:0032587 | ruffle membrane |
| 7. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 7. B | GO:0019870 | potassium channel inhibitor activity |
| 7. B | GO:0055028 | cortical microtubule |
| 7. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 7. B | GO:0060761 | negative regulation of response to cytokine stimulus |
| 7. B | GO:0034134 | toll-like receptor 2 signaling pathway |
| 7. B | GO:0031398 | positive regulation of protein ubiquitination |
| 7. B | GO:0010868 | negative regulation of triglyceride biosynthetic process |
| 7. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 7. B | GO:0090176 | microtubule cytoskeleton organization involved in establishment of planar polarity |
| 7. B | GO:0048710 | regulation of astrocyte differentiation |
| 7. B | GO:0006357 | regulation of transcription by RNA polymerase II |
| 7. B | GO:0060159 | regulation of dopamine receptor signaling pathway |
| 7. B | GO:0006298 | mismatch repair |
| 7. B | GO:0038085 | vascular endothelial growth factor binding |
| 7. B | GO:0007417 | central nervous system development |
| 7. B | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 7. B | GO:0032924 | activin receptor signaling pathway |
| 7. B | GO:1902004 | positive regulation of amyloid-beta formation |
| 7. B | GO:0061847 | response to cholecystokinin |
| 7. B | GO:1901383 | negative regulation of chorionic trophoblast cell proliferation |
| 7. B | GO:2000830 | positive regulation of parathyroid hormone secretion |
| 7. B | GO:0051353 | positive regulation of oxidoreductase activity |
| 7. B | GO:0010181 | FMN binding |
| 7. B | GO:0030536 | larval feeding behavior |
| 7. B | GO:0009612 | response to mechanical stimulus |
| 7. B | GO:0001410 | chlamydospore formation |
| 7. B | GO:0048678 | response to axon injury |
| 7. B | GO:0048185 | activin binding |
| 7. B | GO:0106027 | neuron projection organization |
| 7. B | GO:0001935 | endothelial cell proliferation |
| 7. B | GO:0030546 | signaling receptor activator activity |
| 7. B | GO:0014816 | skeletal muscle satellite cell differentiation |
| 7. B | GO:0005925 | focal adhesion |
| 7. B | GO:0002098 | tRNA wobble uridine modification |
| 7. B | GO:0035791 | platelet-derived growth factor receptor-beta signaling pathway |
| 7. B | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 7. B | GO:0051444 | negative regulation of ubiquitin-protein transferase activity |
| 7. B | GO:0140582 | adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway |
| 7. B | GO:0007568 | aging |
| 7. B | GO:0010726 | positive regulation of hydrogen peroxide metabolic process |
| 7. B | GO:0001764 | neuron migration |
| 7. B | GO:0098978 | glutamatergic synapse |
| 7. B | GO:0005198 | structural molecule activity |
| 7. B | GO:0008349 | MAP kinase kinase kinase kinase activity |
| 7. B | GO:0060292 | long-term synaptic depression |
| 7. B | GO:0035722 | interleukin-12-mediated signaling pathway |
| 7. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 7. B | GO:0070640 | vitamin D3 metabolic process |
| 7. B | GO:0008288 | boss receptor activity |
| 7. B | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 7. B | GO:0002244 | hematopoietic progenitor cell differentiation |
| 7. B | GO:2000058 | regulation of ubiquitin-dependent protein catabolic process |
| 7. B | GO:0031669 | cellular response to nutrient levels |
| 7. B | GO:0005017 | platelet-derived growth factor-activated receptor activity |
| 7. B | GO:0030335 | positive regulation of cell migration |
| 7. B | GO:2001271 | negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis |
| 7. B | GO:0001649 | osteoblast differentiation |
| 7. B | GO:2000650 | negative regulation of sodium ion transmembrane transporter activity |
| 7. B | GO:0046664 | dorsal closure, amnioserosa morphology change |
| 7. B | GO:1905317 | inferior endocardial cushion morphogenesis |
| 7. B | GO:0030587 | sorocarp development |
| 7. B | GO:1903829 | positive regulation of protein localization |
| 7. B | GO:1905285 | fibrous ring of heart morphogenesis |
| 7. B | GO:0031547 | brain-derived neurotrophic factor receptor signaling pathway |
| 7. B | GO:0048680 | positive regulation of axon regeneration |
| 7. B | GO:0070235 | regulation of activation-induced cell death of T cells |
| 7. B | GO:0060368 | regulation of Fc receptor mediated stimulatory signaling pathway |
| 7. B | GO:0045597 | positive regulation of cell differentiation |
| 7. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 7. B | GO:0045785 | positive regulation of cell adhesion |
| 7. B | GO:0000196 | cell wall integrity MAPK cascade |
| 7. B | GO:0097062 | dendritic spine maintenance |
| 7. B | GO:0002513 | tolerance induction to self antigen |
| 7. B | GO:0040024 | dauer larval development |
| 7. B | GO:0060644 | mammary gland epithelial cell differentiation |
| 7. B | GO:1903998 | regulation of eating behavior |
| 7. B | GO:0019900 | kinase binding |
| 7. B | GO:2000369 | regulation of clathrin-dependent endocytosis |
| 7. B | GO:0060545 | positive regulation of necroptotic process |
| 7. B | GO:0097135 | cyclin E2-CDK2 complex |
| 7. B | GO:0070885 | negative regulation of calcineurin-NFAT signaling cascade |
| 7. B | GO:0035602 | fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow cell |
| 7. B | GO:0042742 | defense response to bacterium |
| 7. B | GO:1990277 | parasexual conjugation with cellular fusion |
| 7. B | GO:0009826 | unidimensional cell growth |
| 7. B | GO:0051446 | positive regulation of meiotic cell cycle |
| 7. B | GO:0021631 | optic nerve morphogenesis |
| 7. B | GO:1900225 | regulation of NLRP3 inflammasome complex assembly |
| 7. B | GO:1905832 | positive regulation of spindle assembly |
| 7. B | GO:0038156 | interleukin-3-mediated signaling pathway |
| 7. B | GO:0050794 | regulation of cellular process |
| 7. B | GO:2001286 | regulation of caveolin-mediated endocytosis |
| 7. B | GO:1905037 | autophagosome organization |
| 7. B | GO:0070141 | response to UV-A |
| 7. B | GO:0097009 | energy homeostasis |
| 7. B | GO:0045943 | positive regulation of transcription by RNA polymerase I |
| 7. B | GO:0060244 | negative regulation of cell proliferation involved in contact inhibition |
| 7. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 7. B | GO:1903500 | negative regulation of mitotic actomyosin contractile ring assembly |
| 7. B | GO:0038063 | collagen-activated tyrosine kinase receptor signaling pathway |
| 7. B | GO:0007077 | mitotic nuclear membrane disassembly |
| 7. B | GO:1903140 | regulation of establishment of endothelial barrier |
| 7. B | GO:0072277 | metanephric glomerular capillary formation |
| 7. B | GO:0045616 | regulation of keratinocyte differentiation |
| 7. B | GO:0070507 | regulation of microtubule cytoskeleton organization |
| 7. B | GO:0099159 | regulation of modification of postsynaptic structure |
| 7. B | GO:1902856 | negative regulation of non-motile cilium assembly |
| 7. B | GO:0021769 | orbitofrontal cortex development |
| 7. B | GO:0051222 | positive regulation of protein transport |
| 7. B | GO:1904291 | positive regulation of mitotic DNA damage checkpoint |
| 7. B | GO:0020037 | heme binding |
| 7. B | GO:0046628 | positive regulation of insulin receptor signaling pathway |
| 7. B | GO:0048675 | axon extension |
| 7. B | GO:0010766 | negative regulation of sodium ion transport |
| 7. B | GO:0021837 | motogenic signaling involved in postnatal olfactory bulb interneuron migration |
| 7. B | GO:0061762 | CAMKK-AMPK signaling cascade |
| 7. B | GO:0005019 | platelet-derived growth factor beta-receptor activity |
| 7. B | GO:2000696 | regulation of epithelial cell differentiation involved in kidney development |
| 7. B | GO:0048168 | regulation of neuronal synaptic plasticity |
| 7. B | GO:0010820 | positive regulation of T cell chemotaxis |
| 7. B | GO:0061833 | protein localization to tricellular tight junction |
| 7. B | GO:0035376 | sterol import |
| 7. B | GO:0040020 | regulation of meiotic nuclear division |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0106310 | protein serine kinase activity |
| GO:0016310 | phosphorylation |
| GO:0016021 | integral component of membrane |
| GO:0016020 | membrane |
| GO:0005524 | ATP binding |
| GO:0006468 | protein phosphorylation |
| GO:0004674 | protein serine/threonine kinase activity |
| GO:0004672 | protein kinase activity |
| GO:0016301 | kinase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A4QXX4 | Serine/threonine-protein kinase SSN3 | 2.88e-05 | 6.02e-03 | 2.30e-07 | 0.6277 |
| 1. PBF | Q875L0 | Mitogen-activated protein kinase HOG1 | 2.09e-09 | 2.65e-03 | 6.05e-19 | 0.5725 |
| 1. PBF | Q6GLD8 | Cyclin-dependent kinase 9 | 3.53e-08 | 2.36e-02 | 6.84e-07 | 0.5352 |
| 1. PBF | Q91604 | Serine/threonine-protein kinase stk11 | 1.45e-09 | 3.21e-07 | 5.45e-14 | 0.6119 |
| 1. PBF | Q8SR85 | Probable cell division control protein 7 homolog 1 | 2.94e-05 | 3.55e-08 | 1.11e-09 | 0.6022 |
| 1. PBF | Q8NJT7 | Mitogen-activated protein kinase HOG1 | 1.76e-09 | 4.66e-04 | 3.28e-20 | 0.61 |
| 1. PBF | Q40531 | Mitogen-activated protein kinase homolog NTF6 | 1.45e-07 | 1.26e-02 | 6.59e-13 | 0.6033 |
| 1. PBF | Q02595 | Probable serine/threonine-protein kinase 2 | 5.20e-07 | 2.93e-02 | 3.06e-09 | 0.5533 |
| 1. PBF | Q3SZW1 | Testis-specific serine/threonine-protein kinase 1 | 1.13e-09 | 1.48e-02 | 2.50e-14 | 0.6647 |
| 1. PBF | Q9GM70 | Serine/threonine-protein kinase 17A | 2.98e-09 | 2.22e-05 | 2.07e-14 | 0.617 |
| 1. PBF | P67963 | Casein kinase I isoform alpha | 4.64e-11 | 2.71e-09 | 2.33e-08 | 0.616 |
| 1. PBF | A2QU77 | Serine/threonine-protein kinase ssn3 | 3.19e-06 | 2.20e-06 | 2.41e-08 | 0.5475 |
| 1. PBF | Q5ZK47 | STE20-related kinase adapter protein alpha | 6.02e-07 | 5.58e-04 | 0.004 | 0.5044 |
| 1. PBF | O14408 | Calcium/calmodulin-dependent protein kinase | 2.03e-09 | 4.83e-09 | 6.88e-15 | 0.6693 |
| 1. PBF | Q2KJ16 | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform | 1.80e-08 | 1.52e-07 | 6.40e-15 | 0.6597 |
| 1. PBF | P0CP66 | Mitogen-activated protein kinase CPK1 | 1.88e-08 | 3.70e-02 | 1.08e-13 | 0.5608 |
| 1. PBF | Q9YGW0 | MAP kinase-interacting serine/threonine-protein kinase 1 | 2.67e-08 | 2.46e-10 | 5.46e-10 | 0.6451 |
| 1. PBF | A3LN91 | Mitogen-activated protein kinase HOG1 | 2.14e-08 | 2.76e-03 | 4.19e-19 | 0.5812 |
| 1. PBF | Q91822 | Serine/threonine-protein kinase pim-3 | 3.19e-09 | 8.00e-03 | 5.62e-07 | 0.6199 |
| 1. PBF | Q4WSF6 | Mitogen-activated protein kinase hog1 | 2.39e-09 | 1.78e-03 | 2.05e-19 | 0.5878 |
| 1. PBF | A1CL96 | Serine/threonine-protein kinase ssn3 | 2.18e-07 | 3.72e-06 | 6.37e-10 | 0.569 |
| 1. PBF | Q9YGM4 | CaM kinase-like vesicle-associated protein | 2.18e-07 | 7.62e-03 | 8.82e-07 | 0.6669 |
| 1. PBF | A1DES4 | Mitogen-activated protein kinase mpkC | 1.35e-07 | 4.67e-02 | 4.37e-17 | 0.542 |
| 1. PBF | Q4KTY1 | Serine/threonine-protein kinase H1 homolog | 1.39e-07 | 1.72e-02 | 1.66e-12 | 0.607 |
| 1. PBF | A7MB74 | Serine/threonine-protein kinase Sgk1 | 1.63e-08 | 3.88e-02 | 1.94e-11 | 0.6267 |
| 1. PBF | Q61XD3 | Aurora/IPL1-related protein kinase 2 | 3.10e-10 | 5.40e-03 | 1.15e-12 | 0.6494 |
| 1. PBF | Q8IHZ9 | Casein kinase I | 8.76e-12 | 1.71e-10 | 1.08e-10 | 0.6573 |
| 1. PBF | Q58D94 | MAP kinase-interacting serine/threonine-protein kinase 1 | 1.29e-08 | 1.81e-07 | 1.33e-10 | 0.6368 |
| 1. PBF | Q5ZKN1 | Cyclin-dependent kinase 9 | 3.88e-08 | 4.00e-03 | 1.10e-06 | 0.5589 |
| 1. PBF | Q0CQK1 | Serine/threonine-protein kinase ssn3 | 8.83e-07 | 3.23e-05 | 3.16e-09 | 0.5462 |
| 1. PBF | Q00859 | Mitogen-activated protein kinase | 3.67e-07 | 2.32e-05 | 1.21e-12 | 0.5748 |
| 1. PBF | Q8SQU8 | Probable cell division protein kinase ECU11_1290 | 8.90e-09 | 6.51e-03 | 1.45e-10 | 0.6281 |
| 1. PBF | Q2WFL5 | Mitogen-activated protein kinase HOG1 | 4.74e-09 | 6.95e-04 | 1.42e-19 | 0.5765 |
| 1. PBF | Q8SQZ4 | Probable dual specificity protein kinase YAK1 homolog | 1.10e-08 | 2.50e-03 | 3.78e-09 | 0.5577 |
| 1. PBF | Q91727 | Cyclin-dependent kinase 4 | 2.00e-15 | 4.04e-05 | 2.49e-11 | 0.6594 |
| 1. PBF | O31435 | Probable serine/threonine-protein kinase YbdM | 1.65e-13 | 4.37e-04 | 7.42e-04 | 0.6656 |
| 1. PBF | Q1DUU8 | Mitogen-activated protein kinase HOG1 | 5.58e-09 | 7.80e-04 | 1.45e-19 | 0.562 |
| 1. PBF | Q96TL5 | Mitogen-activated protein kinase hog-1 | 3.25e-09 | 5.04e-03 | 8.63e-19 | 0.5562 |
| 1. PBF | B2MVY4 | Cyclin-dependent kinase 4 | 1.48e-14 | 1.79e-02 | 6.60e-10 | 0.6896 |
| 1. PBF | Q9UV50 | Mitogen-activated protein kinase HOG1 | 1.14e-08 | 3.12e-03 | 4.14e-19 | 0.5945 |
| 1. PBF | Q40884 | Mitogen-activated protein kinase homolog 1 | 2.15e-07 | 3.40e-02 | 8.18e-14 | 0.5873 |
| 1. PBF | P67962 | Casein kinase I isoform alpha | 4.57e-11 | 2.71e-09 | 2.33e-08 | 0.6141 |
| 1. PBF | Q7TYY6 | Serine/threonine-protein kinase PknL | 4.83e-12 | 9.16e-11 | 3.47e-23 | 0.7606 |
| 1. PBF | Q4W6D3 | Mitogen-activated protein kinase HOG1 | 8.91e-09 | 6.26e-03 | 1.74e-19 | 0.556 |
| 1. PBF | Q9W739 | Cyclin-dependent kinase 1 | 3.22e-15 | 9.92e-03 | 1.81e-08 | 0.6755 |
| 1. PBF | Q9PU85 | Serine/threonine-protein kinase pim-3 | 2.47e-13 | 3.88e-02 | 3.02e-08 | 0.6279 |
| 1. PBF | Q0CIC7 | Mitogen-activated protein kinase mpkC | 1.38e-08 | 2.84e-02 | 1.64e-18 | 0.5885 |
| 1. PBF | P33674 | Casein kinase II subunit alpha | 7.32e-08 | 1.12e-07 | 0.002 | 0.5754 |
| 1. PBF | Q2TBL8 | Cyclin-dependent kinase 10 | 7.09e-10 | 2.98e-05 | 2.08e-11 | 0.6191 |
| 1. PBF | G4NEB8 | Mitogen-activated protein kinase kinae MST7 | 1.34e-09 | 6.14e-03 | 2.27e-07 | 0.7338 |
| 1. PBF | P67828 | Casein kinase I isoform alpha | 2.30e-11 | 1.02e-05 | 1.85e-08 | 0.6376 |
| 1. PBF | P73469 | Serine/threonine-protein kinase F | 5.55e-10 | 2.92e-05 | 1.11e-14 | 0.6447 |
| 1. PBF | Q9UV51 | Mitogen-activated protein kinase HOG1 | 2.13e-09 | 2.68e-03 | 7.11e-19 | 0.5844 |
| 1. PBF | Q3T0N5 | Mitogen-activated protein kinase 13 | 8.80e-08 | 3.91e-02 | 1.11e-13 | 0.5455 |
| 1. PBF | Q0D0P5 | Mitogen-activated protein kinase hog1 | 3.12e-09 | 2.45e-03 | 2.11e-18 | 0.5644 |
| 1. PBF | Q5EAB2 | Cyclin-dependent kinase 9 | 5.06e-08 | 3.73e-03 | 6.36e-07 | 0.5702 |
| 1. PBF | P26696 | Mitogen-activated protein kinase 1 | 2.13e-08 | 5.29e-03 | 3.23e-17 | 0.5418 |
| 1. PBF | Q6PWX2 | Mitogen-activated protein kinase HOG1 | 4.36e-09 | 6.53e-04 | 5.39e-19 | 0.5535 |
| 1. PBF | P21901 | Spermatozoon-associated protein kinase | 2.82e-14 | 3.95e-05 | 2.46e-11 | 0.5689 |
| 1. PBF | Q75Q66 | Mitogen-activated protein kinase HOG1 | 2.25e-09 | 1.98e-03 | 4.84e-19 | 0.5707 |
| 1. PBF | P24033 | Cyclin-dependent kinase 1-B | 2.22e-16 | 4.71e-02 | 7.07e-08 | 0.6655 |
| 1. PBF | O94737 | Mitogen-activated protein kinase 1 | 2.31e-09 | 8.66e-04 | 2.53e-16 | 0.6152 |
| 1. PBF | Q6NU47 | Serine/threonine-protein kinase pdik1l-A | 3.62e-12 | 1.87e-04 | 3.74e-11 | 0.5747 |
| 1. PBF | Q6C4M9 | Mitogen-activated protein kinase HOG1 | 3.10e-09 | 2.32e-03 | 3.28e-18 | 0.5842 |
| 1. PBF | Q38775 | Cell division control protein 2 homolog D | 1.17e-14 | 1.35e-04 | 9.54e-07 | 0.6841 |
| 1. PBF | B9VVJ6 | Casein kinase I isoform 2 | 8.36e-12 | 1.81e-09 | 2.06e-11 | 0.6732 |
| 1. PBF | P47355 | Putative serine/threonine-protein kinase | 2.94e-13 | 1.88e-32 | 1.06e-19 | 0.6749 |
| 1. PBF | P54740 | Serine/threonine-protein kinase PkaB | 3.91e-11 | 2.08e-02 | 1.82e-11 | 0.731 |
| 1. PBF | P36887 | cAMP-dependent protein kinase catalytic subunit alpha | 2.44e-14 | 6.64e-03 | 1.69e-08 | 0.6433 |
| 1. PBF | Q00771 | Calcium/calmodulin-dependent protein kinase cmkA | 6.76e-08 | 2.12e-03 | 8.77e-15 | 0.7271 |
| 1. PBF | P20911 | Cyclin-dependent kinase 7 | 1.40e-10 | 5.00e-05 | 1.27e-12 | 0.5904 |
| 1. PBF | P68180 | cAMP-dependent protein kinase catalytic subunit beta | 2.29e-14 | 1.58e-02 | 7.54e-08 | 0.6469 |
| 1. PBF | P21868 | Casein kinase II subunit alpha | 8.18e-08 | 3.73e-07 | 0.001 | 0.583 |
| 1. PBF | P35507 | Casein kinase I isoform beta | 1.68e-11 | 3.79e-09 | 4.21e-12 | 0.6535 |
| 1. PBF | P0CP67 | Mitogen-activated protein kinase CPK1 | 2.69e-08 | 3.70e-02 | 1.08e-13 | 0.5579 |
| 1. PBF | A1D624 | Serine/threonine-protein kinase ssn3 | 1.46e-08 | 9.05e-06 | 7.93e-09 | 0.5598 |
| 1. PBF | O42781 | Mitogen-activated protein kinase 2 | 1.21e-08 | 4.81e-04 | 6.79e-14 | 0.5696 |
| 1. PBF | Q8TGA9 | Mitogen-activated protein kinase HOG1 | 4.72e-09 | 1.00e-02 | 1.43e-18 | 0.5666 |
| 1. PBF | P49136 | MAP kinase-activated protein kinase 2 (Fragment) | 3.22e-07 | 5.69e-04 | 3.30e-12 | 0.5899 |
| 1. PBF | Q8SRL5 | Probable spindle assembly checkpoint kinase homolog | 1.11e-16 | 5.09e-03 | 2.43e-14 | 0.7573 |
| 1. PBF | P93101 | Cell division control protein 2 homolog | 2.55e-15 | 3.31e-02 | 4.36e-11 | 0.702 |
| 1. PBF | Q4R6X5 | STE20-related kinase adapter protein alpha | 5.57e-08 | 1.77e-05 | 0.004 | 0.5222 |
| 1. PBF | Q0GGW5 | Serine/threonine-protein kinase STK11 | 2.61e-09 | 6.10e-07 | 1.94e-14 | 0.6573 |
| 1. PBF | Q5RBJ6 | STE20-related kinase adapter protein alpha | 2.96e-06 | 2.36e-02 | 0.002 | 0.5301 |
| 1. PBF | P13863 | Cyclin-dependent kinase 1 | 1.11e-16 | 4.29e-02 | 1.55e-09 | 0.7119 |
| 1. PBF | P67829 | Casein kinase I isoform alpha | 2.40e-11 | 1.02e-05 | 1.85e-08 | 0.6472 |
| 1. PBF | A1D2C9 | Mitogen-activated protein kinase hog1 | 3.15e-09 | 1.42e-03 | 1.93e-19 | 0.5675 |
| 1. PBF | A1IVT7 | Mitogen-activated protein kinase hog1 | 2.19e-09 | 1.18e-02 | 1.69e-18 | 0.5666 |
| 1. PBF | Q8MJ44 | cAMP-dependent protein kinase catalytic subunit alpha | 2.26e-14 | 2.16e-03 | 1.70e-08 | 0.6431 |
| 1. PBF | Q32KY4 | Cyclin-dependent kinase 4 | 9.99e-16 | 1.79e-02 | 6.60e-10 | 0.7181 |
| 1. PBF | A2ZAB5 | Serine/threonine-protein kinase SAPK3 | 6.44e-09 | 3.38e-05 | 1.93e-16 | 0.6453 |
| 1. PBF | Q38HL5 | Mitogen-activated protein kinase hog1 | 4.25e-09 | 5.18e-04 | 8.74e-19 | 0.6271 |
| 1. PBF | Q4V862 | Cyclin-dependent kinase 9-A | 4.05e-08 | 2.00e-03 | 6.84e-07 | 0.5381 |
| 1. PBF | A9TF79 | Serine/threonine-protein kinase SRK2A | 3.30e-08 | 5.35e-05 | 2.03e-14 | 0.6465 |
| 1. PBF | Q32PI1 | Serine/threonine-protein kinase VRK1 | 5.54e-05 | 5.03e-08 | 0.036 | 0.5404 |
| 1. PBF | A3EZ55 | Mitogen-activated protein kinase HOG1A | 3.27e-09 | 1.18e-02 | 8.87e-17 | 0.5572 |
| 1. PBF | Q9Y899 | Calcium/calmodulin-dependent protein kinase cmkB | 1.63e-11 | 1.79e-04 | 3.91e-13 | 0.6857 |
| 1. PBF | Q8SR83 | Probable cell division control protein 7 homolog 2 | 4.65e-05 | 3.46e-08 | 1.16e-09 | 0.6037 |
| 1. PBF | P28020 | Casein kinase II subunit alpha | 5.66e-08 | 3.26e-06 | 0.001 | 0.6026 |
| 1. PBF | A8XW88 | cAMP-dependent protein kinase catalytic subunit | 1.26e-13 | 2.20e-02 | 7.18e-08 | 0.5785 |
| 1. PBF | P05383 | cAMP-dependent protein kinase catalytic subunit beta | 2.28e-14 | 9.64e-03 | 7.28e-08 | 0.6436 |
| 1. PBF | P46196 | Mitogen-activated protein kinase 1 | 2.06e-08 | 5.34e-03 | 1.82e-17 | 0.5481 |
| 1. PBF | P0CP69 | Mitogen-activated protein kinase HOG1 | 1.66e-09 | 3.18e-02 | 1.86e-18 | 0.5747 |
| 1. PBF | Q38774 | Cell division control protein 2 homolog C | 2.50e-14 | 7.88e-04 | 8.47e-08 | 0.6866 |
| 1. PBF | A2QN07 | Mitogen-activated protein kinase mpkC | 3.97e-08 | 2.36e-02 | 3.04e-18 | 0.5498 |
| 1. PBF | Q66I46 | MAP kinase-interacting serine/threonine-protein kinase 2 | 1.87e-05 | 1.67e-06 | 3.07e-10 | 0.5707 |
| 1. PBF | Q52PH6 | Mitogen-activated protein kinase HOG1 | 2.20e-09 | 2.04e-03 | 3.04e-19 | 0.5673 |
| 1. PBF | P68399 | Casein kinase II subunit alpha | 8.91e-08 | 9.88e-08 | 0.001 | 0.5937 |
| 1. PBF | Q92246 | Mitogen-activated protein kinase PMK1 | 2.92e-07 | 7.01e-06 | 3.55e-11 | 0.5698 |
| 1. PBF | Q7ZX42 | Cyclin-dependent kinase 9-B | 4.31e-08 | 1.06e-02 | 6.78e-07 | 0.5772 |
| 1. PBF | P0CP68 | Mitogen-activated protein kinase HOG1 | 1.55e-09 | 3.18e-02 | 1.86e-18 | 0.5765 |
| 1. PBF | P00517 | cAMP-dependent protein kinase catalytic subunit alpha | 2.41e-14 | 6.98e-03 | 8.04e-09 | 0.6446 |
| 1. PBF | P79432 | Cyclin-dependent kinase 4 | 1.33e-15 | 2.12e-02 | 6.07e-10 | 0.7102 |
| 1. PBF | A8X6H4 | Calcium/calmodulin-dependent protein kinase type 1 | 1.32e-11 | 1.06e-11 | 2.65e-18 | 0.6116 |
| 1. PBF | P24923 | Cell division control protein 2 homolog 1 (Fragment) | 1.33e-15 | 1.30e-02 | 1.67e-08 | 0.6956 |
| 1. PBF | M1T7M3 | Mitogen-activated protein kinase HOG1B | 7.85e-09 | 6.51e-03 | 5.53e-18 | 0.6406 |
| 1. PBF | Q41639 | Cell division control protein 2 homolog | 1.11e-16 | 2.69e-02 | 4.68e-10 | 0.7221 |
| 1. PBF | Q9HGY5 | Negative regulator of the PHO system | 3.19e-10 | 3.30e-05 | 3.66e-15 | 0.667 |
| 1. PBF | Q4R9A9 | Casein kinase I isoform gamma-1 | 2.32e-09 | 3.88e-02 | 1.92e-06 | 0.6538 |
| 1. PBF | Q9MZD9 | cAMP-dependent protein kinase catalytic subunit alpha | 2.42e-14 | 2.30e-03 | 2.38e-08 | 0.6504 |
| 1. PBF | Q02066 | Abscisic acid-inducible protein kinase (Fragment) | 4.51e-09 | 6.26e-03 | 4.17e-12 | 0.6139 |
| 1. PBF | P75524 | Putative serine/threonine-protein kinase | 2.46e-13 | 2.08e-35 | 4.75e-21 | 0.6745 |
| 1. PBF | Q7RBX5 | Casein kinase I | 8.70e-12 | 9.40e-10 | 1.10e-10 | 0.6657 |
| 1. PBF | Q1KTF2 | Mitogen-activated protein kinase Hog1 | 7.25e-09 | 9.31e-04 | 4.44e-19 | 0.5668 |
| 1. PBF | Q8SR86 | Cyclin-dependent kinase 1 | 6.99e-15 | 2.29e-02 | 6.82e-08 | 0.7031 |
| 1. PBF | P67827 | Casein kinase I isoform alpha | 2.27e-11 | 1.02e-05 | 1.85e-08 | 0.6344 |
| 1. PBF | P00518 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform | 8.16e-09 | 2.02e-10 | 4.80e-15 | 0.5947 |
| 1. PBF | Q5E9J9 | STE20-related kinase adapter protein alpha | 1.83e-08 | 5.96e-03 | 0.009 | 0.5302 |
| 1. PBF | Q6NRT0 | Casein kinase I isoform gamma-1 | 5.76e-12 | 3.40e-02 | 8.33e-06 | 0.6281 |
| 1. PBF | Q6GLS4 | CaM kinase-like vesicle-associated protein | 1.77e-10 | 2.37e-06 | 5.01e-10 | 0.6825 |
| 1. PBF | Q6P431 | MAP kinase-interacting serine/threonine-protein kinase 2 | 7.58e-06 | 1.29e-07 | 5.46e-10 | 0.6423 |
| 1. PBF | P51953 | Cyclin-dependent kinase 7 | 7.08e-11 | 7.80e-04 | 1.87e-10 | 0.6154 |
| 1. PBF | Q8SQR2 | Probable casein kinase I homolog ECU11_1980 | 2.42e-10 | 3.68e-11 | 0.015 | 0.6493 |
| 1. PBF | Q8SQW2 | Probable CTD kinase subunit alpha homolog | 5.88e-08 | 5.29e-04 | 1.03e-09 | 0.5717 |
| 1. PBF | G4NH08 | Glycogen synthase kinase 1 | 2.30e-09 | 2.52e-03 | 8.60e-09 | 0.578 |
| 1. PBF | A2QRF6 | Mitogen-activated protein kinase hog1 | 1.67e-09 | 4.79e-03 | 1.42e-18 | 0.59 |
| 1. PBF | Q6BRY2 | Negative regulator of the PHO system | 1.28e-11 | 1.13e-04 | 8.75e-16 | 0.6595 |
| 1. PBF | Q6XKY3 | Mitogen-activated protein kinase hog1 | 8.10e-09 | 4.74e-03 | 1.23e-19 | 0.5653 |
| 1. PBF | Q6QNM1 | Casein kinase I | 1.02e-11 | 1.07e-06 | 1.68e-09 | 0.6507 |
| 1. PBF | Q0U4L8 | Mitogen-activated protein kinase HOG1 | 2.47e-09 | 3.05e-03 | 5.58e-19 | 0.5758 |
| 1. PBF | Q6QNL9 | Casein kinase I | 1.16e-10 | 2.27e-07 | 1.85e-08 | 0.6165 |
| 1. PBF | P54666 | Cell division control protein 2 homolog 3 | 1.70e-11 | 2.57e-03 | 9.86e-17 | 0.6924 |
| 1. PBF | Q8SW92 | Probable serine/threonine-protein kinase KIN28 homolog | 9.33e-15 | 2.96e-03 | 1.58e-12 | 0.7087 |
| 1. PBF | G4N0Z0 | Mitogen-activated protein kinase PMK11 | 2.45e-07 | 6.85e-06 | 6.51e-12 | 0.5786 |
| 1. PBF | Q8SRK8 | Probable cAMP-dependent protein kinase catalytic subunit | 1.96e-11 | 6.73e-07 | 9.27e-12 | 0.6287 |
| 1. PBF | P49673 | cAMP-dependent protein kinase catalytic subunit | 1.13e-10 | 7.40e-04 | 1.19e-10 | 0.5814 |
| 1. PBF | Q5BAE1 | Serine/threonine-protein kinase ssn3 | 6.04e-06 | 7.52e-06 | 2.56e-08 | 0.5535 |
| 1. PBF | Q4WYR6 | Serine/threonine-protein kinase ssn3 | 7.83e-09 | 2.49e-05 | 8.08e-09 | 0.5437 |
| 1. PBF | P9WI62 | Serine/threonine-protein kinase PknL | 6.13e-12 | 1.91e-10 | 1.24e-22 | 0.7685 |
| 1. PBF | Q9GRU1 | Mitogen-activated protein kinase 4 | 9.13e-08 | 4.99e-03 | 1.58e-10 | 0.5511 |
| 1. PBF | Q6U1I9 | Serine/threonine-protein kinase Sgk1 | 1.91e-08 | 4.93e-02 | 2.24e-10 | 0.6414 |
| 1. PBF | Q9XT18 | Serine/threonine-protein kinase Sgk1 | 1.46e-08 | 3.70e-02 | 2.83e-11 | 0.5966 |
| 1. PBF | Q56R42 | Mitogen-activated protein kinase HOG1 | 1.85e-09 | 3.18e-02 | 1.86e-18 | 0.6151 |
| 1. PBF | P20427 | Casein kinase II subunit alpha' | 1.10e-12 | 1.03e-02 | 2.15e-04 | 0.5797 |
| 1. PBF | P0C431 | Mitogen-activated protein kinase HOG1 | 2.34e-09 | 1.42e-03 | 5.03e-19 | 0.5483 |
| 1. PBF | P25321 | cAMP-dependent protein kinase catalytic subunit alpha | 2.56e-14 | 2.04e-02 | 4.89e-08 | 0.6225 |
| 1. PBF | Q2H332 | Mitogen-activated protein kinase HOG1 | 1.53e-09 | 6.19e-04 | 1.21e-18 | 0.578 |
| 1. PBF | O13352 | Mitogen-activated protein kinase MPS1 | 2.32e-08 | 2.65e-04 | 5.40e-19 | 0.611 |
| 1. PBF | Q6CCB0 | Serine/threonine-protein kinase SSN3 | 2.34e-07 | 4.28e-06 | 5.22e-08 | 0.5642 |
| 1. PBF | Q0TWJ7 | Serine/threonine-protein kinase SSN3 | 2.49e-06 | 2.92e-05 | 9.51e-11 | 0.5471 |
| 1. PBF | Q66JF3 | MAP kinase-interacting serine/threonine-protein kinase 1 | 4.12e-10 | 2.99e-10 | 9.94e-10 | 0.6341 |
| 1. PBF | Q2UC58 | Serine/threonine-protein kinase SSN3 | 2.07e-06 | 1.05e-05 | 2.04e-08 | 0.5544 |
| 1. PBF | O15726 | Casein kinase I | 8.12e-12 | 7.24e-10 | 8.30e-10 | 0.6771 |
| 1. PBF | A1CPG7 | Mitogen-activated protein kinase hog1 | 1.25e-09 | 2.14e-03 | 1.59e-19 | 0.5554 |
| 1. PBF | W0LYS5 | Calcium/calmodulin-dependent protein kinase type 1 | 4.84e-10 | 1.58e-09 | 2.62e-17 | 0.6009 |
| 1. PBF | Q3S406 | Glycogen synthase kinase 1 | 2.29e-09 | 2.47e-03 | 1.50e-08 | 0.578 |
| 1. PBF | P05131 | cAMP-dependent protein kinase catalytic subunit beta | 2.28e-14 | 1.20e-02 | 5.50e-08 | 0.6455 |
| 1. PBF | P21869 | Casein kinase II subunit alpha' | 5.14e-07 | 1.67e-02 | 4.30e-04 | 0.579 |
| 1. PBF | Q2WGK3 | Mitogen-activated protein kinase hog1 | 6.87e-09 | 2.93e-03 | 3.77e-19 | 0.5613 |
| 1. PBF | G4N374 | Mitogen-activated protein kinase MPS1 | 2.58e-08 | 2.65e-04 | 5.40e-19 | 0.6038 |
| 1. PBF | Q8SS96 | Probable casein kinase I homolog ECU03_0910 | 2.45e-10 | 3.15e-06 | 3.96e-05 | 0.6778 |
| 1. PBF | A2YNT8 | Serine/threonine-protein kinase SAPK2 | 1.15e-10 | 5.23e-04 | 4.93e-15 | 0.6527 |
| 1. PBF | A2XFC8 | Mitogen-activated protein kinase 5 | 9.73e-08 | 1.55e-02 | 1.59e-14 | 0.6144 |
| 1. PBF | P52389 | Cell division control protein 2 homolog | 1.11e-16 | 1.31e-02 | 6.46e-10 | 0.7241 |
| 1. PBF | Q8SR90 | Probable cell division protein kinase ECU11_1290 | 5.43e-08 | 2.56e-02 | 1.18e-08 | 0.6422 |
| 2. PF | Q5RCY1 | Serine/threonine-protein kinase Kist | 1.22e-05 | 2.76e-04 | NA | 0.5952 |
| 3. BF | O18735 | Receptor tyrosine-protein kinase erbB-2 | 8.84e-04 | NA | 8.46e-10 | 0.5801 |
| 3. BF | B0WAU8 | Serine/threonine-protein kinase PLK4 | 1.29e-09 | NA | 3.21e-17 | 0.6544 |
| 3. BF | P22182 | Fibroblast growth factor receptor 1 | 3.92e-06 | NA | 9.35e-10 | 0.586 |
| 3. BF | Q8XJL8 | Probable serine/threonine-protein kinase CPE1738 | 3.91e-13 | NA | 6.43e-39 | 0.7733 |
| 3. BF | P54743 | Serine/threonine-protein kinase PknA | 7.02e-11 | NA | 7.56e-20 | 0.7718 |
| 3. BF | P00523 | Proto-oncogene tyrosine-protein kinase Src | 8.57e-11 | NA | 2.49e-08 | 0.6368 |
| 3. BF | Q00078 | Protein kinase C-like | 1.64e-05 | NA | 1.19e-07 | 0.6182 |
| 3. BF | Q5R4L1 | Serine/threonine-protein kinase PLK2 | 3.47e-06 | NA | 2.32e-16 | 0.5693 |
| 3. BF | Q02723 | Carbon catabolite-derepressing protein kinase | 2.68e-08 | NA | 4.33e-13 | 0.7122 |
| 3. BF | P29318 | Ephrin type-A receptor 3 | 2.32e-04 | NA | 5.77e-13 | 0.5774 |
| 3. BF | Q04J43 | Serine/threonine-protein kinase StkP | 1.35e-10 | NA | 5.98e-28 | 0.7371 |
| 3. BF | Q9N0X0 | Aurora kinase B | 3.73e-14 | NA | 1.05e-07 | 0.6367 |
| 3. BF | P24786 | NT-3 growth factor receptor | 1.61e-08 | NA | 5.67e-07 | 0.6072 |
| 3. BF | P87253 | Protein kinase C-like | 2.43e-05 | NA | 9.13e-11 | 0.6127 |
| 3. BF | P54741 | Serine/threonine-protein kinase AfsK | 4.98e-07 | NA | 3.68e-08 | 0.6586 |
| 3. BF | Q4R945 | Dual specificity protein kinase TTK | 3.21e-05 | NA | 2.69e-09 | 0.5699 |
| 3. BF | O19004 | Serine/threonine-protein kinase A-Raf | 1.99e-08 | NA | 4.95e-15 | 0.7704 |
| 3. BF | Q97PA9 | Serine/threonine-protein kinase StkP | 7.04e-11 | NA | 8.72e-30 | 0.7349 |
| 3. BF | P10936 | Tyrosine-protein kinase Yes | 4.37e-11 | NA | 3.37e-07 | 0.6507 |
| 3. BF | A3EZ54 | Mitogen-activated protein kinase HOG1 (Fragment) | 8.59e-07 | NA | 1.02e-12 | 0.6414 |
| 3. BF | Q91571 | Ephrin type-B receptor 1-A | 5.32e-05 | NA | 3.50e-11 | 0.659 |
| 3. BF | O42565 | LIM domain kinase 1 | 6.66e-08 | NA | 2.92e-05 | 0.566 |
| 3. BF | Q06309 | Cell division protein kinase 2 homolog CRK1 | 8.88e-16 | NA | 1.56e-14 | 0.7001 |
| 3. BF | Q90330 | Fibroblast growth factor receptor 4 | 2.67e-05 | NA | 3.20e-08 | 0.5634 |
| 3. BF | Q9PK92 | Serine/threonine-protein kinase PknD | 3.00e-06 | NA | 4.13e-15 | 0.6542 |
| 3. BF | Q2GYV9 | Serine/threonine-protein kinase SSN3 | 1.04e-05 | NA | 6.81e-08 | 0.5476 |
| 3. BF | Q5R7I7 | Cyclin-dependent kinase 20 | 4.42e-11 | NA | 2.41e-18 | 0.6822 |
| 3. BF | P12965 | Serine/threonine-protein kinase mos | 3.18e-09 | NA | 2.74e-11 | 0.607 |
| 3. BF | P35509 | Casein kinase I isoform gamma-3 (Fragment) | 1.35e-12 | NA | 9.42e-08 | 0.6184 |
| 3. BF | A7A1P0 | Serine/threonine-protein kinase STE11 | 6.12e-10 | NA | 3.69e-09 | 0.6061 |
| 3. BF | Q6TJY3 | Ribosomal protein S6 kinase beta-1 | 1.25e-07 | NA | 5.17e-12 | 0.614 |
| 3. BF | Q3SWY6 | Serine/threonine-protein kinase 25 | 1.30e-08 | NA | 4.70e-08 | 0.5408 |
| 3. BF | O42626 | Serine/threonine-protein kinase nrc-2 | 1.21e-07 | NA | 3.53e-07 | 0.5367 |
| 3. BF | Q4VSN2 | Dual serine/threonine and tyrosine protein kinase | 1.45e-07 | NA | 4.90e-07 | 0.6992 |
| 3. BF | Q0VD22 | Serine/threonine-protein kinase 33 | 3.16e-09 | NA | 4.50e-11 | 0.6067 |
| 3. BF | P00516 | cGMP-dependent protein kinase 1 | 2.31e-07 | NA | 2.65e-09 | 0.5759 |
| 3. BF | A8X775 | Mitogen-activated protein kinase kinase kinase dlk-1 | 1.24e-05 | NA | 1.85e-13 | 0.6268 |
| 3. BF | Q9TTK0 | Cyclin-dependent kinase-like 2 | 1.57e-08 | NA | 1.22e-13 | 0.6548 |
| 3. BF | P35567 | Cyclin-dependent kinase 1-A | 2.33e-15 | NA | 9.39e-09 | 0.6664 |
| 3. BF | Q8MMZ7 | cGMP-dependent protein kinase | 4.70e-08 | NA | 4.56e-12 | 0.5997 |
| 3. BF | P65729 | Serine/threonine-protein kinase PknG | 8.44e-06 | NA | 7.78e-04 | 0.5716 |
| 3. BF | A8XQD5 | Serine/threonine-protein kinase dkf-2 | 1.13e-03 | NA | 1.74e-12 | 0.5588 |
| 3. BF | Q09YH7 | Hepatocyte growth factor receptor | 1.17e-05 | NA | 2.18e-05 | 0.598 |
| 3. BF | Q7TZN3 | Serine/threonine-protein kinase PknE | 2.53e-08 | NA | 1.14e-18 | 0.7602 |
| 3. BF | Q20CR4 | Dual serine/threonine and tyrosine protein kinase | 8.62e-08 | NA | 5.04e-06 | 0.6578 |
| 3. BF | P74745 | Serine/threonine-protein kinase C | 1.14e-08 | NA | 6.93e-15 | 0.7405 |
| 3. BF | Q16W24 | Serine/threonine-protein kinase PLK4 | 8.73e-10 | NA | 2.04e-17 | 0.7341 |
| 3. BF | B1H3E1 | Serine/threonine-protein kinase NLK2 | 3.32e-07 | NA | 2.39e-12 | 0.5991 |
| 3. BF | P54664 | Cell division control protein 2 homolog 1 | 2.33e-15 | NA | 3.77e-17 | 0.6853 |
| 3. BF | A0JNB0 | Tyrosine-protein kinase Fyn | 5.72e-11 | NA | 1.66e-09 | 0.6685 |
| 3. BF | Q8WP28 | Homeodomain-interacting protein kinase 4 | 5.27e-06 | NA | 4.33e-05 | 0.5298 |
| 3. BF | Q3SX21 | Dual specificity protein kinase CLK3 | 1.89e-08 | NA | 1.20e-10 | 0.5133 |
| 3. BF | P34908 | Serine/threonine-protein kinase B-raf | 1.77e-06 | NA | 2.47e-15 | 0.7467 |
| 3. BF | P21804 | Fibroblast growth factor receptor 1 | 6.64e-05 | NA | 2.72e-09 | 0.5776 |
| 3. BF | Q5YJC2 | Glycogen synthase kinase-3 beta | 3.27e-07 | NA | 4.81e-06 | 0.5485 |
| 3. BF | O76997 | Putative neurotrophin receptor LTRK 1 | 7.09e-09 | NA | 1.87e-10 | 0.6223 |
| 3. BF | P13388 | Melanoma receptor tyrosine-protein kinase | 5.38e-05 | NA | 9.34e-10 | 0.6821 |
| 3. BF | Q9N0P9 | Serine/threonine-protein kinase pim-1 | 3.06e-13 | NA | 1.14e-11 | 0.6277 |
| 3. BF | Q0UY20 | Serine/threonine-protein kinase atg1 | 2.11e-04 | NA | 8.88e-07 | 0.5792 |
| 3. BF | Q00PJ8 | Hepatocyte growth factor receptor | 5.44e-04 | NA | 1.20e-05 | 0.5804 |
| 3. BF | Q5ZJK4 | Serine/threonine-protein kinase 4 | 2.79e-08 | NA | 7.35e-09 | 0.5725 |
| 3. BF | Q6RET7 | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 | 1.07e-09 | NA | 1.97e-14 | 0.5777 |
| 3. BF | Q9XA16 | Probable serine/threonine-protein kinase SCO3848 | 3.63e-07 | NA | 1.87e-21 | 0.7536 |
| 3. BF | Q08CW1 | Serine/threonine-protein kinase tousled-like 2 | 3.89e-10 | NA | 1.62e-14 | 0.6771 |
| 3. BF | O59853 | Mitogen-activated protein kinase HOG2 | 9.98e-09 | NA | 1.46e-18 | 0.6017 |
| 3. BF | Q750A9 | Mitogen-activated protein kinase HOG1 | 1.30e-08 | NA | 5.44e-19 | 0.6067 |
| 3. BF | Q7YR43 | Epithelial discoidin domain-containing receptor 1 | 4.58e-05 | NA | 1.02e-07 | 0.5557 |
| 3. BF | Q4Y4B1 | Cell division control protein 2 homolog | 2.22e-16 | NA | 4.22e-16 | 0.7361 |
| 3. BF | Q4R4U2 | Protein kinase C gamma type | 3.15e-06 | NA | 1.23e-08 | 0.6276 |
| 3. BF | Q8QGV2 | Wee1-like protein kinase 1-B | 2.60e-08 | NA | 6.20e-04 | 0.5576 |
| 3. BF | Q7LZQ8 | Protein kinase C beta type | 1.41e-05 | NA | 5.39e-09 | 0.6129 |
| 3. BF | Q2QLE0 | Hepatocyte growth factor receptor | 5.72e-04 | NA | 1.22e-05 | 0.5664 |
| 3. BF | Q4R6S5 | Dual specificity tyrosine-phosphorylation-regulated kinase 3 | 7.17e-08 | NA | 9.18e-10 | 0.5797 |
| 3. BF | Q9FAB3 | Serine/threonine-protein kinase A | 1.51e-09 | NA | 7.32e-21 | 0.7555 |
| 3. BF | Q5R754 | Cyclin-dependent kinase-like 2 | 2.90e-09 | NA | 2.76e-12 | 0.5753 |
| 3. BF | P13116 | Tyrosine-protein kinase Src-2 | 6.85e-11 | NA | 1.99e-08 | 0.6371 |
| 3. BF | Q7RJG2 | Calcium-dependent protein kinase 4 | 7.21e-07 | NA | 5.39e-14 | 0.6757 |
| 3. BF | Q5E9L6 | Serine/threonine-protein kinase 4 | 3.51e-08 | NA | 2.96e-09 | 0.5948 |
| 3. BF | Q0V7M1 | Serine/threonine-protein kinase H1 | 4.81e-08 | NA | 5.69e-14 | 0.5773 |
| 3. BF | A5A7I8 | Calcium-dependent protein kinase 5 | 1.17e-09 | NA | 1.45e-11 | 0.6149 |
| 3. BF | Q5ZJS0 | Casein kinase I isoform gamma-1 | 1.22e-08 | NA | 1.49e-06 | 0.6399 |
| 3. BF | Q5RDG7 | Myosin light chain kinase 3 | 4.70e-06 | NA | 2.21e-13 | 0.6316 |
| 3. BF | Q95LJ0 | Serine/threonine-protein kinase pim-1 | 1.14e-08 | NA | 8.13e-11 | 0.6271 |
| 3. BF | Q2QLG5 | Hepatocyte growth factor receptor | 5.73e-04 | NA | 2.19e-05 | 0.5994 |
| 3. BF | Q07E48 | Hepatocyte growth factor receptor | 8.73e-04 | NA | 1.63e-05 | 0.6018 |
| 3. BF | Q1KL86 | Ephrin type-A receptor 2 | 3.81e-05 | NA | 1.30e-14 | 0.6486 |
| 3. BF | Q91147 | Fibroblast growth factor receptor 2 | 2.32e-05 | NA | 4.45e-06 | 0.577 |
| 3. BF | G4N6Z6 | Mitogen-activated protein kinase kinae MKK2 | 6.09e-08 | NA | 1.65e-07 | 0.6849 |
| 3. BF | P10650 | Proto-oncogene serine/threonine-protein kinase mos | 3.40e-13 | NA | 6.99e-12 | 0.5893 |
| 3. BF | Q1EBK0 | Serine/threonine-protein kinase SSN3 | 1.10e-06 | NA | 2.86e-06 | 0.5565 |
| 3. BF | B3DL84 | Serine/threonine-protein kinase PLK4 | 8.58e-06 | NA | 6.46e-16 | 0.6838 |
| 3. BF | Q755C4 | Spindle assembly checkpoint kinase | 3.91e-14 | NA | 6.12e-11 | 0.6796 |
| 3. BF | Q2QLC0 | Hepatocyte growth factor receptor | 5.11e-04 | NA | 2.18e-05 | 0.5944 |
| 3. BF | Q255D2 | Serine/threonine-protein kinase PknD | 4.23e-06 | NA | 1.10e-19 | 0.6503 |
| 3. BF | O34507 | Serine/threonine-protein kinase PrkC | 6.23e-09 | NA | 1.25e-31 | 0.7342 |
| 3. BF | A8XJL7 | Serine/threonine-protein kinase sax-1 | 2.73e-07 | NA | 1.45e-11 | 0.5462 |
| 3. BF | P05128 | Protein kinase C gamma type (Fragment) | 3.05e-06 | NA | 2.36e-09 | 0.5954 |
| 3. BF | A2CI34 | Dual serine/threonine and tyrosine protein kinase | 9.74e-08 | NA | 1.12e-07 | 0.7005 |
| 3. BF | Q98TY9 | RAC-alpha serine/threonine-protein kinase | 6.72e-08 | NA | 3.84e-12 | 0.5621 |
| 3. BF | Q07498 | Ephrin type-B receptor 3 (Fragment) | 3.35e-05 | NA | 4.87e-11 | 0.6581 |
| 3. BF | Q8G6P9 | Probable serine/threonine-protein kinase PknB | 1.31e-10 | NA | 1.51e-23 | 0.6952 |
| 3. BF | Q8KY50 | Serine/threonine-protein kinase StkP | 1.86e-10 | NA | 5.29e-28 | 0.7342 |
| 3. BF | B0VXE8 | Cyclin-dependent kinase 14 | 3.33e-13 | NA | 3.84e-12 | 0.566 |
| 3. BF | Q4VSN4 | Dual serine/threonine and tyrosine protein kinase | 1.24e-07 | NA | 5.49e-06 | 0.6593 |
| 3. BF | Q7RAV5 | Calcium-dependent protein kinase 3 | 9.77e-08 | NA | 4.00e-11 | 0.6721 |
| 3. BF | Q9DG02 | Calcium/calmodulin-dependent protein kinase type II delta chain | 1.87e-08 | NA | 2.19e-14 | 0.6341 |
| 3. BF | Q26614 | Fibroblast growth factor receptor | 2.21e-03 | NA | 2.61e-09 | 0.6107 |
| 3. BF | Q8SSH1 | Probable serine/threonine-protein kinase ECU02_0550 | 8.73e-07 | NA | 3.27e-08 | 0.609 |
| 3. BF | Q5R4F3 | Serine/threonine-protein kinase TAO3 | 3.24e-07 | NA | 7.83e-07 | 0.667 |
| 3. BF | P10666 | Ribosomal protein S6 kinase 2 beta | 2.86e-07 | NA | 3.08e-16 | 0.6373 |
| 3. BF | Q91285 | Fibroblast growth factor receptor 1 | 6.64e-05 | NA | 4.28e-10 | 0.5731 |
| 3. BF | Q38772 | Cell division control protein 2 homolog A | 2.55e-15 | NA | 1.20e-10 | 0.6889 |
| 3. BF | A7SNN5 | Serine/threonine-protein kinase PLK4 | 1.41e-05 | NA | 2.84e-19 | 0.6284 |
| 3. BF | A2QHV0 | Cytokinesis protein sepH | 3.59e-05 | NA | 5.48e-12 | 0.6416 |
| 3. BF | D2IYS2 | Tyrosine-protein kinase receptor torso | 2.32e-05 | NA | 1.55e-08 | 0.5613 |
| 3. BF | Q5XHI9 | Hormonally up-regulated neu tumor-associated kinase homolog A | 5.27e-07 | NA | 1.46e-14 | 0.6585 |
| 3. BF | Q6IP76 | RAC-beta serine/threonine-protein kinase B | 3.72e-07 | NA | 5.50e-15 | 0.6223 |
| 3. BF | M3TYT0 | Rho-associated protein kinase 2 | 8.32e-05 | NA | 8.56e-13 | 0.6165 |
| 3. BF | O57473 | Wee1-like protein kinase 2-B | 1.88e-08 | NA | 1.26e-05 | 0.5902 |
| 3. BF | Q61UC4 | Raf homolog serine/threonine-protein kinase | 3.34e-06 | NA | 5.28e-09 | 0.6624 |
| 3. BF | Q8SRI3 | Probable serine/threonine-protein kinase MRK1 homolog | 4.74e-13 | NA | 1.24e-13 | 0.5519 |
| 3. BF | Q91044 | NT-3 growth factor receptor | 2.20e-08 | NA | 4.28e-07 | 0.6176 |
| 3. BF | P65733 | Serine/threonine-protein kinase PknJ | 3.85e-10 | NA | 7.18e-17 | 0.7223 |
| 3. BF | P9WI74 | Serine/threonine-protein kinase PknF | 1.07e-11 | NA | 7.16e-16 | 0.7193 |
| 3. BF | B4QK53 | Serine/threonine-protein kinase PLK4 | 1.36e-09 | NA | 8.06e-16 | 0.6837 |
| 3. BF | Q7TZN1 | Serine/threonine-protein kinase PknF | 1.10e-11 | NA | 7.03e-16 | 0.6517 |
| 3. BF | Q02977 | Proto-oncogene tyrosine-protein kinase Yrk | 4.74e-11 | NA | 7.07e-09 | 0.6969 |
| 3. BF | Q6TGC6 | Serine/threonine-protein kinase CBK1 | 9.07e-07 | NA | 1.79e-09 | 0.5838 |
| 3. BF | A8WJR8 | Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 | 2.71e-05 | NA | 2.26e-09 | 0.597 |
| 3. BF | A2XFF4 | Serine/threonine protein kinase OSK3 | 7.84e-07 | NA | 3.27e-14 | 0.6329 |
| 3. BF | Q5Q0U5 | Serine/threonine-protein kinase Sgk1 | 2.01e-08 | NA | 2.93e-11 | 0.642 |
| 3. BF | B6F107 | Casein kinase II subunit alpha-2 | 2.76e-08 | NA | 4.31e-05 | 0.6358 |
| 3. BF | P73121 | Uncharacterized protein slr1919 | 2.10e-02 | NA | 0.031 | 0.2914 |
| 3. BF | Q9CEF5 | Probable serine/threonine-protein kinase PknB | 1.13e-10 | NA | 3.35e-34 | 0.76 |
| 3. BF | B8BBT7 | Serine/threonine protein kinase OSK4 | 6.91e-08 | NA | 2.63e-14 | 0.6719 |
| 3. BF | Q91287 | Fibroblast growth factor receptor 3 | 5.65e-05 | NA | 2.56e-08 | 0.5778 |
| 3. BF | Q40353 | Mitogen-activated protein kinase homolog MMK2 | 4.54e-08 | NA | 2.15e-14 | 0.5235 |
| 3. BF | B7XHR6 | Probable serine/threonine-protein kinase KIN1 homolog | 3.12e-06 | NA | 3.56e-14 | 0.6628 |
| 3. BF | Q27032 | Cell division control protein 2 homolog | 7.77e-16 | NA | 4.44e-16 | 0.7091 |
| 3. BF | Q8SSA8 | Probable serine/threonine-protein kinase CHK1 homolog | 3.61e-07 | NA | 1.43e-11 | 0.5989 |
| 3. BF | B4IAQ8 | Serine/threonine-protein kinase PLK4 | 1.06e-09 | NA | 1.33e-15 | 0.6717 |
| 3. BF | Q0CL79 | Cytokinesis protein sepH | 4.00e-05 | NA | 3.59e-13 | 0.6346 |
| 3. BF | A0A509AKL0 | cGMP-dependent protein kinase | 1.72e-06 | NA | 1.31e-12 | 0.5321 |
| 3. BF | Q621J7 | Probable serine/threonine-protein kinase zyg-1 | 3.83e-06 | NA | 1.02e-12 | 0.6196 |
| 3. BF | Q2QLF1 | Hepatocyte growth factor receptor | 5.10e-04 | NA | 1.98e-05 | 0.6138 |
| 3. BF | P13115 | Tyrosine-protein kinase Src-1 | 6.39e-11 | NA | 2.34e-08 | 0.6647 |
| 3. BF | Q28923 | Tyrosine-protein kinase Yes | 4.71e-11 | NA | 2.79e-06 | 0.6306 |
| 3. BF | B4LDJ6 | Serine/threonine-protein kinase PLK4 | 2.00e-09 | NA | 1.63e-15 | 0.6819 |
| 3. BF | P62344 | Calcium-dependent protein kinase 1 | 1.32e-07 | NA | 4.14e-13 | 0.6304 |
| 3. BF | A8XWC4 | Serine/threonine-protein kinase dkf-1 | 9.26e-07 | NA | 1.11e-12 | 0.5442 |
| 3. BF | B0BBT2 | Serine/threonine-protein kinase PknD | 3.68e-06 | NA | 5.51e-16 | 0.6351 |
| 3. BF | Q9DG98 | Cyclin-dependent kinase 1 | 4.22e-15 | NA | 4.13e-10 | 0.6759 |
| 3. BF | G4N7X0 | Mitogen-activated protein kinase kinae kinase MST11 | 3.43e-06 | NA | 3.40e-13 | 0.6898 |
| 3. BF | Q4Z6R1 | Cell division control protein 2 homolog | 4.66e-15 | NA | 3.98e-16 | 0.7368 |
| 3. BF | Q91738 | Focal adhesion kinase 1 | 9.86e-04 | NA | 2.27e-10 | 0.6076 |
| 3. BF | Q7ZX15 | RAC-beta serine/threonine-protein kinase A | 7.81e-08 | NA | 4.16e-15 | 0.5973 |
| 3. BF | P28547 | Casein kinase II subunit alpha | 3.04e-09 | NA | 8.09e-06 | 0.6337 |
| 3. BF | P07313 | Myosin light chain kinase 2, skeletal/cardiac muscle | 5.44e-09 | NA | 6.63e-10 | 0.5892 |
| 3. BF | Q07DY1 | Hepatocyte growth factor receptor | 6.65e-04 | NA | 1.78e-05 | 0.5879 |
| 3. BF | P0C198 | Serine/threonine-protein kinase CHK1 | 1.89e-05 | NA | 4.52e-10 | 0.5329 |
| 3. BF | B4IMC3 | Serine/threonine-protein kinase GM11705 | 8.03e-10 | NA | 6.56e-10 | 0.6666 |
| 3. BF | Q6FKD4 | Negative regulator of the PHO system | 6.99e-15 | NA | 2.88e-17 | 0.7013 |
| 3. BF | A4K2Q5 | Serine/threonine-protein kinase 4 | 4.08e-08 | NA | 2.43e-09 | 0.5746 |
| 3. BF | Q5BP74 | Casein kinase I isoform delta | 1.87e-10 | NA | 1.33e-13 | 0.6746 |
| 3. BF | Q6IP06 | Serine/threonine-protein kinase 3 | 4.94e-08 | NA | 1.72e-09 | 0.5932 |
| 3. BF | P0CS77 | Serine/threonine-protein kinase SSN3 | 6.84e-05 | NA | 3.42e-05 | 0.5244 |
| 3. BF | P0CS76 | Serine/threonine-protein kinase SSN3 | 8.09e-05 | NA | 3.42e-05 | 0.5264 |
| 3. BF | A2VDZ4 | Serine/threonine-protein kinase PLK4 | 1.86e-08 | NA | 3.64e-15 | 0.7041 |
| 3. BF | Q2IBF2 | Hepatocyte growth factor receptor | 5.18e-04 | NA | 1.78e-05 | 0.5844 |
| 3. BF | Q5REX1 | Serine/threonine-protein kinase SIK2 | 6.21e-05 | NA | 2.49e-07 | 0.6088 |
| 3. BF | Q01577 | Serine/threonine-protein kinase pkpA | 7.96e-09 | NA | 3.97e-10 | 0.7078 |
| 3. BF | Q5RD00 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 1.12e-07 | NA | 4.77e-15 | 0.6968 |
| 3. BF | P11799 | Myosin light chain kinase, smooth muscle | 2.19e-03 | NA | 6.76e-18 | 0.6488 |
| 3. BF | Q3SZJ2 | Receptor-interacting serine/threonine-protein kinase 2 | 3.18e-09 | NA | 9.29e-05 | 0.7084 |
| 3. BF | Q6DE08 | Aurora kinase B-A | 8.86e-14 | NA | 1.80e-08 | 0.63 |
| 3. BF | O42127 | Fibroblast growth factor receptor 3 | 5.85e-05 | NA | 1.95e-07 | 0.6102 |
| 3. BF | P9WI64 | Serine/threonine-protein kinase PknK | 1.36e-05 | NA | 1.08e-14 | 0.7783 |
| 3. BF | A0QNG1 | Serine/threonine-protein kinase PknB | 4.86e-08 | NA | 3.88e-22 | 0.6459 |
| 3. BF | P50118 | Proto-oncogene serine/threonine-protein kinase mos | 2.85e-13 | NA | 2.55e-10 | 0.6026 |
| 3. BF | Q00655 | Tyrosine-protein kinase SYK | 1.40e-10 | NA | 1.07e-09 | 0.6624 |
| 3. BF | Q90344 | Ephrin type-B receptor 2 | 5.30e-05 | NA | 1.67e-13 | 0.6648 |
| 3. BF | Q5F3L1 | Ribosomal protein S6 kinase alpha-5 | 6.96e-06 | NA | 7.30e-17 | 0.5963 |
| 3. BF | O19111 | Protein kinase C zeta type | 2.43e-07 | NA | 3.45e-12 | 0.6226 |
| 3. BF | Q64682 | Beta-adrenergic receptor kinase 1 | 1.08e-06 | NA | 4.23e-14 | 0.5819 |
| 3. BF | Q86PM4 | Fibroblast growth factor receptor | 5.18e-06 | NA | 2.97e-10 | 0.6169 |
| 3. BF | Q5R814 | Serine/threonine-protein kinase PRP4 homolog | 1.59e-07 | NA | 1.84e-08 | 0.5536 |
| 3. BF | A7TIZ4 | Serine/threonine-protein kinase atg1 | 5.59e-06 | NA | 1.46e-06 | 0.5157 |
| 3. BF | B4NSS9 | Serine/threonine-protein kinase GD17699 | 8.92e-10 | NA | 5.90e-10 | 0.6601 |
| 3. BF | Q90336 | Mitogen-activated protein kinase 14A | 9.35e-08 | NA | 1.22e-18 | 0.4979 |
| 3. BF | Q5RAJ5 | Serine/threonine-protein kinase 36 | 2.23e-04 | NA | 1.10e-10 | 0.5373 |
| 3. BF | A8KBH6 | Protein kinase C beta type | 2.57e-06 | NA | 5.29e-10 | 0.5913 |
| 3. BF | Q6CWQ4 | Spindle assembly checkpoint kinase | 3.71e-14 | NA | 1.13e-09 | 0.6398 |
| 3. BF | D2H526 | Cyclin-dependent kinase 12 | 3.19e-03 | NA | 7.27e-07 | 0.5662 |
| 3. BF | Q7U095 | Serine/threonine-protein kinase PknH | 1.05e-08 | NA | 8.52e-25 | 0.7784 |
| 3. BF | D0N4E2 | Serine/threonine-protein kinase PKZ1 | 1.48e-08 | NA | 1.08e-08 | 0.6484 |
| 3. BF | Q8WNU8 | Serine/threonine-protein kinase Nek11 | 2.65e-10 | NA | 3.05e-17 | 0.7886 |
| 3. BF | Q5BKK4 | Serine/threonine-protein kinase Sgk1 | 1.20e-08 | NA | 2.98e-10 | 0.6343 |
| 3. BF | Q501Q9 | Mitogen-activated protein kinase 15 | 2.45e-07 | NA | 6.34e-16 | 0.5775 |
| 3. BF | Q32L23 | LIM domain kinase 2 | 3.82e-08 | NA | 7.90e-05 | 0.5768 |
| 3. BF | P0C1B1 | Serine/threonine-protein kinase cbk1 | 1.61e-03 | NA | 6.87e-07 | 0.5498 |
| 3. BF | Q6NU21 | Serine/threonine-protein kinase TAO1-A | 1.16e-06 | NA | 1.42e-08 | 0.6822 |
| 3. BF | Q6FP74 | Serine/threonine-protein kinase CBK1 | 1.80e-05 | NA | 1.17e-05 | 0.5852 |
| 3. BF | Q8AYK6 | Wee1-like protein kinase 1-A | 1.77e-08 | NA | 1.34e-04 | 0.5508 |
| 3. BF | A5A7I7 | Calcium-dependent protein kinase 4 | 7.03e-08 | NA | 1.05e-09 | 0.6047 |
| 3. BF | B5VNQ3 | Serine/threonine-protein kinase STE11 | 5.74e-11 | NA | 1.70e-08 | 0.6939 |
| 3. BF | A7E3S4 | RAF proto-oncogene serine/threonine-protein kinase | 7.13e-08 | NA | 9.91e-14 | 0.7487 |
| 3. BF | Q4WHP3 | Serine/threonine-protein kinase ste20 | 3.88e-07 | NA | 1.53e-09 | 0.6 |
| 3. BF | C4YRB7 | Serine/threonine-protein kinase CST20 | 3.05e-05 | NA | 3.55e-13 | 0.6002 |
| 3. BF | P67998 | Ribosomal protein S6 kinase beta-1 | 1.13e-07 | NA | 4.79e-12 | 0.594 |
| 3. BF | O55092 | STE20-like serine/threonine-protein kinase | 1.69e-04 | NA | 1.17e-16 | 0.6554 |
| 3. BF | P04409 | Protein kinase C alpha type | 1.30e-07 | NA | 1.82e-10 | 0.6041 |
| 3. BF | E1BTE1 | Wee1-like protein kinase 2 | 1.40e-05 | NA | 0.005 | 0.5851 |
| 3. BF | A7E3X2 | Casein kinase I isoform gamma-1 | 6.09e-12 | NA | 4.16e-06 | 0.6372 |
| 3. BF | Q2LZZ7 | Serine/threonine-protein kinase tricornered | 1.32e-05 | NA | 1.64e-11 | 0.549 |
| 3. BF | Q07192 | Dual specificity mitogen-activated protein kinase kinase 2 (Fragment) | 4.63e-09 | NA | 7.31e-12 | 0.6448 |
| 3. BF | Q5E9X2 | Dual specificity mitogen-activated protein kinase kinase 6 | 2.78e-10 | NA | 8.20e-13 | 0.651 |
| 3. BF | Q63980 | Dual specificity mitogen-activated protein kinase kinase 1 | 1.81e-13 | NA | 1.61e-09 | 0.5881 |
| 3. BF | Q09YI9 | Hepatocyte growth factor receptor | 5.82e-04 | NA | 4.49e-05 | 0.6071 |
| 3. BF | Q6XUX0 | Dual serine/threonine and tyrosine protein kinase | 1.23e-07 | NA | 1.73e-05 | 0.6517 |
| 3. BF | B6A7Q3 | Cyclin-dependent kinase 14 | 2.41e-12 | NA | 2.93e-12 | 0.6072 |
| 3. BF | Q6NTJ3 | Serine/threonine-protein kinase greatwall | 1.60e-02 | NA | 2.34e-09 | 0.6419 |
| 3. BF | P28327 | Rhodopsin kinase GRK1 | 4.78e-07 | NA | 1.85e-16 | 0.6336 |
| 3. BF | P65731 | Serine/threonine-protein kinase PknI | 6.69e-07 | NA | 1.69e-08 | 0.602 |
| 3. BF | P21146 | Beta-adrenergic receptor kinase 1 | 1.39e-06 | NA | 1.05e-14 | 0.5779 |
| 3. BF | Q09YK0 | Hepatocyte growth factor receptor | 1.14e-05 | NA | 4.41e-05 | 0.615 |
| 3. BF | P38973 | Cell division control protein 2 homolog 1 | 1.22e-15 | NA | 2.14e-16 | 0.6854 |
| 3. BF | Q91820 | Aurora kinase A-A | 2.17e-13 | NA | 1.44e-09 | 0.6409 |
| 3. BF | Q4V7Q6 | Serine/threonine-protein kinase ULK3 | 7.63e-09 | NA | 2.59e-16 | 0.7099 |
| 3. BF | Q28021 | Rho-associated protein kinase 2 | 7.37e-04 | NA | 8.72e-13 | 0.6212 |
| 3. BF | P15792 | Protein kinase PVPK-1 | 5.44e-07 | NA | 3.57e-04 | 0.543 |
| 3. BF | O42422 | Ephrin type-A receptor 7 | 4.91e-05 | NA | 1.28e-12 | 0.6803 |
| 3. BF | B3NKK1 | Serine/threonine-protein kinase GG21441 | 6.28e-10 | NA | 2.72e-10 | 0.6829 |
| 3. BF | Q5R9Z7 | Serine/threonine-protein kinase PLK4 | 5.32e-08 | NA | 7.02e-15 | 0.6972 |
| 3. BF | Q6DFE0 | Wee1-like protein kinase 2-C | 1.44e-08 | NA | 1.11e-05 | 0.5708 |
| 3. BF | Q91987 | BDNF/NT-3 growth factors receptor | 1.93e-08 | NA | 1.55e-08 | 0.6156 |
| 3. BF | P35508 | Casein kinase I isoform delta | 2.01e-10 | NA | 5.37e-13 | 0.6745 |
| 3. BF | Q9I958 | Mitogen-activated protein kinase 14B | 9.50e-08 | NA | 8.90e-20 | 0.4925 |
| 3. BF | A8XJQ6 | cAMP-dependent protein kinase, catalytic subunit-like | 5.01e-14 | NA | 9.07e-11 | 0.6394 |
| 3. BF | Q08DZ2 | Serine/threonine-protein kinase PRP4 homolog | 1.65e-07 | NA | 4.74e-08 | 0.5585 |
| 3. BF | O77676 | cGMP-dependent protein kinase 1 | 3.56e-07 | NA | 2.70e-09 | 0.5835 |
| 3. BF | D2HHP1 | Wee1-like protein kinase 2 | 6.32e-07 | NA | 0.004 | 0.5461 |
| 3. BF | Q2IBC0 | Hepatocyte growth factor receptor | 4.52e-04 | NA | 2.54e-06 | 0.6239 |
| 3. BF | Q6FIU2 | Mitogen-activated protein kinase HOG1 | 2.15e-08 | NA | 4.04e-17 | 0.5978 |
| 3. BF | Q6DFJ6 | Serine/threonine-protein kinase TBK1 | 1.74e-07 | NA | 2.23e-10 | 0.5975 |
| 3. BF | P54738 | Serine/threonine-protein kinase pkn6 | 3.41e-08 | NA | 2.41e-15 | 0.683 |
| 3. BF | Q6C3J2 | Spindle assembly checkpoint kinase | 1.19e-13 | NA | 8.19e-11 | 0.6177 |
| 3. BF | P40230 | Casein kinase I homolog RAG8 | 2.95e-06 | NA | 4.07e-08 | 0.6393 |
| 3. BF | P47817 | Wee1-like protein kinase 2-A | 1.89e-08 | NA | 1.13e-05 | 0.5586 |
| 3. BF | A8X4H1 | Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 | 5.87e-05 | NA | 0.002 | 0.5479 |
| 3. BF | Q2TA06 | Aurora kinase A | 7.48e-10 | NA | 2.59e-07 | 0.6814 |
| 3. BF | Q8FUI4 | Serine/threonine-protein kinases drp72 | 5.14e-09 | NA | 2.10e-15 | 0.7497 |
| 3. BF | P0CY46 | Epidermal growth factor receptor | 8.46e-05 | NA | 4.58e-07 | 0.6879 |
| 3. BF | Q91447 | Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) | 7.00e-11 | NA | 9.33e-09 | 0.6197 |
| 3. BF | Q92241 | Negative regulator of the PHO system | 7.44e-15 | NA | 2.62e-15 | 0.7059 |
| 3. BF | P26818 | Beta-adrenergic receptor kinase 2 | 9.70e-07 | NA | 1.47e-16 | 0.604 |
| 3. BF | B4IT27 | Serine/threonine-protein kinase GE16371 | 3.94e-10 | NA | 1.21e-09 | 0.6359 |
| 3. BF | Q91736 | Ephrin type-B receptor 1-B (Fragment) | 1.12e-04 | NA | 1.60e-13 | 0.612 |
| 3. BF | A4QNA8 | Wee1-like protein kinase 2 | 7.82e-07 | NA | 2.71e-05 | 0.5636 |
| 3. BF | J9VH94 | Serine/threonine-protein kinase PDK1 | 1.08e-02 | NA | 2.58e-12 | 0.6576 |
| 3. BF | Q2IBA6 | Hepatocyte growth factor receptor | 4.44e-04 | NA | 1.84e-05 | 0.5745 |
| 3. BF | Q9XZD6 | Cell division control protein 2 homolog | 5.44e-15 | NA | 2.83e-15 | 0.7324 |
| 3. BF | P18460 | Fibroblast growth factor receptor 3 | 4.98e-05 | NA | 7.03e-08 | 0.5985 |
| 3. BF | A5GFW1 | Aurora kinase A | 7.05e-10 | NA | 9.53e-07 | 0.6797 |
| 3. BF | P54737 | Serine/threonine-protein kinase pkn5 | 3.29e-14 | NA | 3.14e-14 | 0.6119 |
| 3. BF | Q96VK3 | Serine/threonine-protein kinase bur1 | 1.97e-06 | NA | 1.72e-06 | 0.5552 |
| 3. BF | Q01917 | Cell division control protein 2 homolog | 3.31e-04 | NA | 0.005 | 0.4427 |
| 3. BF | B6CZ17 | Rhodopsin kinase grk7-a | 4.57e-07 | NA | 1.18e-11 | 0.5988 |
| 3. BF | P42686 | Tyrosine-protein kinase isoform SRK1 | 8.65e-13 | NA | 3.00e-13 | 0.7061 |
| 3. BF | Q8MMZ8 | cGMP-dependent protein kinase | 9.79e-06 | NA | 1.24e-11 | 0.5982 |
| 3. BF | Q8QHK8 | Mitogen-activated protein kinase 8 | 6.80e-06 | NA | 6.69e-17 | 0.533 |
| 3. BF | O19175 | Casein kinase I isoform alpha (Fragment) | 2.06e-06 | NA | 1.35e-04 | 0.6993 |
| 3. BF | Q26671 | Cell division control protein 2 homolog | 4.44e-16 | NA | 4.19e-16 | 0.7311 |
| 3. BF | Q91821 | Maternal embryonic leucine zipper kinase | 8.58e-07 | NA | 4.87e-14 | 0.6523 |
| 3. BF | P43450 | Cyclin-dependent kinase 2 | 4.44e-16 | NA | 5.98e-12 | 0.7081 |
| 3. BF | Q8SWM6 | Probable cell cycle serine/threonine-protein kinase CDC5 homolog | 6.59e-08 | NA | 1.64e-16 | 0.7046 |
| 3. BF | Q6P3Q4 | Serine/threonine-protein kinase 4 | 2.87e-08 | NA | 3.48e-10 | 0.5963 |
| 3. BF | O96821 | Cell division control protein 2 homolog | 6.11e-15 | NA | 1.46e-15 | 0.7245 |
| 3. BF | Q6GPK9 | Serine/threonine-protein kinase TAO2 | 1.91e-05 | NA | 1.59e-08 | 0.5706 |
| 3. BF | P10665 | Ribosomal protein S6 kinase 2 alpha | 1.55e-06 | NA | 1.28e-16 | 0.6298 |
| 3. BF | P33973 | Serine/threonine-protein kinase Pkn1 | 1.17e-08 | NA | 1.47e-23 | 0.7215 |
| 3. BF | O97627 | Beta-adrenergic receptor kinase 1 | 8.23e-07 | NA | 3.83e-14 | 0.6146 |
| 3. BF | P54744 | Serine/threonine-protein kinase PknB | 3.16e-08 | NA | 2.26e-23 | 0.7592 |
| 3. BF | Q5R4M2 | Serine/threonine-protein kinase ULK4 | 5.27e-04 | NA | 5.36e-07 | 0.6463 |
| 3. BF | Q9GRC0 | Serine/threonine-protein kinase mos | 5.25e-13 | NA | 1.28e-09 | 0.6243 |
| 3. BF | Q3KM61 | Serine/threonine-protein kinase PknD | 5.32e-06 | NA | 1.71e-15 | 0.6423 |
| 3. BF | P53666 | LIM domain kinase 2 | 5.34e-08 | NA | 2.11e-05 | 0.556 |
| 3. BF | P10830 | Protein kinase C epsilon type | 3.49e-06 | NA | 2.53e-12 | 0.6597 |
| 3. BF | P0CY23 | Serine/threonine-protein kinase CST20 | 3.22e-05 | NA | 3.39e-13 | 0.5985 |
| 3. BF | Q38773 | Cell division control protein 2 homolog B (Fragment) | 8.69e-14 | NA | 1.48e-10 | 0.708 |
| 3. BF | Q6FKC6 | Serine/threonine-protein kinase SSN3 | 9.33e-05 | NA | 3.66e-06 | 0.5457 |
| 3. BF | A0A2I0BVG8 | Calcium-dependent protein kinase 1 | 8.54e-08 | NA | 4.14e-13 | 0.6494 |
| 3. BF | Q8TFN2 | Serine/threonine-protein kinase ATG1 | 4.54e-05 | NA | 9.36e-09 | 0.539 |
| 3. BF | Q6DD27 | Serine/threonine-protein kinase TAO3 | 7.78e-06 | NA | 8.82e-08 | 0.6151 |
| 3. BF | Q754N7 | Serine/threonine-protein kinase CBK1 | 1.47e-05 | NA | 1.87e-06 | 0.5834 |
| 3. BF | Q1L6Q1 | Dual serine/threonine and tyrosine protein kinase | 6.65e-05 | NA | 1.03e-06 | 0.6936 |
| 3. BF | Q5R4K9 | Protein kinase C iota type | 1.91e-07 | NA | 6.42e-15 | 0.663 |
| 3. BF | A9T142 | Mitogen-activated protein kinase 4a | 4.64e-08 | NA | 1.44e-14 | 0.5925 |
| 3. BF | P9WI76 | Serine/threonine-protein kinase PknE | 3.10e-11 | NA | 1.48e-18 | 0.7645 |
| 3. BF | P47812 | Mitogen-activated protein kinase 14 | 1.01e-07 | NA | 1.79e-18 | 0.507 |
| 3. BF | O02812 | Mitogen-activated protein kinase 14 | 4.83e-08 | NA | 6.04e-18 | 0.5318 |
| 3. BF | Q871M9 | Serine/threonine-protein kinase bur1 | 2.34e-06 | NA | 1.74e-07 | 0.5252 |
| 3. BF | B1WAR9 | Serine/threonine-protein kinase greatwall | 1.65e-02 | NA | 6.27e-09 | 0.6722 |
| 3. BF | O42632 | Protein kinase C-like | 2.82e-05 | NA | 3.18e-09 | 0.6195 |
| 3. BF | B3NE99 | Serine/threonine-protein kinase PLK4 | 1.17e-09 | NA | 4.87e-16 | 0.7018 |
| 3. BF | Q0IHQ8 | Serine/threonine-protein kinase 10 | 1.10e-05 | NA | 2.27e-16 | 0.6742 |
| 3. BF | Q91735 | Ephrin type-B receptor 3 | 5.34e-05 | NA | 1.05e-11 | 0.6392 |
| 3. BF | Q7YQL4 | Serine/threonine-protein kinase PAK 3 | 3.95e-07 | NA | 5.65e-12 | 0.5538 |
| 3. BF | Q05006 | Cell division control protein 2 homolog 2 | 3.66e-15 | NA | 7.20e-11 | 0.7118 |
| 3. BF | W7JX98 | cGMP-dependent protein kinase | 1.07e-06 | NA | 4.34e-13 | 0.5573 |
| 3. BF | Q9P419 | Mitogen-activated protein kinase hog1 | 4.30e-08 | NA | 4.08e-18 | 0.5107 |
| 3. BF | A3EZ53 | Mitogen-activated protein kinase HOG1 (Fragment) | 7.56e-07 | NA | 7.58e-13 | 0.6094 |
| 3. BF | Q9Z2G7 | Rhodopsin kinase GRK7 | 2.90e-07 | NA | 1.96e-14 | 0.6308 |
| 3. BF | Q40532 | Mitogen-activated protein kinase homolog NTF4 | 1.47e-06 | NA | 3.87e-14 | 0.5924 |
| 3. BF | E2RSS3 | Wee1-like protein kinase 2 | 5.93e-07 | NA | 7.64e-04 | 0.5533 |
| 3. BF | P93194 | Receptor-like protein kinase | 1.04e-02 | NA | 7.09e-13 | 0.6189 |
| 3. BF | Q6FJ85 | Probable serine/threonine-protein kinase KKQ8 | 3.30e-04 | NA | 8.89e-12 | 0.594 |
| 3. BF | Q8SSH4 | Probable serine/threonine-protein kinase MPS1 homolog | 3.93e-06 | NA | 5.95e-08 | 0.6746 |
| 3. BF | B4PDM5 | Serine/threonine-protein kinase PLK4 | 1.08e-09 | NA | 5.15e-16 | 0.7076 |
| 3. BF | Q5R669 | Tribbles homolog 2 | 2.26e-09 | NA | 0.009 | 0.6112 |
| 3. BF | O15865 | Calcium-dependent protein kinase 2 | 3.79e-08 | NA | 1.40e-14 | 0.6525 |
| 3. BF | A4K2P5 | Serine/threonine-protein kinase 4 | 3.04e-08 | NA | 2.07e-09 | 0.5942 |
| 3. BF | P23437 | Cyclin-dependent kinase 2 | 5.55e-16 | NA | 5.63e-14 | 0.7002 |
| 3. BF | P29294 | Myosin light chain kinase, smooth muscle | 4.79e-04 | NA | 3.37e-18 | 0.6136 |
| 3. BF | A8WRV1 | Serine/threonine-protein kinase kin-29 | 3.83e-06 | NA | 1.30e-09 | 0.67 |
| 3. BF | P62343 | Calcium-dependent protein kinase 1 | 7.43e-08 | NA | 4.14e-13 | 0.6486 |
| 3. BF | Q5RD01 | Cyclin-dependent kinase 18 | 3.13e-12 | NA | 3.87e-13 | 0.6574 |
| 3. BF | P54736 | Serine/threonine-protein kinase pkn2 | 5.38e-07 | NA | 2.35e-19 | 0.7811 |
| 3. BF | Q9IA88 | Serine/threonine-protein kinase SIK2 | 2.33e-06 | NA | 1.74e-10 | 0.6659 |
| 3. BF | P05625 | RAF proto-oncogene serine/threonine-protein kinase | 4.40e-09 | NA | 4.47e-14 | 0.7134 |
| 3. BF | Q822K5 | Serine/threonine-protein kinase PknD | 3.68e-06 | NA | 1.97e-18 | 0.6601 |
| 3. BF | Q2TAE3 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A | 5.46e-09 | NA | 1.01e-05 | 0.5341 |
| 3. BF | Q9GRT1 | Putative mitogen-activated protein kinase kinase 4 | 2.57e-08 | NA | 2.28e-11 | 0.6725 |
| 3. BF | Q06060 | Mitogen-activated protein kinase homolog D5 | 1.24e-06 | NA | 2.32e-13 | 0.6302 |
| 3. BF | Q9XT09 | Dual specificity mitogen-activated protein kinase kinase 1 | 4.76e-09 | NA | 6.55e-09 | 0.5963 |
| 3. BF | Q6RET6 | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) | 1.86e-09 | NA | 9.83e-13 | 0.6105 |
| 3. BF | B4J3F1 | Serine/threonine-protein kinase PLK4 | 8.35e-06 | NA | 8.78e-16 | 0.6709 |
| 3. BF | Q07DZ1 | Hepatocyte growth factor receptor | 1.47e-05 | NA | 1.69e-05 | 0.6185 |
| 3. BF | Q2QLA9 | Hepatocyte growth factor receptor | 7.11e-04 | NA | 2.23e-05 | 0.565 |
| 3. BF | Q6GPL3 | Aurora kinase B-B | 4.33e-10 | NA | 1.11e-08 | 0.6386 |
| 3. BF | Q97IC2 | Probable serine/threonine-protein kinase CA_C1728 | 5.26e-08 | NA | 1.97e-28 | 0.8118 |
| 3. BF | A8XNJ6 | Serine/threonine-protein kinase sgk-1 | 1.37e-09 | NA | 8.61e-08 | 0.6845 |
| 3. BF | P0CP70 | Serine/threonine-protein kinase ATG1 | 4.63e-05 | NA | 2.77e-07 | 0.5597 |
| 3. BF | P53681 | CDPK-related protein kinase | 2.92e-07 | NA | 1.15e-13 | 0.6996 |
| 3. BF | Q6FQH2 | Serine/threonine-protein kinase HAL5 | 1.00e-04 | NA | 1.23e-08 | 0.5923 |
| 3. BF | Q8QGV6 | Serine/threonine-protein kinase NLK2 | 2.25e-06 | NA | 2.81e-12 | 0.5915 |
| 3. BF | Q00944 | Focal adhesion kinase 1 | 1.70e-04 | NA | 5.95e-10 | 0.5983 |
| 3. BF | Q90321 | Dual specificity mitogen-activated protein kinase kinase 2 | 1.19e-10 | NA | 3.63e-07 | 0.5833 |
| 3. BF | P79701 | Vascular endothelial growth factor receptor 3 | 1.08e-03 | NA | 2.74e-07 | 0.5623 |
| 3. BF | Q29502 | Serine/threonine-protein kinase PAK 2 | 1.94e-07 | NA | 2.92e-11 | 0.5582 |
| 3. BF | Q6BLJ9 | Serine/threonine-protein kinase CBK1 | 1.05e-05 | NA | 1.42e-08 | 0.5784 |
| 3. BF | P52497 | Carbon catabolite-derepressing protein kinase | 3.57e-07 | NA | 2.04e-13 | 0.6715 |
| 3. BF | Q40517 | Mitogen-activated protein kinase homolog NTF3 | 2.69e-08 | NA | 1.94e-14 | 0.6149 |
| 3. BF | B4HNW4 | Tyrosine-protein kinase-like otk | 3.13e-04 | NA | 0.002 | 0.5218 |
| 3. BF | Q1RMT8 | Interleukin-1 receptor-associated kinase 4 | 8.19e-06 | NA | 6.78e-11 | 0.63 |
| 3. BF | Q5RDH5 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) | 1.52e-07 | NA | 4.31e-16 | 0.6675 |
| 3. BF | Q6C7U0 | Serine/threonine-protein kinase ATG1 | 4.73e-06 | NA | 3.99e-08 | 0.5491 |
| 3. BF | P19026 | Cell division control protein 2 homolog 1 (Fragment) | 4.17e-08 | NA | 1.76e-06 | 0.7355 |
| 3. BF | Q07DV8 | Hepatocyte growth factor receptor | 1.58e-05 | NA | 2.18e-05 | 0.5597 |
| 3. BF | P62345 | Calcium-dependent protein kinase 4 | 7.29e-07 | NA | 5.74e-14 | 0.6872 |
| 3. BF | Q91819 | Aurora kinase A-B | 1.68e-13 | NA | 1.42e-09 | 0.6516 |
| 3. BF | C4YGK0 | Extracellular signal-regulated kinase 1 | 1.61e-07 | NA | 4.45e-14 | 0.5135 |
| 3. BF | Q1L5Z8 | Mitogen-activated protein kinase HOG1 | 1.15e-07 | NA | 1.74e-18 | 0.5961 |
| 3. BF | O59854 | Mitogen-activated protein kinase HOG1 | 3.36e-08 | NA | 5.99e-19 | 0.593 |
| 3. BF | P09324 | Tyrosine-protein kinase Yes | 4.90e-11 | NA | 3.63e-07 | 0.6789 |
| 3. BF | Q8NU98 | Probable serine/threonine-protein kinase PknB | 1.63e-07 | NA | 8.01e-27 | 0.7481 |
| 3. BF | Q60553 | Receptor tyrosine-protein kinase erbB-2 | 7.17e-04 | NA | 5.13e-11 | 0.6028 |
| 3. BF | Q75CH3 | Serine/threonine-protein kinase ATG1 | 4.50e-06 | NA | 1.11e-09 | 0.5515 |
| 3. BF | P54735 | Serine/threonine-protein kinase D | 6.46e-09 | NA | 1.56e-10 | 0.6855 |
| 3. BF | P54755 | Ephrin type-A receptor 5 | 8.73e-05 | NA | 7.31e-12 | 0.6333 |
| 3. BF | Q95266 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 2.22e-08 | NA | 1.95e-15 | 0.6308 |
| 3. BF | Q5RB23 | Tyrosine-protein kinase JAK2 | 7.02e-07 | NA | 5.73e-11 | 0.6459 |
| 3. BF | P54742 | Serine/threonine-protein kinase AfsK | 2.19e-06 | NA | 1.06e-08 | 0.6422 |
| 3. BF | P17713 | Tyrosine-protein kinase STK | 3.10e-12 | NA | 5.81e-10 | 0.6539 |
| 3. BF | Q1HG70 | Dual specificity mitogen-activated protein kinase kinase 2 | 1.86e-10 | NA | 1.19e-07 | 0.5833 |
| 3. BF | Q9AR27 | Casein kinase II subunit alpha-2 | 2.81e-08 | NA | 4.31e-05 | 0.6384 |
| 3. BF | Q5R8Z4 | Serine/threonine-protein kinase PAK 6 | 3.92e-06 | NA | 2.19e-09 | 0.5511 |
| 3. BF | Q0IJ08 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A | 2.03e-06 | NA | 3.43e-06 | 0.531 |
| 3. BF | Q91618 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase | 3.28e-09 | NA | 3.81e-11 | 0.5991 |
| 3. BF | Q5R5M7 | RAF proto-oncogene serine/threonine-protein kinase | 1.44e-07 | NA | 6.91e-14 | 0.748 |
| 3. BF | Q0VBZ0 | Tyrosine-protein kinase CSK | 1.16e-08 | NA | 4.74e-10 | 0.64 |
| 3. BF | Q5I6M2 | Mitogen-activated protein kinase HOG1 | 1.03e-08 | NA | 6.53e-18 | 0.5912 |
| 3. BF | A4IGM9 | Aurora kinase B | 4.40e-14 | NA | 2.84e-08 | 0.6466 |
| 3. BF | P55202 | Atrial natriuretic peptide receptor 2 | 4.46e-05 | NA | 0.020 | 0.5711 |
| 3. BF | Q108U6 | Hepatocyte growth factor receptor | 6.79e-04 | NA | 1.43e-05 | 0.5626 |
| 3. BF | B6CZ18 | Rhodopsin kinase grk7-b | 3.60e-07 | NA | 1.43e-10 | 0.6327 |
| 3. BF | Q28283 | Tribbles homolog 2 | 1.02e-12 | NA | 0.009 | 0.6225 |
| 3. BF | Q28824 | Myosin light chain kinase, smooth muscle | 2.20e-04 | NA | 3.86e-18 | 0.6426 |
| 3. BF | B5DK35 | Serine/threonine-protein kinase GA29083 | 8.37e-10 | NA | 3.87e-12 | 0.6758 |
| 3. BF | E2QWQ2 | Serine/threonine-protein kinase NLK | 7.01e-06 | NA | 1.24e-11 | 0.5946 |
| 3. BF | Q7ZZC8 | Serine/threonine-protein kinase Nek9 | 2.55e-05 | NA | 1.16e-09 | 0.5986 |
| 3. BF | Q98949 | Tyrosine-protein kinase receptor TYRO3 | 4.84e-08 | NA | 1.49e-05 | 0.6116 |
| 3. BF | Q17R13 | Activated CDC42 kinase 1 | 3.26e-05 | NA | 1.67e-06 | 0.6775 |
| 3. BF | P42689 | Tyrosine-protein kinase SRK3 (Fragment) | 2.01e-13 | NA | 7.40e-06 | 0.6098 |
| 3. BF | Q7YRC6 | Aurora kinase B | 4.13e-14 | NA | 4.35e-08 | 0.643 |
| 3. BF | Q4R8T9 | Cyclin-dependent kinase-like 3 | 4.13e-08 | NA | 1.28e-14 | 0.6386 |
| 3. BF | Q5IFJ9 | NT-3 growth factor receptor | 1.74e-08 | NA | 5.06e-07 | 0.6174 |
| 3. BF | P42683 | Proto-oncogene tyrosine-protein kinase LCK | 9.16e-12 | NA | 5.80e-10 | 0.7121 |
| 3. BF | P29678 | Dual specificity mitogen-activated protein kinase kinase 1 | 1.14e-13 | NA | 4.33e-09 | 0.6262 |
| 3. BF | P55245 | Epidermal growth factor receptor | 8.25e-05 | NA | 5.28e-11 | 0.592 |
| 3. BF | Q61RA2 | Serine/threonine-protein kinase chk-1 | 1.84e-05 | NA | 3.42e-18 | 0.5907 |
| 3. BF | A8WUG4 | Protein kinase C-like 3 | 1.92e-07 | NA | 5.63e-13 | 0.6669 |
| 3. BF | Q8R9T6 | Probable serine/threonine-protein kinase Sps1 | 3.06e-10 | NA | 5.70e-30 | 0.6905 |
| 3. BF | P74297 | Serine/threonine-protein kinase B | 7.66e-12 | NA | 2.61e-12 | 0.5694 |
| 3. BF | Q6FV07 | Spindle assembly checkpoint kinase | 2.88e-14 | NA | 3.37e-10 | 0.6288 |
| 3. BF | P51958 | Cyclin-dependent kinase 1 | 1.11e-16 | NA | 1.35e-10 | 0.7 |
| 3. BF | O62846 | cAMP-dependent protein kinase catalytic subunit gamma (Fragment) | 3.01e-09 | NA | 8.08e-08 | 0.6648 |
| 3. BF | Q8WP15 | Rhodopsin kinase GRK7 | 3.48e-07 | NA | 1.13e-12 | 0.6219 |
| 3. BF | Q8DNS0 | Serine/threonine-protein kinase StkP | 1.19e-10 | NA | 5.98e-28 | 0.7325 |
| 3. BF | Q9XBQ0 | Serine/threonine-protein kinase pkn3 | 6.61e-09 | NA | 3.67e-15 | 0.724 |
| 3. BF | Q8NU97 | Serine/threonine-protein kinases PknA | 1.41e-09 | NA | 1.14e-15 | 0.5983 |
| 3. BF | Q8TGI1 | Serine/threonine-protein kinase ATG1 | 7.14e-05 | NA | 6.66e-09 | 0.5648 |
| 3. BF | Q7TXA9 | Serine/threonine-protein kinase PknK | 2.05e-05 | NA | 8.47e-15 | 0.766 |
| 3. BF | Q6MAN0 | Serine/threonine-protein kinase PknD | 6.77e-06 | NA | 2.57e-14 | 0.6367 |
| 3. BF | Q6BNF3 | Serine/threonine-protein kinase STE20 | 1.00e-05 | NA | 1.96e-12 | 0.6042 |
| 3. BF | Q07E37 | Hepatocyte growth factor receptor | 6.84e-04 | NA | 2.08e-05 | 0.5938 |
| 3. BF | Q4WTN5 | Serine/threonine-protein kinase bur1 | 3.75e-06 | NA | 7.06e-08 | 0.5397 |
| 3. BF | Q25410 | Putative molluscan insulin-related peptide(s) receptor | 1.70e-03 | NA | 6.78e-14 | 0.5659 |
| 3. BF | Q5R7G9 | NUAK family SNF1-like kinase 2 | 3.17e-08 | NA | 1.86e-13 | 0.6266 |
| 3. BF | P54665 | Cell division control protein 2 homolog 2 | 4.89e-10 | NA | 1.32e-10 | 0.6607 |
| 3. BF | O19064 | Tyrosine-protein kinase JAK2 | 1.30e-03 | NA | 4.75e-11 | 0.6568 |
| 3. BF | Q95KR7 | Proto-oncogene tyrosine-protein kinase LCK | 1.31e-08 | NA | 2.69e-10 | 0.6943 |
| 3. BF | A8WXF6 | Calcium/calmodulin-dependent protein kinase type II | 1.59e-09 | NA | 8.28e-15 | 0.6141 |
| 3. BF | Q6DJM7 | Cyclin-dependent kinase 14 | 2.46e-13 | NA | 1.56e-13 | 0.5895 |
| 3. BF | Q4VSN5 | Dual serine/threonine and tyrosine protein kinase | 1.29e-07 | NA | 4.99e-06 | 0.6574 |
| 3. BF | A2BD05 | Serine/threonine-protein kinase Nek6 | 0.00e+00 | NA | 6.33e-20 | 0.739 |
| 3. BF | Q03428 | Putative serine/threonine-protein kinase B | 4.79e-10 | NA | 3.98e-13 | 0.6394 |
| 3. BF | Q5B4Z3 | Cytokinesis protein sepH | 3.79e-05 | NA | 1.22e-13 | 0.6365 |
| 3. BF | Q753D9 | Serine/threonine-protein kinase PKH3 | 1.07e-05 | NA | 1.94e-12 | 0.6687 |
| 3. BF | Q8MY85 | Fibroblast growth factor receptor 2 | 5.43e-06 | NA | 1.98e-06 | 0.5473 |
| 3. BF | Q6GPN6 | Serine/threonine-protein kinase Sgk1-A | 1.63e-08 | NA | 1.08e-10 | 0.619 |
| 3. BF | Q802A6 | Serine/threonine-protein kinase 3/4 | 3.95e-08 | NA | 6.11e-11 | 0.5754 |
| 3. BF | D7UQM5 | Aurora kinase | 2.51e-13 | NA | 1.08e-07 | 0.6755 |
| 3. BF | A8X0C4 | Serine/threonine-protein kinase par-4 | 5.57e-08 | NA | 3.94e-11 | 0.6312 |
| 3. BF | Q4TVR5 | Dual serine/threonine and tyrosine protein kinase | 1.37e-07 | NA | 3.67e-06 | 0.6988 |
| 3. BF | Q99078 | Dual specificity protein kinase FUZ7 | 1.38e-09 | NA | 5.00e-11 | 0.6016 |
| 3. BF | Q75R65 | Tyrosine-protein kinase JAK2 | 1.24e-03 | NA | 2.15e-11 | 0.6668 |
| 3. BF | A1X150 | Hepatocyte growth factor receptor | 7.23e-04 | NA | 6.99e-06 | 0.5642 |
| 3. BF | A2XUW1 | Cyclin-dependent kinase G-2 | 3.62e-06 | NA | 1.01e-12 | 0.5643 |
| 3. BF | Q626B1 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 | 5.40e-08 | NA | 1.78e-07 | 0.6573 |
| 3. BF | P9WI70 | Serine/threonine-protein kinase PknH | 3.33e-08 | NA | 1.17e-24 | 0.7868 |
| 3. BF | Q05876 | Tyrosine-protein kinase Fyn | 5.95e-11 | NA | 3.55e-09 | 0.6738 |
| 3. BF | Q5L5J7 | Serine/threonine-protein kinase PknD | 3.82e-06 | NA | 7.65e-19 | 0.6614 |
| 3. BF | Q3MHJ9 | Calcium/calmodulin-dependent protein kinase type II subunit beta | 3.11e-09 | NA | 1.31e-13 | 0.6174 |
| 3. BF | Q6GLY8 | Serine/threonine-protein kinase Sgk1-B | 2.64e-10 | NA | 3.42e-09 | 0.6407 |
| 3. BF | Q8GRU6 | Leucine-rich repeat receptor-like kinase protein HAR1 | 1.55e-03 | NA | 1.26e-04 | 0.592 |
| 3. BF | Q5EDC3 | Cyclin-dependent kinase 20 | 5.91e-06 | NA | 9.94e-14 | 0.8031 |
| 3. BF | P51166 | Cyclin-dependent-like kinase 5 | 1.22e-15 | NA | 3.41e-12 | 0.662 |
| 3. BF | E1BB52 | Cyclin-dependent kinase 13 | 2.10e-03 | NA | 1.76e-07 | 0.5664 |
| 3. BF | Q5ZJH6 | Serine/threonine-protein kinase ULK3 | 6.22e-09 | NA | 6.38e-18 | 0.6978 |
| 3. BF | P10829 | Protein kinase C gamma type | 4.83e-06 | NA | 3.65e-09 | 0.5998 |
| 3. BF | J9W0G9 | Serine/threonine-protein kinase YPK1 | 5.41e-07 | NA | 3.09e-11 | 0.6582 |
| 3. BF | Q4R633 | Serine/threonine-protein kinase Sgk1 | 2.06e-08 | NA | 9.73e-12 | 0.61 |
| 3. BF | Q07176 | Mitogen-activated protein kinase homolog MMK1 | 1.40e-06 | NA | 8.08e-14 | 0.6116 |
| 3. BF | Q95NE7 | Mitogen-activated protein kinase 14 | 3.32e-08 | NA | 4.40e-18 | 0.5043 |
| 3. BF | B7ZR30 | Serine/threonine-protein kinase 10-A | 1.10e-05 | NA | 6.76e-17 | 0.6922 |
| 3. BF | A4K2W5 | Serine/threonine-protein kinase 4 | 3.84e-08 | NA | 3.21e-09 | 0.571 |
| 3. BF | C0RW22 | Cyclin-dependent kinase 14 | 2.75e-12 | NA | 3.09e-12 | 0.5894 |
| 3. BF | A9S5R3 | Mitogen-activated protein kinase kinase 1c | 5.55e-15 | NA | 4.49e-12 | 0.7266 |
| 3. BF | Q9Z986 | Serine/threonine-protein kinase PknD | 2.91e-06 | NA | 3.31e-16 | 0.6678 |
| 3. BF | Q91743 | Fibroblast growth factor receptor 4 | 4.14e-04 | NA | 2.15e-09 | 0.5966 |
| 3. BF | Q5R7A7 | Serine/threonine-protein kinase Sgk3 | 5.59e-08 | NA | 1.21e-10 | 0.6344 |
| 3. BF | P05772 | Protein kinase C beta type | 1.79e-07 | NA | 1.30e-08 | 0.5904 |
| 3. BF | O94168 | Carbon catabolite-derepressing protein kinase | 1.93e-06 | NA | 7.28e-15 | 0.6656 |
| 3. BF | O77708 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 8.57e-10 | NA | 2.83e-15 | 0.6338 |
| 3. BF | Q5E9Y0 | Cyclin-dependent kinase 2 | 6.66e-16 | NA | 7.69e-13 | 0.7115 |
| 3. BF | Q8JH64 | Tyrosine-protein kinase BTK | 2.72e-10 | NA | 3.11e-07 | 0.7321 |
| 3. BF | A8WVU9 | Rho-associated protein kinase let-502 | 2.66e-04 | NA | 1.61e-14 | 0.6305 |
| 3. BF | P54119 | Cyclin-dependent kinase 1 | 1.08e-14 | NA | 1.53e-09 | 0.6403 |
| 3. BF | B4GXC2 | Serine/threonine-protein kinase GL21140 | 4.71e-07 | NA | 3.91e-12 | 0.6693 |
| 3. BF | Q91009 | High affinity nerve growth factor receptor (Fragment) | 1.66e-08 | NA | 6.03e-08 | 0.5896 |
| 3. BF | O76484 | Casein kinase II subunit alpha | 3.20e-08 | NA | 1.49e-05 | 0.5932 |
| 3. BF | P10741 | Serine/threonine-protein kinase mos | 6.85e-13 | NA | 1.81e-13 | 0.5794 |
| 3. BF | A6ZZF6 | Probable serine/threonine-protein kinase KKQ8 | 3.56e-05 | NA | 4.47e-08 | 0.5848 |
| 3. BF | P27446 | Tyrosine-protein kinase Fyn | 5.01e-11 | NA | 2.36e-10 | 0.6916 |
| 3. BF | Q02399 | Cyclin-dependent-like kinase 5 | 1.67e-15 | NA | 4.87e-12 | 0.6536 |
| 3. BF | B4P5Q9 | Tyrosine-protein kinase-like otk | 2.69e-04 | NA | 0.002 | 0.5205 |
| 3. BF | A4K2M3 | Serine/threonine-protein kinase 4 | 3.15e-08 | NA | 1.22e-09 | 0.5936 |
| 3. BF | Q1DB00 | Tyrosine-protein kinase MasK | 3.82e-07 | NA | 1.48e-18 | 0.6408 |
| 3. BF | P14238 | Tyrosine-protein kinase Fes/Fps | 2.29e-08 | NA | 7.40e-13 | 0.6393 |
| 3. BF | Q5R495 | Serine/threonine-protein kinase OSR1 | 2.95e-08 | NA | 9.79e-16 | 0.6659 |
| 3. BF | A4K2T0 | Serine/threonine-protein kinase 4 | 3.56e-08 | NA | 2.46e-09 | 0.5756 |
| 3. BF | Q07496 | Ephrin type-A receptor 4 | 5.46e-05 | NA | 2.05e-11 | 0.6462 |
| 3. BF | Q8GVC7 | Serine/threonine-protein kinase PKZ1 | 1.27e-08 | NA | 1.89e-08 | 0.6375 |
| 3. BF | P42690 | Tyrosine-protein kinase isoform SRK4 | 2.34e-11 | NA | 8.13e-12 | 0.6541 |
| 3. BF | Q2IBD8 | Hepatocyte growth factor receptor | 4.16e-04 | NA | 1.81e-05 | 0.5892 |
| 3. BF | Q5RC72 | Casein kinase I isoform delta | 1.87e-10 | NA | 4.31e-13 | 0.6712 |
| 3. BF | Q16974 | Calcium-dependent protein kinase C | 1.09e-05 | NA | 7.37e-10 | 0.5498 |
| 3. BF | B3M6I4 | Serine/threonine-protein kinase PLK4 | 1.59e-09 | NA | 1.11e-15 | 0.6916 |
| 3. BF | P18652 | Ribosomal protein S6 kinase 2 alpha | 1.69e-06 | NA | 5.42e-15 | 0.6132 |
| 3. BF | A8WZ92 | Spermatocyte protein spe-8 | 1.14e-04 | NA | 8.60e-13 | 0.3979 |
| 3. BF | Q6CJA8 | Mitogen-activated protein kinase HOG1 | 1.61e-10 | NA | 4.82e-19 | 0.5958 |
| 3. BF | Q40541 | Mitogen-activated protein kinase kinase kinase NPK1 | 3.32e-08 | NA | 6.67e-17 | 0.6998 |
| 3. BF | Q67E01 | Dual serine/threonine and tyrosine protein kinase | 1.01e-07 | NA | 6.08e-06 | 0.6843 |
| 3. BF | P9WI72 | Serine/threonine-protein kinase PknG | 5.10e-05 | NA | 7.78e-04 | 0.5731 |
| 3. BF | F1NBT0 | Serine/threonine-protein kinase 10 | 4.03e-06 | NA | 1.69e-16 | 0.7096 |
| 3. BF | P43057 | Protein kinase C-like 1 | 1.27e-04 | NA | 7.53e-13 | 0.6748 |
| 3. BF | Q966Y3 | Stress-activated protein kinase JNK | 1.08e-05 | NA | 8.35e-18 | 0.5159 |
| 3. BF | A4K2Y1 | Serine/threonine-protein kinase 4 | 3.99e-08 | NA | 2.48e-09 | 0.5746 |
| 3. BF | B5DE93 | Cyclin-dependent kinase 12 | 1.08e-03 | NA | 6.58e-08 | 0.5544 |
| 3. BF | P38679 | Serine/threonine-protein kinase cot-1 | 4.79e-05 | NA | 5.00e-11 | 0.5249 |
| 3. BF | Q00372 | Carbon catabolite-derepressing protein kinase | 8.73e-08 | NA | 2.67e-14 | 0.5875 |
| 3. BF | Q91757 | Glycogen synthase kinase-3 beta | 7.07e-08 | NA | 4.29e-05 | 0.5682 |
| 3. BF | A0QQK3 | Serine/threonine-protein kinase PknG | 1.14e-05 | NA | 2.86e-06 | 0.5929 |
| 3. BF | Q01314 | RAC-alpha serine/threonine-protein kinase | 9.79e-08 | NA | 6.59e-12 | 0.591 |
| 3. BF | Q08942 | Putative serine/threonine-protein kinase A | 8.68e-10 | NA | 6.53e-12 | 0.6437 |
| 3. BF | P41239 | Tyrosine-protein kinase CSK | 1.26e-08 | NA | 8.42e-10 | 0.6802 |
| 3. BF | P9WI66 | Serine/threonine-protein kinase PknJ | 2.36e-08 | NA | 7.18e-17 | 0.7335 |
| 3. BF | Q6PA14 | Serine/threonine-protein kinase 4 | 3.22e-08 | NA | 6.38e-11 | 0.5901 |
| 3. BF | A0A509AFG4 | Calcium-dependent protein kinase 3 | 1.37e-07 | NA | 2.80e-11 | 0.6819 |
| 3. BF | A0M8R7 | Hepatocyte growth factor receptor | 6.21e-04 | NA | 1.83e-05 | 0.5993 |
| 3. BF | A1Y2K1 | Tyrosine-protein kinase Fyn | 5.18e-11 | NA | 1.55e-09 | 0.6661 |
| 3. BF | Q9I9E0 | Serine/threonine-protein kinase TAO3 | 4.23e-07 | NA | 3.08e-07 | 0.5563 |
| 3. BF | A6QGC0 | Serine/threonine-protein kinase PrkC | 4.10e-11 | NA | 3.78e-33 | 0.8237 |
| 3. BF | Q5BBL3 | Serine/threonine-protein kinase ste20 | 4.71e-07 | NA | 5.05e-10 | 0.5619 |
| 3. BF | P0DPS8 | Serine/threonine-protein kinase PknD | 3.93e-06 | NA | 1.68e-15 | 0.6523 |
| 3. BF | Q5ZLL1 | Casein kinase I isoform epsilon | 7.63e-09 | NA | 4.42e-12 | 0.6689 |
| 3. BF | Q67E00 | Dual serine/threonine and tyrosine protein kinase | 1.40e-07 | NA | 7.24e-06 | 0.6483 |
| 3. BF | P9WI80 | Serine/threonine-protein kinase PknB | 3.35e-08 | NA | 5.11e-23 | 0.7239 |
| 3. BF | Q6BVA0 | Spindle assembly checkpoint kinase | 1.13e-09 | NA | 1.14e-09 | 0.6253 |
| 3. BF | Q4H3K6 | Fibroblast growth factor receptor | 5.83e-05 | NA | 5.85e-09 | 0.5959 |
| 3. BF | P65727 | Serine/threonine-protein kinase PknA | 8.71e-11 | NA | 1.15e-19 | 0.7689 |
| 3. BF | Q28948 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 3.03e-09 | NA | 5.67e-15 | 0.7067 |
| 3. BF | Q91845 | Ephrin type-A receptor 4-A | 5.57e-05 | NA | 7.59e-12 | 0.6674 |
| 3. BF | B0VXL7 | Cyclin-dependent kinase 14 | 2.78e-12 | NA | 4.54e-12 | 0.5952 |
| 3. BF | Q2TA25 | Serine/threonine-protein kinase PLK1 | 2.97e-07 | NA | 4.23e-18 | 0.628 |
| 3. BF | P48734 | Cyclin-dependent kinase 1 | 2.22e-15 | NA | 7.12e-10 | 0.6855 |
| 3. BF | P0CY25 | Serine/threonine-protein kinase STE7 homolog | 3.55e-07 | NA | 3.63e-08 | 0.6583 |
| 3. BF | P32023 | cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 | 6.86e-06 | NA | 6.20e-11 | 0.639 |
| 3. BF | Q07E01 | Hepatocyte growth factor receptor | 5.27e-04 | NA | 1.03e-05 | 0.5962 |
| 3. BF | A4IIW7 | Cyclin-dependent kinase 14 | 1.49e-09 | NA | 5.18e-13 | 0.5961 |
| 3. BF | O42099 | Mitogen-activated protein kinase 8B | 7.55e-06 | NA | 2.11e-16 | 0.5179 |
| 3. BF | Q751F5 | Serine/threonine-protein kinase SSN3 | 6.23e-06 | NA | 1.23e-05 | 0.5297 |
| 3. BF | E1BK52 | Serine/threonine-protein kinase 10 | 3.64e-06 | NA | 6.99e-13 | 0.6239 |
| 3. BF | A8XA58 | Cyclin-dependent kinase 1 | 1.53e-14 | NA | 2.43e-11 | 0.6583 |
| 3. BF | Q7T2V3 | Mitogen-activated protein kinase kinase kinase 10 | 1.13e-06 | NA | 1.51e-10 | 0.6802 |
| 3. BF | Q4PC06 | Mitogen-activated protein kinase HOG1 | 3.89e-09 | NA | 8.68e-18 | 0.5982 |
| 3. BF | Q9HG11 | Mitogen-activated protein kinase mpkC | 1.64e-08 | NA | 4.00e-18 | 0.6126 |
| 3. BF | P54734 | Serine/threonine-protein kinase PknA | 9.79e-12 | NA | 2.52e-15 | 0.7353 |
| 3. BF | A7MBB4 | Mitogen-activated protein kinase kinase kinase 13 | 2.07e-06 | NA | 1.01e-13 | 0.608 |
| 3. BF | Q8WMV0 | Rhodopsin kinase GRK7 | 2.73e-07 | NA | 9.63e-14 | 0.6203 |
| 3. BF | Q91288 | Fibroblast growth factor receptor 4 | 7.53e-05 | NA | 4.72e-08 | 0.5746 |
| 3. BF | Q2LYK3 | Serine/threonine-protein kinase PLK4 | 1.87e-09 | NA | 3.16e-13 | 0.6942 |
| 3. BF | P79996 | Mitogen-activated protein kinase 9 | 3.21e-08 | NA | 3.67e-16 | 0.4937 |
| 3. BF | A4IFM7 | Myosin light chain kinase 2, skeletal/cardiac muscle | 1.54e-08 | NA | 2.66e-10 | 0.6663 |
| 3. BF | Q99014 | Protein kinase C-like | 2.19e-04 | NA | 1.49e-10 | 0.6143 |
| 3. BF | P9WI68 | Serine/threonine-protein kinase PknI | 2.81e-07 | NA | 1.69e-08 | 0.6433 |
| 3. BF | Q5ZIU3 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 | 4.15e-06 | NA | 1.45e-08 | 0.5711 |
| 3. BF | Q9DGA2 | Cyclin-dependent kinase 1 | 5.55e-16 | NA | 3.59e-10 | 0.6796 |
| 3. BF | Q6AX33 | Microtubule-associated serine/threonine-protein kinase 3 | 2.13e-03 | NA | 1.34e-15 | 0.5789 |
| 3. BF | P27447 | Tyrosine-protein kinase Yes | 4.97e-11 | NA | 6.88e-07 | 0.6414 |
| 3. BF | Q9DGD3 | Cyclin-dependent kinase 1 | 5.55e-16 | NA | 3.94e-10 | 0.6721 |
| 3. BF | Q4PNJ1 | Mitogen-activated protein kinase HOG1 (Fragment) | 2.47e-07 | NA | 4.20e-17 | 0.6784 |
| 3. BF | Q769I5 | Hepatocyte growth factor receptor | 2.73e-03 | NA | 4.45e-05 | 0.5954 |
| 3. BF | Q25378 | Protein kinase C | 1.02e-07 | NA | 1.53e-09 | 0.5909 |
| 3. BF | Q9WUM7 | Homeodomain-interacting protein kinase 2 | 4.96e-05 | NA | 9.65e-07 | 0.5137 |
| 3. BF | A8XJW8 | Serine/threonine-protein kinase cst-1 | 4.52e-08 | NA | 9.19e-12 | 0.5812 |
| 3. BF | A0AAR7 | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase | 1.17e-09 | NA | 1.83e-11 | 0.6134 |
| 3. BF | Q6C7U8 | Negative regulator of the PHO system | 6.66e-16 | NA | 3.60e-17 | 0.7077 |
| 3. BF | Q05116 | Dual specificity mitogen-activated protein kinase kinase 1 | 4.12e-09 | NA | 2.85e-09 | 0.5895 |
| 3. BF | P31034 | Serine/threonine-protein kinase CBK1 | 9.69e-06 | NA | 8.87e-07 | 0.5647 |
| 3. BF | A7J1T0 | Mitogen-activated protein kinase kinase kinase 13-B | 2.86e-05 | NA | 2.90e-14 | 0.6266 |
| 3. BF | Q7RM49 | Cell division control protein 2 homolog | 3.33e-16 | NA | 1.44e-15 | 0.7381 |
| 3. BF | O14427 | Serine/threonine-protein kinase CLA4 | 5.97e-05 | NA | 3.02e-11 | 0.6223 |
| 3. BF | Q5PXS1 | Tyrosine-protein kinase Lck | 1.52e-08 | NA | 2.84e-10 | 0.6789 |
| 3. BF | Q6P647 | Casein kinase I isoform delta | 1.47e-10 | NA | 2.76e-13 | 0.637 |
| 3. BF | A1A4I4 | Serine/threonine-protein kinase N1 | 3.15e-05 | NA | 1.12e-07 | 0.6458 |
| 3. BF | Q75ZY9 | Hepatocyte growth factor receptor | 5.97e-04 | NA | 1.83e-05 | 0.6233 |
| 3. BF | E1BB50 | Cyclin-dependent kinase 12 | 1.25e-03 | NA | 8.74e-07 | 0.568 |
| 3. BF | Q8AYC9 | Serine/threonine-protein kinase Chk1 | 5.91e-06 | NA | 3.02e-10 | 0.5827 |
| 3. BF | Q2QL89 | Hepatocyte growth factor receptor | 7.82e-04 | NA | 1.39e-05 | 0.5972 |
| 3. BF | Q5GLH2 | Tribbles homolog 2 | 2.71e-09 | NA | 0.015 | 0.5933 |
| 3. BF | A2ZMH2 | Serine/threonine-protein kinase Nek2 | 4.84e-07 | NA | 5.47e-17 | 0.6891 |
| 3. BF | Q6PAD2 | Serine/threonine-protein kinase PLK4 | 7.14e-06 | NA | 1.92e-15 | 0.6744 |
| 3. BF | G4NDR3 | Mitogen-activated protein kinase kinae kinase MCK1 | 1.82e-03 | NA | 1.87e-08 | 0.6264 |
| 3. BF | Q6BS08 | Serine/threonine-protein kinase ATG1 | 2.66e-05 | NA | 4.62e-06 | 0.5329 |
| 3. BF | O77819 | Rho-associated protein kinase 1 | 4.53e-04 | NA | 1.37e-12 | 0.6422 |
| 3. BF | Q5RCH1 | Cyclin-dependent kinase 1 | 1.11e-15 | NA | 1.11e-09 | 0.7035 |
| 3. BF | Q7RAH3 | Calcium-dependent protein kinase 1 | 8.38e-08 | NA | 3.20e-16 | 0.6367 |
| 3. BF | P13369 | Macrophage colony-stimulating factor 1 receptor | 4.94e-05 | NA | 8.28e-08 | 0.5726 |
| 3. BF | Q622Z7 | G protein-coupled receptor kinase 1 | 1.08e-06 | NA | 4.01e-11 | 0.6154 |
| 3. BF | F1N9Y5 | Tyrosine-protein kinase SYK | 8.80e-08 | NA | 2.72e-12 | 0.6607 |
| 3. BF | D2HXI8 | Serine/threonine-protein kinase greatwall | 1.75e-02 | NA | 5.40e-10 | 0.7434 |
| 3. BF | Q8FUI5 | Probable serine/threonine-protein kinase CE0033 | 2.29e-07 | NA | 1.37e-25 | 0.7475 |
| 3. BF | Q751E8 | Negative regulator of the PHO system | 6.66e-15 | NA | 3.36e-14 | 0.7076 |
| 3. BF | Q95M30 | Tyrosine-protein kinase HCK | 1.28e-11 | NA | 2.65e-12 | 0.6604 |
| 3. BF | A0A078CGE6 | MAP3K epsilon protein kinase 1 | 4.64e-04 | NA | 1.70e-15 | 0.6582 |
| 3. BF | E1BFR5 | Serine/threonine-protein kinase greatwall | 1.67e-02 | NA | 3.40e-10 | 0.6593 |
| 3. BF | Q6R2V0 | Serine/threonine-protein kinase WNK1 | 1.03e-02 | NA | 1.84e-09 | 0.7163 |
| 3. BF | A8XSC1 | Serine/threonine kinase NLK | 1.69e-04 | NA | 4.47e-09 | 0.5262 |
| 3. BF | Q81WH6 | Serine/threonine-protein kinase PrkC | 3.90e-11 | NA | 1.08e-33 | 0.7464 |
| 3. BF | Q2VWQ3 | Serine/threonine-protein kinase pakA | 2.42e-08 | NA | 5.39e-12 | 0.5923 |
| 3. BF | A5TY85 | Serine/threonine-protein kinase PknA | 1.16e-10 | NA | 1.15e-19 | 0.7605 |
| 3. BF | Q28GW8 | Maternal embryonic leucine zipper kinase | 7.40e-07 | NA | 4.65e-15 | 0.6674 |
| 3. BF | Q91694 | Ephrin type-A receptor 4-B | 3.32e-04 | NA | 1.42e-12 | 0.6747 |
| 3. BF | B1WAS2 | Hormonally up-regulated neu tumor-associated kinase homolog | 3.37e-07 | NA | 1.19e-14 | 0.7025 |
| 3. BF | Q91286 | Fibroblast growth factor receptor 2 | 5.45e-05 | NA | 1.71e-07 | 0.5962 |
| 3. BF | A7J1T2 | Mitogen-activated protein kinase kinase kinase 13-A | 2.56e-06 | NA | 6.19e-14 | 0.6149 |
| 3. BF | Q5R4K3 | Ribosomal protein S6 kinase alpha-5 | 2.49e-05 | NA | 1.77e-17 | 0.615 |
| 3. BF | E2RJI4 | Serine/threonine-protein kinase greatwall | 6.07e-03 | NA | 6.28e-10 | 0.7844 |
| 3. BF | Q2IBG7 | Hepatocyte growth factor receptor | 5.07e-04 | NA | 1.72e-05 | 0.5758 |
| 3. BF | Q5F361 | TBC domain-containing protein kinase-like protein | 1.19e-04 | NA | 1.25e-04 | 0.5857 |
| 3. BF | A8WWX1 | Mitogen-activated protein kinase kinase kinase mom-4 | 8.09e-07 | NA | 7.49e-05 | 0.6255 |
| 3. BF | A0A509AQE6 | Calcium-dependent protein kinase 5 | 3.68e-07 | NA | 8.51e-17 | 0.6939 |
| 3. BF | Q6BV06 | Serine/threonine-protein kinase BUR1 | 1.24e-06 | NA | 1.53e-07 | 0.5339 |
| 3. BF | Q5RCC4 | Calcium/calmodulin-dependent protein kinase type II subunit alpha | 1.80e-08 | NA | 3.87e-13 | 0.6326 |
| 3. BF | P70032 | Serine/threonine-protein kinase PLK1 | 5.02e-07 | NA | 1.42e-16 | 0.6087 |
| 3. BF | A0M8S8 | Hepatocyte growth factor receptor | 1.01e-03 | NA | 2.08e-05 | 0.5629 |
| 3. BF | P42159 | Class II receptor tyrosine kinase | 6.57e-05 | NA | 2.84e-07 | 0.5468 |
| 3. BF | Q5ZKI0 | Calcium/calmodulin-dependent protein kinase type II delta chain | 1.99e-08 | NA | 7.06e-15 | 0.634 |
| 3. BF | Q9S2C0 | Serine/threonine-protein kinase PksC | 3.24e-10 | NA | 2.31e-19 | 0.7756 |
| 3. BF | P49695 | Probable serine/threonine-protein kinase PkwA | 4.25e-07 | NA | 3.62e-07 | 0.7232 |
| 3. BF | P42687 | Tyrosine-protein kinase SPK-1 | 6.18e-07 | NA | 1.16e-10 | 0.686 |
| 3. BF | Q6DE87 | Serine/threonine-protein kinase Chk1 | 1.05e-06 | NA | 8.04e-11 | 0.575 |
| 3. BF | A9S9Q8 | Mitogen-activated protein kinase 4b | 3.57e-07 | NA | 1.41e-12 | 0.5782 |
| 3. BF | P0DPS9 | Serine/threonine-protein kinase PknD | 4.66e-06 | NA | 5.51e-16 | 0.654 |
| 3. BF | Q90891 | Dual specificity mitogen-activated protein kinase kinase 2 | 1.02e-08 | NA | 1.47e-07 | 0.5851 |
| 3. BF | Q07497 | Ephrin type-B receptor 5 | 7.16e-05 | NA | 6.35e-13 | 0.6744 |
| 3. BF | Q4VSN3 | Dual serine/threonine and tyrosine protein kinase | 1.26e-07 | NA | 8.02e-07 | 0.6949 |
| 3. BF | Q5RB22 | Receptor tyrosine-protein kinase erbB-3 | 2.32e-04 | NA | 3.29e-05 | 0.6836 |
| 3. BF | Q25197 | Putative insulin-like peptide receptor | 1.02e-03 | NA | 8.20e-10 | 0.5573 |
| 3. BF | E1BMN8 | Serine/threonine-protein kinase NLK | 6.82e-06 | NA | 1.17e-11 | 0.5778 |
| 3. BF | Q5R8M1 | Serine/threonine-protein kinase 38 | 4.94e-07 | NA | 2.88e-11 | 0.5656 |
| 3. BF | A9RVK2 | Mitogen-activated protein kinase kinase kinase 1b | 1.24e-06 | NA | 1.13e-11 | 0.6528 |
| 3. BF | Q4R7T5 | Cyclin-dependent kinase-like 2 | 1.52e-09 | NA | 4.37e-12 | 0.5594 |
| 3. BF | P0DP15 | Sucrose non-fermenting protein kinase 1 | 5.26e-06 | NA | 3.26e-12 | 0.644 |
| 3. BF | Q8QFP8 | LIM domain kinase 1 | 1.86e-07 | NA | 6.54e-05 | 0.5504 |
| 3. BF | Q07E24 | Hepatocyte growth factor receptor | 6.08e-04 | NA | 1.70e-05 | 0.6062 |
| 3. BF | A2X6X1 | Cyclin-dependent kinase G-1 | 2.18e-06 | NA | 8.81e-13 | 0.5537 |
| 3. BF | P05126 | Protein kinase C beta type | 1.81e-07 | NA | 9.19e-09 | 0.6082 |
| 3. BF | Q6FRE7 | Serine/threonine-protein kinase PTK2 | 1.02e-03 | NA | 1.24e-07 | 0.5486 |
| 3. BF | A2CI35 | Dual serine/threonine and tyrosine protein kinase | 2.14e-07 | NA | 6.30e-06 | 0.6657 |
| 3. BF | P62205 | Serine/threonine-protein kinase PLK1 | 4.75e-07 | NA | 3.49e-16 | 0.5879 |
| 3. BF | Q5R8X7 | Mitogen-activated protein kinase kinase kinase 13 | 2.34e-05 | NA | 8.20e-14 | 0.6146 |
| 3. BF | Q95YM9 | Fibroblast growth factor receptor | 1.64e-04 | NA | 1.83e-12 | 0.6079 |
| 3. BF | Q6CFS5 | Serine/threonine-protein kinase CBK1 | 9.37e-06 | NA | 1.93e-11 | 0.5826 |
| 3. BF | Q863I2 | Serine/threonine-protein kinase OSR1 | 4.68e-08 | NA | 1.20e-15 | 0.6758 |
| 3. BF | P42688 | Tyrosine-protein kinase SRK2 (Fragment) | 1.10e-13 | NA | 1.25e-10 | 0.6666 |
| 3. BF | P54739 | Serine/threonine-protein kinase PkaA | 2.19e-08 | NA | 1.90e-23 | 0.7679 |
| 3. BF | A2YBX5 | Protein kinase G11A | 3.11e-10 | NA | 9.14e-05 | 0.557 |
| 3. BF | P28582 | Calcium-dependent protein kinase | 2.42e-08 | NA | 6.38e-14 | 0.6458 |
| 3. BF | A4K2S1 | Serine/threonine-protein kinase 4 | 3.74e-08 | NA | 2.64e-09 | 0.5937 |
| 3. BF | Q7ZYJ0 | Serine/threonine-protein kinase TAO1-B | 1.10e-06 | NA | 2.61e-09 | 0.5866 |
| 3. BF | O55076 | Cyclin-dependent kinase 2 | 4.44e-16 | NA | 2.86e-12 | 0.7066 |
| 3. BF | P10102 | Protein kinase C alpha type | 2.12e-07 | NA | 2.09e-10 | 0.5913 |
| 3. BF | P48963 | Cyclin-dependent kinase 2 | 7.77e-16 | NA | 7.20e-13 | 0.7141 |
| 3. BF | Q68UT7 | Hormonally up-regulated neu tumor-associated kinase | 4.37e-08 | NA | 2.57e-18 | 0.6737 |
| 3. BF | Q09YL1 | Hepatocyte growth factor receptor | 5.42e-04 | NA | 2.18e-05 | 0.5926 |
| 3. BF | Q6CSX2 | Serine/threonine-protein kinase ATG1 | 4.00e-05 | NA | 1.66e-10 | 0.558 |
| 3. BF | Q4U925 | Casein kinase II subunit alpha | 4.62e-09 | NA | 7.80e-06 | 0.6079 |
| 3. BF | P53356 | Tyrosine-protein kinase HTK16 | 2.21e-09 | NA | 2.77e-09 | 0.6488 |
| 3. BF | O93982 | Mitogen-activated protein kinase HOG1 | 1.29e-08 | NA | 8.33e-19 | 0.5943 |
| 3. BF | P13406 | Tyrosine-protein kinase Fyn | 5.15e-11 | NA | 3.17e-10 | 0.6551 |
| 3. BF | Q03364 | Fibroblast growth factor receptor 2 | 5.42e-05 | NA | 5.01e-09 | 0.5795 |
| 3. BF | Q5IS37 | NT-3 growth factor receptor | 2.03e-08 | NA | 5.15e-07 | 0.6173 |
| 3. BF | W0T9X4 | Serine/threonine-protein kinase ATG1 | 4.05e-06 | NA | 6.78e-09 | 0.5762 |
| 3. BF | E1C2I2 | Serine/threonine-protein kinase greatwall | 2.06e-02 | NA | 2.57e-08 | 0.6734 |
| 3. BF | P43068 | Mitogen-activated protein kinase MKC1 | 1.84e-08 | NA | 1.32e-15 | 0.5662 |
| 3. BF | A8X6H1 | cGMP-dependent protein kinase egl-4 | 1.16e-06 | NA | 5.85e-09 | 0.5833 |
| 3. BF | B4HBU3 | Serine/threonine-protein kinase PLK4 | 3.23e-09 | NA | 3.34e-13 | 0.6991 |
| 3. BF | Q09YN5 | Hepatocyte growth factor receptor | 1.71e-05 | NA | 1.37e-05 | 0.6134 |
| 3. BF | A8WYE4 | Serine/threonine-protein kinase par-1 | 6.70e-05 | NA | 1.58e-16 | 0.6728 |
| 3. BF | Q4PKS0 | Mitogen-activated protein kinase HOG1 (Fragment) | 3.68e-07 | NA | 3.19e-17 | 0.6953 |
| 3. BF | Q2HJF7 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 2.42e-08 | NA | 1.80e-15 | 0.6362 |
| 3. BF | A0A509AHB6 | Calcium-dependent protein kinase 1 | 5.73e-08 | NA | 4.51e-16 | 0.6883 |
| 3. BF | A9SR33 | Mitogen-activated protein kinase kinase 1b | 2.89e-15 | NA | 7.57e-11 | 0.74 |
| 3. BF | Q8SW31 | Probable serine/threonine-protein kinase KIN1 homolog | 8.58e-08 | NA | 1.26e-11 | 0.6836 |
| 3. BF | Q2ULU3 | Serine/threonine-protein kinase ste20 | 4.90e-07 | NA | 1.64e-11 | 0.5818 |
| 3. BF | Q9KIG4 | Serine/threonine-protein kinase PK-1 | 3.80e-09 | NA | 3.75e-21 | 0.7442 |
| 3. BF | Q9RRH3 | DNA damage-responsive serine/threonine-protein kinase RqkA | 1.26e-11 | NA | 3.75e-23 | 0.7674 |
| 3. BF | Q8G4G1 | Probable serine/threonine-protein kinase pknA2 | 2.55e-08 | NA | 1.15e-23 | 0.7794 |
| 3. BF | Q9DGA5 | Cyclin-dependent kinase 1 | 1.78e-15 | NA | 2.01e-10 | 0.6717 |
| 3. BF | A5K0N4 | cGMP-dependent protein kinase | 1.34e-06 | NA | 4.65e-13 | 0.5702 |
| 3. BF | A6ZU07 | Serine/threonine-protein kinase ATG1 | 2.33e-05 | NA | 1.14e-08 | 0.5596 |
| 3. BF | A9RWC9 | Mitogen-activated protein kinase kinase 1a | 1.22e-15 | NA | 1.41e-14 | 0.676 |
| 3. BF | A2Y4B6 | Cyclin-dependent kinase D-1 | 8.15e-09 | NA | 1.95e-12 | 0.6853 |
| 3. BF | Q09178 | Tyrosine-protein kinase JAK1 | 2.10e-04 | NA | 1.64e-12 | 0.6852 |
| 3. BF | D2I3C6 | Serine/threonine-protein kinase DCLK2 | 9.79e-05 | NA | 2.12e-11 | 0.6717 |
| 3. BF | Q2PQN9 | Cyclin-dependent kinase 5 homolog | 1.89e-15 | NA | 1.96e-11 | 0.6782 |
| 3. BF | Q6VZ17 | Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) | 1.41e-06 | NA | 3.99e-15 | 0.6491 |
| 3. BF | P9WI78 | Serine/threonine-protein kinase PknD | 4.31e-08 | NA | 5.11e-20 | 0.7798 |
| 3. BF | Q04770 | Cell division protein kinase 2 homolog | 3.33e-16 | NA | 1.40e-08 | 0.7357 |
| 3. BF | Q04982 | Serine/threonine-protein kinase B-raf | 8.04e-07 | NA | 2.64e-15 | 0.7285 |
| 3. BF | Q6FL58 | Serine/threonine-protein kinase ATG1 | 2.21e-05 | NA | 4.40e-09 | 0.5311 |
| 3. BF | P0A5S5 | Serine/threonine-protein kinase PknB | 7.28e-08 | NA | 5.11e-23 | 0.6439 |
| 3. BF | A2VDV2 | Serine/threonine-protein kinase 38 | 3.52e-07 | NA | 2.91e-11 | 0.566 |
| 3. BF | Q75D46 | Serine/threonine-protein kinase BUR1 | 1.67e-05 | NA | 7.26e-04 | 0.5249 |
| 3. BF | P9WI82 | Serine/threonine-protein kinase PknA | 8.62e-11 | NA | 1.15e-19 | 0.7677 |
| 3. BF | B4MXR8 | Serine/threonine-protein kinase PLK4 | 1.11e-06 | NA | 4.72e-13 | 0.6775 |
| 3. BF | P28693 | Ephrin type-B receptor 2 | 1.93e-04 | NA | 5.43e-14 | 0.6568 |
| 3. BF | B4KYX8 | Serine/threonine-protein kinase PLK4 | 1.46e-06 | NA | 7.10e-15 | 0.697 |
| 3. BF | A9SY39 | Mitogen-activated protein kinase kinase kinase 1a | 1.78e-06 | NA | 6.51e-11 | 0.6489 |
| 3. BF | P09560 | RAF proto-oncogene serine/threonine-protein kinase | 9.29e-08 | NA | 8.12e-13 | 0.7098 |
| 3. BF | A2X0M1 | Mitogen-activated protein kinase 13 | 1.34e-07 | NA | 3.41e-13 | 0.5911 |
| 3. BF | Q9TTY2 | Tyrosine-protein kinase Fer | 1.81e-08 | NA | 4.60e-13 | 0.6563 |
| 3. BF | Q00646 | Cyclin-dependent kinase 1 | 6.44e-15 | NA | 1.46e-08 | 0.639 |
| 3. BF | Q07785 | Cell division control protein 2 homolog | 4.44e-16 | NA | 2.44e-16 | 0.7125 |
| 3. BF | Q6CR51 | Serine/threonine-protein kinase SSN3 | 2.21e-04 | NA | 1.99e-05 | 0.479 |
| 3. BF | Q16975 | Calcium-independent protein kinase C | 3.16e-06 | NA | 5.54e-10 | 0.6436 |
| 3. BF | P43249 | G protein-coupled receptor kinase 5 | 4.27e-07 | NA | 4.07e-13 | 0.542 |
| 3. BF | Q5R4V3 | Casein kinase I isoform gamma-3 | 2.88e-07 | NA | 1.01e-06 | 0.5914 |
| 3. BF | Q4I5U9 | Serine/threonine-protein kinase BUR1 | 1.99e-06 | NA | 5.89e-10 | 0.5358 |
| 3. BF | Q2QLH6 | Hepatocyte growth factor receptor | 6.48e-04 | NA | 9.41e-06 | 0.5932 |
| 4. PB | P38615 | Serine/threonine-protein kinase RIM11/MSD1 | 1.00e-07 | 2.57e-03 | 1.84e-07 | NA |
| 4. PB | Q04543 | Serine/threonine-protein kinase US3 homolog | NA | 1.50e-02 | 3.93e-05 | NA |
| 4. PB | O75716 | Serine/threonine-protein kinase 16 | 4.00e-15 | 7.51e-07 | 1.55e-08 | NA |
| 4. PB | P27466 | Calcium/calmodulin-dependent protein kinase I | 1.30e-07 | 1.63e-03 | 2.43e-16 | NA |
| 4. PB | Q9Z335 | Serine/threonine-protein kinase SBK1 | 1.00e-06 | 5.13e-10 | 7.87e-10 | NA |
| 4. PB | P47042 | Probable serine/threonine-protein kinase IKS1 | 2.33e-07 | 3.34e-05 | 2.64e-04 | NA |
| 4. PB | A3LUB9 | Serine/threonine-protein kinase SSN3 | 8.86e-09 | 8.49e-08 | 8.83e-07 | NA |
| 4. PB | Q8BN21 | Serine/threonine-protein kinase VRK2 | 7.36e-05 | 3.60e-02 | 9.50e-06 | NA |
| 4. PB | P49187 | Mitogen-activated protein kinase 10 | 1.32e-05 | 1.86e-02 | 2.48e-14 | NA |
| 4. PB | O08605 | MAP kinase-interacting serine/threonine-protein kinase 1 | 3.17e-07 | 1.04e-08 | 2.85e-12 | NA |
| 4. PB | P34516 | Putative serine/threonine-protein kinase K06H7.1 | 6.32e-10 | 2.17e-08 | 5.25e-08 | NA |
| 4. PB | P32801 | Serine/threonine-protein kinase ELM1 | 2.16e-09 | 3.31e-04 | 1.76e-08 | NA |
| 4. PB | Q9N272 | Mitogen-activated protein kinase 13 | NA | 8.84e-04 | 2.31e-13 | NA |
| 4. PB | Q9URT9 | Protein kinase gsk31 | 2.25e-09 | 1.15e-03 | 2.19e-06 | NA |
| 4. PB | P50750 | Cyclin-dependent kinase 9 | 7.63e-13 | 3.28e-03 | 7.14e-07 | NA |
| 4. PB | Q5UQ78 | Putative serine/threonine-protein kinase R517/R518 | NA | 8.57e-03 | 2.32e-17 | NA |
| 4. PB | Q9C0K7 | STE20-related kinase adapter protein beta | 1.01e-10 | 7.40e-03 | 3.78e-05 | NA |
| 4. PB | Q9BUB5 | MAP kinase-interacting serine/threonine-protein kinase 1 | 7.92e-06 | 7.10e-09 | 1.50e-07 | NA |
| 4. PB | P27361 | Mitogen-activated protein kinase 3 | 2.80e-07 | 8.41e-03 | 5.19e-19 | NA |
| 4. PB | P40417 | Mitogen-activated protein kinase ERK-A | 2.12e-08 | 2.20e-04 | 1.09e-17 | NA |
| 4. PB | Q9BXA7 | Testis-specific serine/threonine-protein kinase 1 | 1.73e-13 | 4.37e-02 | 9.61e-14 | NA |
| 4. PB | Q9SYB9 | Serine/threonine-protein kinase UCN | 3.78e-07 | 8.83e-03 | 7.28e-04 | NA |
| 4. PB | Q388M1 | Glycogen synthase kinase 3 | 2.09e-09 | 4.13e-03 | 1.03e-05 | NA |
| 4. PB | P68182 | cAMP-dependent protein kinase catalytic subunit beta | 2.30e-14 | 1.58e-02 | 7.54e-08 | NA |
| 4. PB | Q8K4T3 | STE20-related kinase adapter protein beta | 9.52e-11 | 3.18e-03 | 3.33e-04 | NA |
| 4. PB | Q10N20 | Mitogen-activated protein kinase 5 | 1.08e-07 | 1.55e-02 | 1.59e-14 | NA |
| 4. PB | P34633 | Putative serine/threonine-protein kinase ZK507.1 | 1.68e-04 | 4.78e-05 | 0.010 | NA |
| 4. PB | Q9LQQ9 | Mitogen-activated protein kinase 13 | 1.04e-07 | 5.73e-03 | 3.72e-13 | NA |
| 4. PB | O61443 | Mitogen-activated protein kinase p38b | 5.83e-08 | 1.03e-02 | 1.00e-15 | NA |
| 4. PB | Q32PP3 | Serine/threonine-protein kinase pdik1l | 2.85e-12 | 8.39e-04 | 9.19e-10 | NA |
| 4. PB | Q8QZR7 | Serine/threonine-protein kinase PDIK1L | 2.64e-12 | 3.08e-04 | 1.06e-12 | NA |
| 4. PB | Q8MXI4 | Mitogen-activated protein kinase pmk-2 | 3.77e-08 | 2.76e-03 | 1.70e-10 | NA |
| 4. PB | Q8BW96 | Calcium/calmodulin-dependent protein kinase type 1D | 7.20e-10 | 1.64e-07 | 1.85e-13 | NA |
| 4. PB | P27791 | cAMP-dependent protein kinase catalytic subunit alpha | 2.35e-14 | 4.47e-03 | 6.65e-08 | NA |
| 4. PB | D4AE59 | Serine/threonine-protein kinase STK11 | 1.09e-07 | 2.18e-06 | 7.64e-13 | NA |
| 4. PB | Q9TXJ0 | Calcium/calmodulin-dependent protein kinase type 1 | 5.86e-12 | 5.38e-12 | 5.87e-19 | NA |
| 4. PB | Q9DGD9 | Mitogen-activated protein kinase 8 | 3.99e-06 | 1.01e-02 | 1.11e-16 | NA |
| 4. PB | Q75H77 | Serine/threonine-protein kinase SAPK10 | 4.00e-08 | 1.74e-09 | 5.93e-13 | NA |
| 4. PB | P78368 | Casein kinase I isoform gamma-2 | 1.17e-12 | 1.55e-02 | 2.97e-07 | NA |
| 4. PB | O61847 | Cyclin-dependent kinase 2 | 1.10e-08 | 4.67e-02 | 6.80e-11 | NA |
| 4. PB | P31325 | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform | 1.66e-09 | 2.54e-08 | 2.21e-13 | NA |
| 4. PB | Q8TG13 | Casein kinase II subunit alpha | 1.24e-12 | 1.41e-02 | 8.64e-05 | NA |
| 4. PB | O59697 | Serine/threonine-protein kinase ppk25 | 1.67e-07 | 3.61e-04 | 1.43e-07 | NA |
| 4. PB | Q4G050 | MAP kinase-interacting serine/threonine-protein kinase 1 | 3.12e-07 | 6.03e-07 | 6.52e-12 | NA |
| 4. PB | Q6SA08 | Testis-specific serine/threonine-protein kinase 4 | 5.03e-12 | 1.86e-06 | 6.72e-14 | NA |
| 4. PB | P41676 | Probable serine/threonine-protein kinase 2 | NA | 3.40e-02 | 3.74e-05 | NA |
| 4. PB | O08875 | Serine/threonine-protein kinase DCLK1 | 1.09e-06 | 2.28e-04 | 9.25e-13 | NA |
| 4. PB | Q9U2H1 | Cyclin-dependent kinase-like 1 | 1.66e-13 | 1.39e-03 | 9.42e-13 | NA |
| 4. PB | Q9DB30 | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform | 8.81e-12 | 2.71e-08 | 2.66e-13 | NA |
| 4. PB | Q8BGW6 | Serine/threonine-protein kinase 32A | 1.76e-08 | 7.70e-03 | 1.09e-11 | NA |
| 4. PB | Q8BK63 | Casein kinase I isoform alpha | 3.82e-11 | 4.28e-09 | 2.35e-08 | NA |
| 4. PB | P18334 | Casein kinase II subunit alpha | 6.83e-09 | 1.84e-02 | 8.26e-05 | NA |
| 4. PB | Q9D2E1 | Testis-specific serine/threonine-protein kinase 3 | 1.89e-15 | 1.96e-04 | 2.73e-11 | NA |
| 4. PB | Q63450 | Calcium/calmodulin-dependent protein kinase type 1 | 8.35e-10 | 1.07e-07 | 4.87e-17 | NA |
| 4. PB | Q9WTK7 | Serine/threonine-protein kinase STK11 | 2.62e-09 | 9.59e-07 | 6.91e-13 | NA |
| 4. PB | Q03147 | Cyclin-dependent kinase 7 | 1.40e-11 | 1.68e-03 | 1.52e-13 | NA |
| 4. PB | A1CAF0 | Mitogen-activated protein kinase mpkC | 2.98e-08 | 3.48e-03 | 3.99e-18 | NA |
| 4. PB | P83100 | Putative mitogen-activated protein kinase 14C | 2.84e-08 | 2.40e-02 | 3.33e-16 | NA |
| 4. PB | O70150 | Calcium/calmodulin-dependent protein kinase type 1B | 3.91e-10 | 3.63e-10 | 8.31e-17 | NA |
| 4. PB | Q16644 | MAP kinase-activated protein kinase 3 | 1.69e-07 | 6.14e-09 | 8.26e-11 | NA |
| 4. PB | Q6A1A2 | Putative 3-phosphoinositide-dependent protein kinase 2 | 1.61e-08 | 1.23e-03 | 3.85e-11 | NA |
| 4. PB | Q15131 | Cyclin-dependent kinase 10 | 4.84e-10 | 3.74e-05 | 2.93e-11 | NA |
| 4. PB | P05132 | cAMP-dependent protein kinase catalytic subunit alpha | 2.39e-14 | 1.31e-02 | 4.68e-08 | NA |
| 4. PB | Q00526 | Cyclin-dependent kinase 3 | 4.04e-10 | 1.59e-02 | 2.21e-11 | NA |
| 4. PB | Q61241 | Testis-specific serine/threonine-protein kinase 1 | 9.45e-10 | 1.15e-03 | 7.22e-15 | NA |
| 4. PB | Q5U2N4 | MAP kinase-interacting serine/threonine-protein kinase 2 | 5.78e-07 | 5.91e-05 | 2.46e-10 | NA |
| 4. PB | Q96PF2 | Testis-specific serine/threonine-protein kinase 2 | 5.63e-09 | 4.96e-04 | 1.07e-13 | NA |
| 4. PB | Q8BVP5 | Casein kinase I isoform gamma-2 | 8.79e-13 | 5.56e-03 | 2.48e-07 | NA |
| 4. PB | P50582 | Cell cycle serine/threonine-protein kinase hsk1 | 3.47e-05 | 1.86e-08 | 2.29e-04 | NA |
| 4. PB | P17612 | cAMP-dependent protein kinase catalytic subunit alpha | 2.52e-14 | 3.85e-03 | 1.95e-08 | NA |
| 4. PB | Q9FMY3 | Serine/threonine-protein kinase-like protein At5g23170 | 2.40e-07 | 5.97e-13 | 5.13e-05 | NA |
| 4. PB | Q9QYK9 | Calcium/calmodulin-dependent protein kinase type 1B | 1.84e-09 | 4.17e-10 | 8.39e-17 | NA |
| 4. PB | P42168 | Casein kinase I isoform alpha | 5.70e-11 | 9.27e-10 | 8.54e-08 | NA |
| 4. PB | Q641Z4 | Cyclin-dependent kinase 9 | 5.02e-08 | 4.74e-03 | 6.42e-07 | NA |
| 4. PB | Q9U2Q9 | Glycogen synthase kinase-3 | 3.34e-09 | 3.08e-04 | 2.75e-06 | NA |
| 4. PB | Q7SXE8 | Cyclin-dependent kinase 9 | 4.47e-08 | 1.11e-03 | 7.65e-07 | NA |
| 4. PB | Q6NU98 | Serine/threonine-protein kinase pdik1l-B | 2.29e-12 | 6.53e-04 | 9.02e-11 | NA |
| 4. PB | Q8WU08 | Serine/threonine-protein kinase 32A | 4.30e-08 | 5.78e-03 | 1.35e-12 | NA |
| 4. PB | P36615 | Serine/threonine-protein kinase csk1 | 4.38e-12 | 1.48e-11 | 0.046 | NA |
| 4. PB | G5ECN5 | STE20-related kinase adapter protein strd-1 | 2.36e-09 | 1.37e-04 | 0.013 | NA |
| 4. PB | Q17QV9 | Serine/threonine-protein kinase 40 | 6.85e-07 | 4.78e-08 | 7.29e-06 | NA |
| 4. PB | Q75V57 | Serine/threonine-protein kinase SAPK9 | 6.51e-09 | 5.43e-08 | 1.05e-13 | NA |
| 4. PB | Q8IU85 | Calcium/calmodulin-dependent protein kinase type 1D | 7.97e-10 | 1.16e-06 | 1.11e-13 | NA |
| 4. PB | O42376 | Mitogen-activated protein kinase 12 | 5.19e-08 | 1.61e-03 | 2.74e-16 | NA |
| 4. PB | P34635 | Putative serine/threonine-protein kinase ZK507.3 | 3.18e-04 | 5.05e-06 | 0.001 | NA |
| 4. PB | O62618 | Mitogen-activated protein kinase p38a | 3.76e-08 | 2.13e-04 | 2.51e-14 | NA |
| 4. PB | Q4FCZ5 | Serine/threonine-protein kinase SSN3 | 5.11e-06 | 3.53e-05 | 6.06e-07 | NA |
| 4. PB | Q8LG64 | Cyclin-dependent kinase B2-2 | 1.25e-14 | 6.25e-05 | 9.63e-06 | NA |
| 4. PB | P40236 | Casein kinase I homolog hhp2 | 5.83e-11 | 7.63e-05 | 4.33e-07 | NA |
| 4. PB | Q9HCP0 | Casein kinase I isoform gamma-1 | 1.70e-12 | 6.14e-03 | 2.27e-06 | NA |
| 4. PB | Q9VT57 | Cyclin-dependent kinase 8 | 9.36e-07 | 4.80e-02 | 1.83e-06 | NA |
| 4. PB | Q9C9U4 | Mitogen-activated protein kinase 15 | 3.72e-06 | 6.51e-03 | 2.70e-14 | NA |
| 4. PB | Q9P7I2 | Calcium/calmodulin-dependent protein kinase type I | 1.14e-11 | 1.11e-06 | 2.26e-15 | NA |
| 4. PB | P30285 | Cyclin-dependent kinase 4 | 9.99e-16 | 2.36e-02 | 1.16e-09 | NA |
| 4. PB | P57760 | Serine/threonine-protein kinase 16 | 4.00e-15 | 1.12e-07 | 4.32e-09 | NA |
| 4. PB | P23573 | Cyclin-dependent kinase 2 | 1.76e-10 | 3.24e-03 | 2.75e-08 | NA |
| 4. PB | Q9VM90 | Serine/threonine-protein kinase meng-po | 1.70e-05 | 3.47e-02 | 8.28e-09 | NA |
| 4. PB | Q9M9E9 | Serine/threonine-protein kinase SRK2C | 4.63e-10 | 7.56e-04 | 5.65e-13 | NA |
| 4. PB | O94768 | Serine/threonine-protein kinase 17B | 1.16e-13 | 8.36e-14 | 2.30e-10 | NA |
| 4. PB | Q7XQP4 | Serine/threonine-protein kinase SAPK7 | 1.07e-08 | 9.27e-06 | 3.81e-13 | NA |
| 4. PB | Q10452 | Protein kinase gsk3 | 2.19e-09 | 5.40e-03 | 2.43e-06 | NA |
| 4. PB | P53233 | Probable serine/threonine-protein kinase FMP48 | 2.22e-05 | 3.40e-12 | 2.02e-12 | NA |
| 4. PB | Q54Y26 | Probable serine/threonine-protein kinase ndrA | 2.04e-06 | 8.57e-04 | 2.67e-10 | NA |
| 4. PB | Q9ZVP5 | Mitogen-activated protein kinase kinase kinase 18 | 2.83e-08 | 1.34e-04 | 1.44e-10 | NA |
| 4. PB | F4I1N8 | Serine/threonine-protein kinase ATG1t | 2.45e-08 | 1.87e-02 | 7.63e-14 | NA |
| 4. PB | Q2QSL4 | Putative cyclin-dependent kinase F-2 | 5.07e-10 | 3.28e-04 | 6.11e-12 | NA |
| 4. PB | Q96QS6 | Serine/threonine-protein kinase H2 | 2.05e-07 | 8.16e-05 | 4.89e-11 | NA |
| 4. PB | Q09892 | Mitogen-activated protein kinase sty1 | 3.74e-09 | 1.00e-02 | 6.41e-19 | NA |
| 4. PB | Q17446 | Mitogen-activated protein kinase pmk-1 | 9.52e-09 | 4.70e-03 | 6.10e-16 | NA |
| 4. PB | P11802 | Cyclin-dependent kinase 4 | 7.77e-16 | 2.18e-02 | 6.72e-10 | NA |
| 4. PB | Q9LSC2 | PTI1-like tyrosine-protein kinase At3g15890 | 1.39e-05 | 4.67e-02 | 0.004 | NA |
| 4. PB | Q91XS8 | Serine/threonine-protein kinase 17B | 4.06e-14 | 1.76e-11 | 4.37e-11 | NA |
| 4. PB | Q2RA93 | Probable serine/threonine-protein kinase WNK6 | 1.04e-05 | 9.83e-03 | 4.24e-07 | NA |
| 4. PB | Q7TNZ6 | STE20-related kinase adapter protein alpha | 2.73e-08 | 2.68e-04 | 0.006 | NA |
| 4. PB | P06243 | Cell division control protein 7 | 1.18e-04 | 4.08e-06 | 7.10e-07 | NA |
| 4. PB | Q8QZX0 | Serine/threonine-protein kinase SBK1 | 9.63e-06 | 1.94e-10 | 7.46e-10 | NA |
| 4. PB | P43568 | Serine/threonine-protein kinase CAK1 | 1.32e-10 | 2.66e-05 | 8.45e-07 | NA |
| 4. PB | Q39022 | Mitogen-activated protein kinase 2 | 5.68e-08 | 7.40e-03 | 4.52e-15 | NA |
| 4. PB | Q556Y4 | Casein kinase I | 1.25e-10 | 4.76e-02 | 4.00e-08 | NA |
| 4. PB | P07934 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform | 4.57e-10 | 4.92e-10 | 1.42e-14 | NA |
| 4. PB | Q52WX2 | Serine/threonine-protein kinase SBK1 | 2.34e-05 | 1.17e-08 | 1.13e-09 | NA |
| 4. PB | O64629 | Serine/threonine-protein kinase Aurora-3 | 2.00e-15 | 2.38e-02 | 9.20e-16 | NA |
| 4. PB | A8X5H5 | Glycogen synthase kinase-3 | 1.68e-09 | 5.69e-04 | 3.38e-05 | NA |
| 4. PB | Q63538 | Mitogen-activated protein kinase 12 | 7.43e-08 | 7.19e-03 | 2.34e-15 | NA |
| 4. PB | Q60737 | Casein kinase II subunit alpha | 6.71e-08 | 1.01e-07 | 0.001 | NA |
| 4. PB | Q5PRD4 | Casein kinase I isoform gamma-1 | 1.72e-12 | 4.25e-03 | 5.70e-07 | NA |
| 4. PB | P19139 | Casein kinase II subunit alpha | 6.34e-08 | 1.44e-07 | 0.001 | NA |
| 4. PB | P25323 | Myosin light chain kinase A | 3.98e-11 | 1.21e-07 | 1.87e-15 | NA |
| 4. PB | Q8C4X2 | Casein kinase I isoform gamma-3 | 5.27e-08 | 7.30e-05 | 1.51e-07 | NA |
| 4. PB | O88697 | Serine/threonine-protein kinase 16 | 2.22e-15 | 4.12e-07 | 1.53e-08 | NA |
| 4. PB | Q90ZY4 | Serine/threonine-protein kinase SBK1 | 4.28e-06 | 4.19e-12 | 1.02e-08 | NA |
| 4. PB | Q9Y898 | Calcium/calmodulin-dependent protein kinase kinase cmkC | 3.23e-05 | 2.12e-05 | 1.19e-09 | NA |
| 4. PB | Q9SGN7 | Serine/threonine-protein kinase-like protein At1g28390 | 1.17e-04 | 1.14e-02 | 1.04e-07 | NA |
| 4. PB | Q9DGE1 | Mitogen-activated protein kinase 14B | 7.89e-10 | 4.02e-02 | 1.26e-18 | NA |
| 4. PB | Q8NEV1 | Casein kinase II subunit alpha 3 | 9.32e-08 | 2.71e-08 | 0.002 | NA |
| 4. PB | Q06226 | Serine/threonine-protein kinase Sgk1 | 1.65e-08 | 3.50e-02 | 1.26e-09 | NA |
| 4. PB | Q63454 | Mitogen-activated protein kinase 4 (Fragment) | 2.65e-12 | 4.29e-02 | 5.05e-13 | NA |
| 4. PB | Q7T6Y1 | Putative serine/threonine-protein kinase R436 | NA | 3.58e-15 | 2.25e-10 | NA |
| 4. PB | Q5RER6 | Serine/threonine-protein kinase PDIK1L | 8.74e-13 | 2.13e-04 | 2.33e-10 | NA |
| 4. PB | P9WI63 | Serine/threonine-protein kinase PknL | 5.52e-12 | 1.91e-10 | 1.24e-22 | NA |
| 4. PB | Q3SYZ2 | MAP kinase-activated protein kinase 3 | 1.84e-06 | 2.35e-08 | 6.06e-11 | NA |
| 4. PB | Q965G5 | MAP kinase-activated protein kinase mak-2 | 2.27e-09 | 1.90e-07 | 1.42e-08 | NA |
| 4. PB | Q8N752 | Casein kinase I isoform alpha-like | 7.23e-12 | 7.65e-10 | 2.41e-07 | NA |
| 4. PB | O14047 | Serine/threonine-protein kinase ppk11 | 3.36e-12 | 1.05e-04 | 1.90e-16 | NA |
| 4. PB | Q8IY84 | Serine/threonine-protein kinase NIM1 | 6.56e-09 | 1.88e-06 | 5.73e-17 | NA |
| 4. PB | Q8SRF5 | Probable cell division protein kinase ECU08_0230 | 6.07e-14 | 1.59e-04 | 2.75e-17 | NA |
| 4. PB | Q99986 | Serine/threonine-protein kinase VRK1 | 5.44e-05 | 4.76e-06 | 0.022 | NA |
| 4. PB | P16911 | cAMP-dependent protein kinase catalytic subunit 2 | 3.63e-14 | 3.35e-04 | 6.43e-09 | NA |
| 4. PB | P49138 | MAP kinase-activated protein kinase 2 | 3.29e-09 | 3.92e-07 | 5.78e-12 | NA |
| 4. PB | Q9Y6M4 | Casein kinase I isoform gamma-3 | 4.96e-06 | 1.67e-02 | 3.04e-07 | NA |
| 4. PB | P24100 | Cyclin-dependent kinase A-1 | 3.55e-15 | 3.25e-02 | 6.62e-11 | NA |
| 4. PB | Q54US6 | Probable inactive serine/threonine-protein kinase DDB_G0280855 | 3.27e-06 | 2.95e-04 | 8.04e-06 | NA |
| 4. PB | Q9LSF1 | Serine/threonine-protein kinase OXI1 | 1.45e-07 | 6.41e-08 | 3.03e-08 | NA |
| 4. PB | Q12126 | Serine/threonine-protein kinase crk1 | 4.19e-11 | 1.45e-05 | 1.01e-10 | NA |
| 4. PB | Q80X41 | Serine/threonine-protein kinase VRK1 | 3.70e-06 | 1.93e-08 | 0.002 | NA |
| 4. PB | Q9BXA6 | Testis-specific serine/threonine-protein kinase 6 | 5.11e-15 | 4.04e-06 | 1.23e-08 | NA |
| 4. PB | Q54CY9 | Probable myosin light chain kinase DDB_G0292624 | 6.82e-13 | 7.24e-07 | 7.13e-18 | NA |
| 4. PB | Q6ZI44 | Serine/threonine-protein kinase SAPK6 | 1.42e-07 | 5.29e-06 | 1.57e-12 | NA |
| 4. PB | Q9UEE5 | Serine/threonine-protein kinase 17A | 4.74e-10 | 1.32e-03 | 8.44e-13 | NA |
| 4. PB | Q62761 | Casein kinase I isoform gamma-1 | 7.24e-13 | 1.23e-03 | 2.11e-06 | NA |
| 4. PB | P19784 | Casein kinase II subunit alpha' | 2.26e-09 | 1.91e-02 | 2.33e-04 | NA |
| 4. PB | Q20085 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 | 1.10e-05 | 3.15e-03 | 5.21e-07 | NA |
| 4. PB | P97633 | Casein kinase I isoform alpha | 2.46e-11 | 1.75e-05 | 1.15e-08 | NA |
| 4. PB | Q12222 | Glycogen synthase kinase-3 homolog YGK3 | 1.91e-06 | 1.78e-06 | 1.28e-06 | NA |
| 4. PB | Q6P2M8 | Calcium/calmodulin-dependent protein kinase type 1B | 2.09e-12 | 6.22e-10 | 1.24e-16 | NA |
| 4. PB | P43292 | Serine/threonine-protein kinase SRK2G | 2.10e-09 | 1.12e-06 | 4.70e-14 | NA |
| 4. PB | Q925K9 | Testis-specific serine/threonine-protein kinase 6 | 4.22e-15 | 4.09e-05 | 5.80e-09 | NA |
| 4. PB | Q3UUJ4 | STE20-related kinase adapter protein alpha | 1.26e-07 | 5.73e-03 | 0.003 | NA |
| 4. PB | Q702W0 | Mitogen-activated protein kinase hog1 | NA | 8.32e-03 | 2.74e-17 | NA |
| 4. PB | P54367 | Casein kinase I isoform alpha | 6.71e-08 | 2.47e-07 | 1.01e-08 | NA |
| 4. PB | P16892 | Mitogen-activated protein kinase FUS3 | 2.84e-08 | 1.39e-02 | 1.55e-09 | NA |
| 4. PB | Q86AD7 | Probable myosin light chain kinase DDB_G0271550 | 8.84e-12 | 8.74e-03 | 2.46e-18 | NA |
| 4. PB | Q54L81 | Probable serine/threonine-protein kinase DDB_G0286841 | 3.22e-08 | 2.40e-04 | 6.72e-13 | NA |
| 4. PB | Q8BG48 | Serine/threonine-protein kinase 17B | 7.83e-14 | 3.52e-11 | 1.53e-10 | NA |
| 4. PB | P54685 | Cyclin-dependent kinase 7 | 1.59e-09 | 9.61e-04 | 8.56e-09 | NA |
| 4. PB | Q8GYQ5 | Mitogen-activated protein kinase 12 | 7.60e-08 | 5.04e-03 | 9.12e-15 | NA |
| 4. PB | Q39192 | Serine/threonine-protein kinase SRK2D | 1.91e-07 | 8.39e-07 | 4.21e-13 | NA |
| 4. PB | Q4KM47 | Cyclin-dependent kinase 10 | 3.17e-10 | 9.63e-05 | 6.55e-11 | NA |
| 4. PB | P21965 | Protein kinase MCK1 | 4.94e-09 | 1.40e-06 | 3.92e-07 | NA |
| 4. PB | P68181 | cAMP-dependent protein kinase catalytic subunit beta | 2.38e-14 | 1.58e-02 | 7.54e-08 | NA |
| 4. PB | Q9M077 | Serine/threonine-protein kinase Aurora-1 | 3.11e-15 | 3.91e-02 | 3.36e-11 | NA |
| 4. PB | P28482 | Mitogen-activated protein kinase 1 | 1.51e-07 | 5.96e-03 | 1.67e-17 | NA |
| 4. PB | P36005 | Serine/threonine-protein kinase KDX1 | 2.57e-08 | 8.74e-03 | 1.56e-09 | NA |
| 4. PB | Q80YP0 | Cyclin-dependent kinase 3 | 1.19e-10 | 7.64e-04 | 9.54e-10 | NA |
| 4. PB | Q8CEQ0 | Cyclin-dependent kinase-like 1 | 2.87e-09 | 4.67e-02 | 1.22e-13 | NA |
| 4. PB | Q940H6 | Serine/threonine-protein kinase SRK2E | 1.52e-06 | 1.50e-07 | 1.65e-14 | NA |
| 4. PB | Q92207 | Mitogen-activated protein kinase HOG1 | 3.39e-09 | 1.15e-03 | 1.78e-19 | NA |
| 4. PB | O01775 | Serine/threonine-protein kinase nekl-2 | 2.41e-10 | 2.70e-04 | 5.39e-15 | NA |
| 4. PB | Q3TZA2 | Cyclin-dependent kinase-like 4 | 4.57e-11 | 1.67e-02 | 7.95e-14 | NA |
| 4. PB | Q9SND6 | Mitogen-activated protein kinase kinase kinase 20 | 1.96e-08 | 6.33e-04 | 9.53e-09 | NA |
| 4. PB | Q9P1W9 | Serine/threonine-protein kinase pim-2 | 1.11e-13 | 9.27e-03 | 9.02e-10 | NA |
| 4. PB | Q9LT38 | Serine/threonine-protein kinase UCNL | 8.25e-09 | 4.96e-04 | 2.46e-08 | NA |
| 4. PB | Q8BHI9 | Serine/threonine-protein kinase NIM1 | 4.27e-09 | 2.00e-06 | 1.62e-16 | NA |
| 4. PB | B1WBU5 | Serine/threonine-protein kinase SBK2 | 2.76e-06 | 8.66e-03 | 3.45e-07 | NA |
| 4. PB | Q61831 | Mitogen-activated protein kinase 10 | 1.33e-05 | 1.34e-02 | 3.18e-14 | NA |
| 4. PB | O94547 | Serine/threonine-protein kinase srk1 | 1.11e-07 | 1.93e-02 | 6.63e-12 | NA |
| 4. PB | P50613 | Cyclin-dependent kinase 7 | 1.68e-09 | 2.09e-04 | 1.21e-13 | NA |
| 4. PB | Q9WTY9 | Mitogen-activated protein kinase 13 | 1.25e-07 | 6.91e-03 | 4.63e-14 | NA |
| 4. PB | O08911 | Mitogen-activated protein kinase 12 | 2.89e-08 | 1.45e-02 | 2.69e-15 | NA |
| 4. PB | Q62763 | Casein kinase I isoform gamma-3 | 4.41e-09 | 2.66e-02 | 2.23e-07 | NA |
| 4. PB | O42844 | Calcium/calmodulin-dependent protein kinase type II | 1.15e-09 | 2.66e-05 | 4.44e-11 | NA |
| 4. PB | P43063 | Cyclin-dependent kinase 1 | 2.66e-15 | 2.45e-04 | 5.46e-10 | NA |
| 4. PB | Q15831 | Serine/threonine-protein kinase STK11 | 8.35e-08 | 6.73e-07 | 1.28e-13 | NA |
| 4. PB | Q0D4J7 | Serine/threonine-protein kinase SAPK2 | 4.66e-08 | 1.16e-03 | 6.60e-15 | NA |
| 4. PB | Q2QXC6 | Probable serine/threonine-protein kinase WNK9 | 3.95e-07 | 6.45e-03 | 3.08e-05 | NA |
| 4. PB | P63085 | Mitogen-activated protein kinase 1 | 1.73e-08 | 9.27e-03 | 1.52e-17 | NA |
| 4. PB | Q62762 | Casein kinase I isoform gamma-2 | 1.11e-12 | 5.40e-03 | 2.69e-07 | NA |
| 4. PB | Q8N165 | Serine/threonine-protein kinase PDIK1L | 2.26e-12 | 1.78e-04 | 9.73e-13 | NA |
| 4. PB | Q9SPK4 | Phosphoenolpyruvate carboxylase kinase 1 | 3.33e-16 | 2.47e-03 | 6.42e-16 | NA |
| 4. PB | P49137 | MAP kinase-activated protein kinase 2 | 3.97e-09 | 7.80e-05 | 2.20e-12 | NA |
| 4. PB | Q91YS8 | Calcium/calmodulin-dependent protein kinase type 1 | 1.88e-09 | 8.82e-08 | 5.16e-17 | NA |
| 4. PB | Q9UIK4 | Death-associated protein kinase 2 | 1.99e-11 | 5.03e-08 | 1.84e-15 | NA |
| 4. PB | Q9SF12 | Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like | 3.93e-06 | 4.18e-02 | 0.007 | NA |
| 4. PB | Q12505 | Serine/threonine-protein kinase SKS1 | 9.59e-07 | 3.89e-08 | 2.10e-05 | NA |
| 4. PB | P35426 | Cyclin-dependent kinase 4 | 1.67e-15 | 1.35e-02 | 6.54e-10 | NA |
| 4. PB | Q9FFP9 | Serine/threonine-protein kinase SRK2H | 3.53e-09 | 6.69e-06 | 2.48e-13 | NA |
| 4. PB | Q99J95 | Cyclin-dependent kinase 9 | 4.68e-08 | 4.74e-03 | 6.42e-07 | NA |
| 4. PB | P27966 | Serine/threonine-protein kinase-transforming protein Rmil | NA | 3.01e-04 | 1.35e-15 | NA |
| 4. PB | Q00534 | Cyclin-dependent kinase 6 | 3.37e-10 | 4.89e-05 | 2.92e-11 | NA |
| 4. PB | Q5N942 | Serine/threonine-protein kinase SAPK4 | 3.02e-10 | 4.60e-07 | 8.31e-14 | NA |
| 4. PB | P41415 | Serine/threonine-protein kinase 1 | NA | 2.90e-06 | 4.56e-07 | NA |
| 4. PB | P0C5D6 | Serine/threonine-protein kinase SAPK3 | 5.01e-09 | 3.38e-05 | 1.93e-16 | NA |
| 4. PB | P49139 | MAP kinase-activated protein kinase 2 (Fragment) | 1.10e-07 | 7.33e-07 | 2.20e-12 | NA |
| 4. PB | Q07250 | Calcium/calmodulin-dependent serine/threonine-protein kinase | 4.84e-09 | 2.76e-06 | 2.98e-11 | NA |
| 4. PB | O10269 | Serine/threonine-protein kinase 1 | NA | 3.41e-05 | 1.17e-06 | NA |
| 4. PB | Q9C9M7 | Cyclin-dependent kinase D-2 | 5.83e-11 | 8.16e-05 | 3.72e-10 | NA |
| 4. PB | O74426 | Serine/threonine-protein kinase ppk33 | 2.04e-07 | 1.43e-06 | 5.09e-10 | NA |
| 4. PB | Q9C958 | Serine/threonine-protein kinase SRK2B | 9.95e-09 | 1.04e-06 | 8.97e-12 | NA |
| 4. PB | Q9UQY9 | Cell cycle protein kinase spo4 | 2.80e-05 | 4.76e-06 | 5.93e-06 | NA |
| 4. PB | Q8SRU0 | Probable casein kinase II subunit alpha homolog | 3.42e-13 | 3.46e-04 | 1.15e-07 | NA |
| 4. PB | Q4WQR3 | Mitogen-activated protein kinase mpkA | 4.50e-08 | 4.25e-02 | 5.84e-19 | NA |
| 4. PB | Q64261 | Cyclin-dependent kinase 6 | 3.26e-10 | 7.72e-05 | 1.23e-10 | NA |
| 4. PB | P63086 | Mitogen-activated protein kinase 1 | 1.76e-08 | 9.27e-03 | 1.52e-17 | NA |
| 4. PB | Q9HBH9 | MAP kinase-interacting serine/threonine-protein kinase 2 | 1.18e-05 | 5.11e-05 | 6.51e-10 | NA |
| 4. PB | P34117 | Cyclin-dependent kinase 5 homolog | 4.44e-16 | 4.67e-02 | 2.72e-16 | NA |
| 4. PB | P41719 | Serine/threonine-protein kinase 1 | NA | 3.62e-03 | 3.25e-08 | NA |
| 4. PB | Q8N2I9 | Serine/threonine-protein kinase 40 | 9.86e-08 | 2.87e-07 | 3.95e-05 | NA |
| 4. PB | Q8LF80 | Cyclin-dependent kinase B2-1 | 1.54e-14 | 1.15e-05 | 3.33e-06 | NA |
| 4. PB | O64812 | Serine/threonine-protein kinase SRK2J | 3.53e-08 | 9.84e-05 | 2.66e-13 | NA |
| 4. PB | P22517 | Calcium/calmodulin-dependent protein kinase II | 1.26e-07 | 1.43e-07 | 2.99e-16 | NA |
| 4. PB | P51952 | Cyclin-dependent kinase 7 (Fragment) | 2.03e-09 | 8.22e-04 | 7.03e-14 | NA |
| 4. PB | Q9SMQ4 | Serine/threonine-protein kinase SRK2F | 2.14e-10 | 3.57e-04 | 1.65e-14 | NA |
| 4. PB | O54863 | Testis-specific serine/threonine-protein kinase 2 | 3.51e-09 | 2.00e-05 | 7.00e-14 | NA |
| 4. PB | Q3UMM4 | Cyclin-dependent kinase 10 | 9.21e-10 | 1.27e-05 | 2.49e-11 | NA |
| 4. PB | P68400 | Casein kinase II subunit alpha | 9.11e-08 | 9.88e-08 | 0.001 | NA |
| 4. PB | O13958 | Serine/threonine-protein kinase srb10 | 6.16e-09 | 1.28e-02 | 3.64e-12 | NA |
| 4. PB | P53779 | Mitogen-activated protein kinase 10 | 2.41e-07 | 7.93e-03 | 2.79e-14 | NA |
| 4. PB | P13286 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform | 3.77e-12 | 4.72e-10 | 1.44e-14 | NA |
| 4. PB | Q8CDB0 | MAP kinase-interacting serine/threonine-protein kinase 2 | 9.54e-07 | 5.98e-05 | 2.60e-10 | NA |
| 4. PB | P40235 | Casein kinase I homolog hhp1 | 1.72e-09 | 5.66e-09 | 3.32e-11 | NA |
| 4. PB | Q14012 | Calcium/calmodulin-dependent protein kinase type 1 | 1.36e-09 | 2.87e-07 | 1.23e-16 | NA |
| 4. PB | Q8L4P8 | Cyclin-dependent kinase B1-1 | 5.66e-15 | 2.65e-03 | 5.71e-08 | NA |
| 4. PB | Q11112 | Putative tyrosine-protein kinase C03B1.5 | 1.73e-09 | 5.41e-05 | 4.17e-04 | NA |
| 4. PB | Q9J523 | Probable serine/threonine-protein kinase FPV212 | NA | 9.84e-05 | 8.88e-04 | NA |
| 4. PB | O54833 | Casein kinase II subunit alpha' | 3.23e-09 | 1.09e-02 | 2.33e-04 | NA |
| 4. PB | P00532 | Serine/threonine-protein kinase-transforming protein raf | NA | 6.33e-07 | 3.42e-15 | NA |
| 4. PB | Q3UMW7 | MAP kinase-activated protein kinase 3 | 3.37e-09 | 3.08e-08 | 2.13e-11 | NA |
| 4. PB | P21708 | Mitogen-activated protein kinase 3 | 3.23e-08 | 1.93e-02 | 6.59e-19 | NA |
| 4. PB | Q7TNL4 | Serine/threonine-protein kinase 40 | 8.24e-09 | 4.43e-07 | 3.06e-05 | NA |
| 4. PB | Q16816 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform | 7.21e-10 | 3.01e-11 | 6.60e-14 | NA |
| 4. PB | Q9HBY8 | Serine/threonine-protein kinase Sgk2 | 4.95e-09 | 4.37e-02 | 2.67e-09 | NA |
| 4. PB | Q7TNL3 | Serine/threonine-protein kinase 40 | 3.55e-09 | 5.53e-07 | 3.03e-05 | NA |
| 4. PB | Q75LR7 | Serine/threonine-protein kinase SAPK1 | 6.61e-11 | 7.30e-05 | 8.21e-13 | NA |
| 4. PB | Q8WQ99 | Casein kinase I gamma | 2.64e-09 | 1.50e-03 | 1.34e-05 | NA |
| 4. PB | Q54FH3 | Probable serine/threonine-protein kinase DDB_G0290859 | 2.23e-11 | 1.66e-04 | 1.39e-07 | NA |
| 4. PB | Q20443 | Serine/threonine-protein kinase prk-2 | 8.19e-08 | 1.02e-03 | 1.07e-11 | NA |
| 4. PB | Q556S2 | Serine/threonine-protein kinase pakH | 1.06e-08 | 2.77e-02 | 1.88e-08 | NA |
| 4. PB | P48729 | Casein kinase I isoform alpha | 3.76e-11 | 4.28e-09 | 2.35e-08 | NA |
| 4. PB | P53778 | Mitogen-activated protein kinase 12 | 8.43e-08 | 2.42e-02 | 1.20e-15 | NA |
| 4. PB | Q6DHU8 | Lymphokine-activated killer T-cell-originated protein kinase homolog | 2.76e-14 | 1.61e-02 | 0.007 | NA |
| 4. PB | P42169 | Putative casein kinase I C03C10.2 | 2.29e-13 | 3.34e-05 | 4.23e-06 | NA |
| 4. PB | Q39193 | Serine/threonine-protein kinase SRK2I | 2.75e-07 | 9.94e-07 | 7.29e-13 | NA |
| 4. PB | P41720 | Serine/threonine-protein kinase 1 | NA | 2.64e-11 | 3.92e-07 | NA |
| 4. PB | P40231 | Casein kinase II subunit alpha | 1.46e-12 | 1.45e-02 | 8.21e-07 | NA |
| 4. PB | Q2U469 | Mitogen-activated protein kinase mpkC | 4.72e-08 | 1.18e-02 | 3.40e-18 | NA |
| 4. PB | Q8C1R0 | Testis-specific serine/threonine-protein kinase 5 | 2.17e-10 | 7.57e-08 | 1.43e-13 | NA |
| 4. PB | Q03785 | Serine/threonine-protein kinase VHS1 | 4.03e-06 | 3.96e-13 | 2.34e-07 | NA |
| 4. PB | Q5R667 | Serine/threonine-protein kinase 40 | 8.06e-08 | 2.30e-07 | 4.39e-05 | NA |
| 4. PB | P08092 | Negative regulator of sexual conjugation and meiosis | 7.54e-10 | 2.42e-02 | 6.37e-11 | NA |
| 4. PB | Q8W490 | Serine/threonine-protein kinase PEPKR2 | 2.53e-10 | 2.84e-02 | 3.95e-11 | NA |
| 4. PB | Q8VDF3 | Death-associated protein kinase 2 | 4.96e-11 | 3.15e-06 | 2.50e-15 | NA |
| 4. PB | O44408 | GLH-binding kinase 1 | 1.58e-07 | 4.91e-04 | 4.05e-08 | NA |
| 4. PB | P27638 | Mitogen-activated protein kinase spk1 | 1.51e-08 | 1.08e-02 | 1.40e-12 | NA |
| 4. PB | Q7T0B0 | Serine/threonine-protein kinase 40 | 2.01e-07 | 2.35e-07 | 6.61e-05 | NA |
| 4. PB | Q91Y86 | Mitogen-activated protein kinase 8 | 3.57e-06 | 1.79e-02 | 5.57e-15 | NA |
| 4. PB | P41808 | Sporulation-specific mitogen-activated protein kinase SMK1 | 1.23e-08 | 6.92e-08 | 1.98e-13 | NA |
| 4. PB | Q39023 | Mitogen-activated protein kinase 3 | 9.19e-08 | 3.89e-04 | 1.92e-13 | NA |
| 4. PB | O15264 | Mitogen-activated protein kinase 13 | 2.97e-08 | 1.37e-02 | 3.62e-14 | NA |
| 4. PB | Q7XKA8 | Serine/threonine-protein kinase SAPK5 | 4.93e-08 | 1.98e-04 | 2.05e-12 | NA |
| 4. PB | P43291 | Serine/threonine-protein kinase SRK2A | 2.11e-07 | 1.01e-06 | 1.90e-12 | NA |
| 4. PB | Q93VK0 | Phosphoenolpyruvate carboxylase kinase 2 | 6.66e-16 | 3.00e-06 | 3.72e-15 | NA |
| 4. PB | Q63844 | Mitogen-activated protein kinase 3 | 4.27e-08 | 4.06e-02 | 6.65e-19 | NA |
| 4. PB | Q06548 | Probable serine/threonine-protein kinase PBL9 | 5.07e-05 | 4.18e-02 | 3.22e-11 | NA |
| 4. PB | O01427 | Aurora/IPL1-related protein kinase 2 | 1.82e-10 | 2.85e-03 | 4.42e-13 | NA |
| 4. PB | Q66H84 | MAP kinase-activated protein kinase 3 | 3.78e-09 | 6.25e-08 | 2.35e-11 | NA |
| 4. PB | P49071 | MAP kinase-activated protein kinase 2 | 3.03e-06 | 1.46e-07 | 4.06e-11 | NA |
| 4. PB | Q8R4U9 | Serine/threonine-protein kinase Sgk2 | 4.00e-09 | 2.84e-02 | 5.59e-11 | NA |
| 4. PB | Q7Y0B9 | Serine/threonine-protein kinase SAPK8 | 1.72e-07 | 2.40e-09 | 1.19e-14 | NA |
| 4. PB | P15735 | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform | 6.87e-09 | 1.32e-07 | 1.13e-14 | NA |
| 4. PB | Q9D411 | Testis-specific serine/threonine-protein kinase 4 | 5.37e-09 | 2.26e-06 | 7.45e-14 | NA |
| 4. PB | Q86Y07 | Serine/threonine-protein kinase VRK2 | 6.13e-05 | 1.22e-02 | 1.32e-05 | NA |
| 4. PB | Q7T0B1 | Serine/threonine-protein kinase 40 | 1.23e-07 | 2.97e-06 | 6.97e-06 | NA |
| 4. PB | Q96PN8 | Testis-specific serine/threonine-protein kinase 3 | 1.67e-15 | 3.22e-06 | 1.13e-12 | NA |
| 5. P | Q1QH29 | Homoserine kinase | 1.46e-02 | 3.18e-02 | NA | NA |
| 5. P | Q9SVZ0 | Non-functional pseudokinase ZRK6 | 3.45e-03 | 1.41e-03 | NA | NA |
| 5. P | P97343 | Serine/threonine-protein kinase Kist | 1.35e-05 | 2.95e-04 | NA | NA |
| 5. P | P20505 | B1 kinase | NA | 7.33e-07 | NA | NA |
| 5. P | P0C8F4 | Serine/threonine-protein kinase 1 | NA | 1.23e-03 | NA | NA |
| 5. P | P0C264 | Uncharacterized serine/threonine-protein kinase SBK3 | 1.45e-05 | 7.49e-15 | NA | NA |
| 5. P | P83098 | Putative serine/threonine-protein kinase STE20-like | 6.62e-10 | 3.59e-07 | NA | NA |
| 5. P | P16913 | B1 kinase | NA | 3.68e-07 | NA | NA |
| 5. P | Q2RPU7 | Homoserine kinase | 1.36e-02 | 4.54e-02 | NA | NA |
| 5. P | P22209 | Serine/threonine-protein kinase KIN3 | 1.15e-10 | 1.96e-09 | NA | NA |
| 5. P | P33800 | B1 kinase | NA | 3.85e-06 | NA | NA |
| 5. P | P21098 | Probable serine/threonine-protein kinase B12 | NA | 2.51e-04 | NA | NA |
| 5. P | Q8TAS1 | Serine/threonine-protein kinase Kist | 4.66e-06 | 2.76e-04 | NA | NA |
| 5. P | Q63285 | Serine/threonine-protein kinase Kist | 1.22e-05 | 2.25e-04 | NA | NA |
| 5. P | O80795 | Probable inactive receptor-like protein kinase At1g65250 | 9.48e-05 | 5.29e-08 | NA | NA |
| 5. P | P0C5K0 | Uncharacterized serine/threonine-protein kinase SBK3 | 8.68e-06 | 2.28e-12 | NA | NA |
| 5. P | O57252 | B1 kinase | NA | 9.36e-07 | NA | NA |
| 5. P | P42493 | Serine/threonine-protein kinase 1 | NA | 3.18e-03 | NA | NA |
| 5. P | O57259 | Probable serine/threonine-protein kinase B12 | NA | 3.77e-04 | NA | NA |
| 5. P | Q66640 | Probable inactive protein kinase 38 | NA | 1.87e-02 | NA | NA |
| 5. P | P34206 | Serine/threonine-protein kinase 1 | NA | 1.31e-04 | NA | NA |
| 5. P | P0C8F3 | Serine/threonine-protein kinase 1 | NA | 6.64e-03 | NA | NA |
| 5. P | P24362 | Probable serine/threonine-protein kinase B12 | NA | 5.63e-04 | NA | NA |
| 5. P | O64798 | Inactive serine/threonine-protein kinase ZRK12 | 7.81e-05 | 3.30e-15 | NA | NA |
| 5. P | Q7ZUS1 | Serine/threonine-protein kinase VRK1 | 3.64e-06 | 6.58e-08 | NA | NA |
| 5. P | P0C8F2 | Serine/threonine-protein kinase 1 | NA | 6.64e-03 | NA | NA |
| 5. P | Q758T2 | Serine/threonine-protein kinase ISR1 | 5.36e-07 | 1.53e-02 | NA | NA |
| 5. P | Q9J509 | Probable serine/threonine-protein kinase FPV226 | NA | 2.22e-05 | NA | NA |
| 5. P | Q09595 | Putative serine/threonine-protein kinase R03D7.5 | 4.14e-09 | 4.33e-06 | NA | NA |
| 5. P | Q95PZ9 | Serine/threonine-protein kinase spe-6 | 4.46e-08 | 8.18e-07 | NA | NA |
| 5. P | P37562 | Probable serine/threonine-protein kinase YabT | 1.82e-08 | 3.50e-19 | NA | NA |
| 5. P | A9HS91 | Homoserine kinase | 1.09e-02 | 3.34e-02 | NA | NA |
| 6. F | Q6CBZ0 | PAN2-PAN3 deadenylation complex subunit PAN3 | 2.39e-06 | NA | NA | 0.5555 |
| 6. F | Q40902 | Pollen receptor-like kinase 1 | 3.26e-04 | NA | NA | 0.5836 |
| 6. F | B7LTZ9 | Probable protein kinase UbiB | 5.28e-03 | NA | NA | 0.2988 |
| 6. F | Q561M0 | N-terminal kinase-like protein | 5.12e-03 | NA | NA | 0.5487 |
| 6. F | Q82UL3 | Homoserine kinase | 8.50e-03 | NA | NA | 0.3055 |
| 6. F | Q9PKP3 | Serine/threonine-protein kinase pkn1 | 3.22e-07 | NA | NA | 0.52 |
| 6. F | A0A0H3MBJ2 | Serine/threonine-protein kinase Pkn1 | 4.03e-06 | NA | NA | 0.5809 |
| 6. F | P0A3Y5 | Aminoglycoside 3'-phosphotransferase | 1.84e-02 | NA | NA | 0.4394 |
| 6. F | P14508 | Aminoglycoside 3'-phosphotransferase | 1.58e-02 | NA | NA | 0.4224 |
| 6. F | Q5R810 | Interleukin-1 receptor-associated kinase-like 2 | 1.98e-03 | NA | NA | 0.5407 |
| 6. F | O86560 | Probable kinase PglW | 1.04e-03 | NA | NA | 0.6475 |
| 6. F | B1XWR5 | Probable protein kinase UbiB | 4.51e-03 | NA | NA | 0.309 |
| 6. F | B4MR28 | Tyrosine-protein kinase-like otk | 1.76e-03 | NA | NA | 0.5161 |
| 6. F | P46197 | Atrial natriuretic peptide receptor 2 | 4.90e-05 | NA | NA | 0.6674 |
| 6. F | P73515 | Serine/threonine-protein kinase-like protein E | 2.79e-07 | NA | NA | 0.6025 |
| 6. F | Q28FH2 | N-terminal kinase-like protein | 5.17e-03 | NA | NA | 0.5285 |
| 6. F | A4PES0 | Wee1-like protein kinase 2 | 6.92e-07 | NA | NA | 0.5433 |
| 6. F | Q0VCE3 | Tribbles homolog 3 | 3.65e-09 | NA | NA | 0.6379 |
| 6. F | Q75BU9 | PAN2-PAN3 deadenylation complex subunit PAN3 | 7.67e-07 | NA | NA | 0.5247 |
| 6. F | C5BCA6 | Probable protein kinase UbiB | 9.63e-03 | NA | NA | 0.3156 |
| 6. F | Q61IS6 | Serine/threonine-protein kinase spk-1 | 1.00e-01 | NA | NA | 0.6687 |
| 6. F | Q8LPD9 | Phototropin | 5.81e-09 | NA | NA | 0.5621 |
| 6. F | Q45FA5 | Serine/threonine-protein kinase SRPK | 6.54e-06 | NA | NA | 0.537 |
| 6. F | P0A3Y6 | Aminoglycoside 3'-phosphotransferase | 2.57e-02 | NA | NA | 0.3574 |
| 6. F | O02740 | Retinal guanylyl cyclase 2 | 6.74e-04 | NA | NA | 0.7035 |
| 6. F | B1IW70 | Probable protein kinase UbiB | 5.08e-03 | NA | NA | 0.3112 |
| 6. F | A8WU31 | Serine/threonine-protein kinase VRK1 | 2.59e-06 | NA | NA | 0.5566 |
| 6. F | B7L998 | Probable protein kinase UbiB | 5.11e-03 | NA | NA | 0.2999 |
| 6. F | A8XQC7 | Receptor-type guanylate cyclase gcy-19 | 1.39e-04 | NA | NA | 0.5764 |
| 6. F | P0A6A2 | Probable protein kinase UbiB | 5.10e-03 | NA | NA | 0.3058 |
| 6. F | O19179 | Retinal guanylyl cyclase 1 | 2.30e-04 | NA | NA | 0.608 |
| 6. F | Q290N5 | Tyrosine-protein kinase-like otk | 5.05e-03 | NA | NA | 0.5292 |
| 6. F | A8WPG9 | Receptor-type guanylate cyclase gcy-4 | 4.25e-05 | NA | NA | 0.6127 |
| 6. F | Q32A13 | Probable protein kinase UbiB | 5.00e-03 | NA | NA | 0.3004 |
| 6. F | A1U669 | Probable protein kinase UbiB | 6.44e-03 | NA | NA | 0.3054 |
| 6. F | B8Y466 | SRSF protein kinase 3 | 4.20e-08 | NA | NA | 0.5351 |
| 6. F | Q4R793 | Serine/threonine kinase-like domain-containing protein STKLD1 | 9.38e-04 | NA | NA | 0.5111 |
| 6. F | P0DPS7 | Serine/threonine-protein kinase Pkn1 | 3.95e-06 | NA | NA | 0.5469 |
| 6. F | P16065 | Speract receptor | 1.25e-03 | NA | NA | 0.6118 |
| 6. F | P9WJK2 | Probable peptidoglycan biosynthesis protein MviN | 5.75e-04 | NA | NA | 0.5101 |
| 6. F | Q5RD27 | SRSF protein kinase 1 | 6.88e-03 | NA | NA | 0.3774 |
| 6. F | Q5RA67 | Ribosomal protein S6 kinase-like 1 | 3.76e-03 | NA | NA | 0.4642 |
| 6. F | P55203 | Retinal guanylyl cyclase 1 | 3.04e-04 | NA | NA | 0.6004 |
| 6. F | A0A509AIU5 | Inactive protein tyrosine kinase pTKL | 1.22e-01 | NA | NA | 0.4587 |
| 6. F | Q2YDN8 | Inactive serine/threonine-protein kinase VRK3 | 8.22e-06 | NA | NA | 0.5499 |
| 6. F | Q0P5I2 | Interleukin-1 receptor-associated kinase-like 2 | 1.27e-04 | NA | NA | 0.5658 |
| 6. F | Q822R1 | Serine/threonine-protein kinase pkn1 | 6.19e-05 | NA | NA | 0.5847 |
| 6. F | Q47592 | O-antigen chain terminator bifunctional methyltransferase/kinase WbdD | 9.05e-03 | NA | NA | 0.3719 |
| 6. F | P00553 | Aminoglycoside 3'-phosphotransferase | 2.89e-02 | NA | NA | 0.3457 |
| 6. F | Q0AHY7 | Homoserine kinase | 9.47e-03 | NA | NA | 0.3021 |
| 6. F | Q9UVG6 | Putative serine/threonine-protein kinase VPS15 | 2.47e-03 | NA | NA | 0.5576 |
| 6. F | Q9RAM6 | Homoserine kinase | 2.10e-02 | NA | NA | 0.2856 |
| 6. F | J7I4B7 | O-antigen chain terminator bifunctional methyltransferase/kinase WbdD | 1.01e-02 | NA | NA | 0.3994 |
| 6. F | O88037 | Probable SapB synthase | 7.08e-03 | NA | NA | 0.5117 |
| 6. F | P0C0K6 | Ephrin type-B receptor 6 | 8.04e-05 | NA | NA | 0.6422 |
| 6. F | Q7AJA5 | Serine/threonine-protein kinase pkn1 | 1.13e-05 | NA | NA | 0.5359 |
| 6. F | A6QLH6 | N-terminal kinase-like protein | 6.73e-03 | NA | NA | 0.5211 |
| 6. F | P11528 | Resact receptor | 7.05e-04 | NA | NA | 0.65 |
| 6. F | Q5R9I3 | Phosphoinositide 3-kinase regulatory subunit 4 | 1.92e-02 | NA | NA | 0.536 |
| 6. F | A6SUR4 | Homoserine kinase | 2.00e-02 | NA | NA | 0.3002 |
| 6. F | B2SX38 | Probable protein kinase UbiB | 7.39e-03 | NA | NA | 0.3126 |
| 7. B | Q80XP9 | Serine/threonine-protein kinase WNK3 | 5.77e-04 | NA | 6.57e-10 | NA |
| 7. B | Q8MQ70 | Homeodomain-interacting protein kinase 1 | 1.99e-06 | NA | 1.76e-06 | NA |
| 7. B | P0C5E2 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2 | 1.64e-04 | NA | 6.30e-09 | NA |
| 7. B | Q9FZ59 | Leucine-rich repeat receptor-like protein kinase PEPR2 | 1.62e-03 | NA | 3.52e-10 | NA |
| 7. B | P14681 | Mitogen-activated protein kinase KSS1 | 1.08e-08 | NA | 4.10e-17 | NA |
| 7. B | Q99JT2 | Serine/threonine-protein kinase 26 | 1.64e-07 | NA | 1.10e-07 | NA |
| 7. B | Q9LSX4 | Casein kinase 1-like protein 8 | 6.91e-08 | NA | 2.12e-08 | NA |
| 7. B | Q94CG0 | CBL-interacting serine/threonine-protein kinase 21 | 4.63e-09 | NA | 3.36e-17 | NA |
| 7. B | Q7JP68 | cAMP-dependent protein kinase, catalytic subunit-like | 6.93e-10 | NA | 2.21e-11 | NA |
| 7. B | Q9M1Z9 | Putative L-type lectin-domain containing receptor kinase V.8 | 1.34e-04 | NA | 3.42e-10 | NA |
| 7. B | Q9M8S2 | Receptor-like kinase LIP2 | 2.25e-05 | NA | 1.66e-08 | NA |
| 7. B | Q54H45 | Probable serine/threonine-protein kinase drkB | 8.68e-06 | NA | 8.81e-08 | NA |
| 7. B | Q12152 | Putative serine/threonine-protein kinase YPL150W | 5.68e-05 | NA | 1.16e-07 | NA |
| 7. B | Q91VJ4 | Serine/threonine-protein kinase 38 | 3.67e-06 | NA | 4.77e-11 | NA |
| 7. B | P05986 | cAMP-dependent protein kinase type 3 | 5.61e-10 | NA | 4.24e-11 | NA |
| 7. B | P35917 | Vascular endothelial growth factor receptor 3 | 9.21e-04 | NA | 5.66e-08 | NA |
| 7. B | P55204 | Heat-stable enterotoxin receptor | 3.62e-05 | NA | 0.023 | NA |
| 7. B | Q8BM85 | TBC domain-containing protein kinase-like protein | 4.04e-05 | NA | 2.49e-04 | NA |
| 7. B | Q67C40 | Mitogen-activated protein kinase 7 | 6.06e-07 | NA | 3.51e-11 | NA |
| 7. B | Q8TD19 | Serine/threonine-protein kinase Nek9 | 2.55e-05 | NA | 7.76e-09 | NA |
| 7. B | Q0E459 | Mitogen-activated protein kinase 13 | 1.39e-07 | NA | 3.41e-13 | NA |
| 7. B | Q8W4J2 | Mitogen-activated protein kinase 16 | 6.51e-07 | NA | 1.02e-15 | NA |
| 7. B | P22612 | cAMP-dependent protein kinase catalytic subunit gamma | 1.28e-14 | NA | 6.32e-11 | NA |
| 7. B | Q01621 | Proto-oncogene tyrosine-protein kinase LCK | 1.45e-08 | NA | 1.36e-09 | NA |
| 7. B | Q6H7D2 | L-type lectin-domain containing receptor kinase SIT1 | 1.45e-04 | NA | 3.73e-08 | NA |
| 7. B | Q0D847 | Probable serine/threonine-protein kinase WNK3 | 8.31e-06 | NA | 2.32e-05 | NA |
| 7. B | Q5AP53 | Serine/threonine-protein kinase CBK1 | 1.02e-05 | NA | 2.92e-11 | NA |
| 7. B | A0A075F7E9 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK1 | 1.81e-04 | NA | 2.04e-09 | NA |
| 7. B | Q18846 | Putative ribosomal protein S6 kinase alpha-2 | 1.66e-06 | NA | 1.04e-15 | NA |
| 7. B | Q86HG9 | Probable serine/threonine-protein kinase DDB_G0271682 | 1.12e-04 | NA | 1.35e-07 | NA |
| 7. B | Q16288 | NT-3 growth factor receptor | 1.24e-08 | NA | 1.09e-06 | NA |
| 7. B | P07332 | Tyrosine-protein kinase Fes/Fps | 2.50e-08 | NA | 1.94e-12 | NA |
| 7. B | Q03042 | cGMP-dependent protein kinase, isozyme 1 | 2.72e-09 | NA | 6.38e-06 | NA |
| 7. B | Q8JH47 | Cyclin-dependent kinase 8 | 9.90e-05 | NA | 1.49e-05 | NA |
| 7. B | Q9EQY0 | Serine/threonine-protein kinase/endoribonuclease IRE1 | 2.80e-03 | NA | 1.10e-07 | NA |
| 7. B | Q55FT4 | Probable serine/threonine-protein kinase tsuA | 5.26e-03 | NA | 7.98e-17 | NA |
| 7. B | O76411 | ALK tyrosine kinase receptor homolog scd-2 | 9.39e-04 | NA | 4.70e-05 | NA |
| 7. B | Q2QY53 | CBL-interacting protein kinase 32 | 6.02e-09 | NA | 9.99e-19 | NA |
| 7. B | Q9LYN8 | Leucine-rich repeat receptor protein kinase EMS1 | 3.64e-03 | NA | 3.03e-08 | NA |
| 7. B | Q00342 | Receptor-type tyrosine-protein kinase FLT3 | 1.90e-06 | NA | 4.02e-07 | NA |
| 7. B | Q9FN92 | Probable receptor-like protein kinase At5g59700 | 1.54e-03 | NA | 3.98e-11 | NA |
| 7. B | A5PKJ4 | Mitogen-activated protein kinase 7 | 5.38e-06 | NA | 3.59e-12 | NA |
| 7. B | P70335 | Rho-associated protein kinase 1 | 4.95e-04 | NA | 1.35e-12 | NA |
| 7. B | O80623 | Probable receptor-like protein kinase At2g39360 | 5.17e-04 | NA | 2.77e-08 | NA |
| 7. B | P32328 | Serine/threonine-protein kinase DBF20 | 3.11e-05 | NA | 3.23e-04 | NA |
| 7. B | Q6XHA5 | Probable serine/threonine-protein kinase roco11 | 2.25e-03 | NA | 1.82e-06 | NA |
| 7. B | Q54RB7 | Dual specificity protein kinase shkA | 5.55e-07 | NA | 6.99e-09 | NA |
| 7. B | Q54C18 | Probable serine/threonine-protein kinase DDB_G0293276 | 3.49e-11 | NA | 1.96e-11 | NA |
| 7. B | Q9U9Y8 | Serine/threonine kinase NLK | 3.95e-05 | NA | 7.02e-11 | NA |
| 7. B | Q9ZUI0 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 | 2.65e-03 | NA | 1.66e-05 | NA |
| 7. B | Q9WUN2 | Serine/threonine-protein kinase TBK1 | 2.65e-07 | NA | 4.68e-10 | NA |
| 7. B | P35916 | Vascular endothelial growth factor receptor 3 | 4.43e-04 | NA | 2.19e-08 | NA |
| 7. B | Q54IP4 | Dual specificity protein kinase shkB | 1.53e-05 | NA | 1.57e-08 | NA |
| 7. B | Q54I36 | Dual specificity protein kinase pyk3 | 1.02e-03 | NA | 2.01e-09 | NA |
| 7. B | P35969 | Vascular endothelial growth factor receptor 1 | 3.21e-05 | NA | 1.35e-08 | NA |
| 7. B | Q12706 | Serine/threonine-protein kinase psk1 | 1.57e-08 | NA | 1.75e-09 | NA |
| 7. B | Q10407 | MAP kinase kinase kinase mkh1 | 2.72e-04 | NA | 7.40e-10 | NA |
| 7. B | Q69Q47 | CBL-interacting protein kinase 24 | 7.37e-10 | NA | 2.24e-19 | NA |
| 7. B | Q12100 | Probable serine/threonine-protein kinase RTK1 | 2.29e-05 | NA | 8.33e-06 | NA |
| 7. B | Q96J92 | Serine/threonine-protein kinase WNK4 | 4.22e-05 | NA | 5.77e-07 | NA |
| 7. B | Q9ST27 | Phototropin-2 | 3.59e-06 | NA | 3.01e-06 | NA |
| 7. B | C0LGG9 | Probable LRR receptor-like serine/threonine-protein kinase At1g53440 | 1.36e-03 | NA | 3.97e-08 | NA |
| 7. B | P97924 | Kalirin | NA | NA | 1.04e-09 | NA |
| 7. B | B3NS99 | Tyrosine-protein kinase-like otk | 1.65e-03 | NA | 0.002 | NA |
| 7. B | P33497 | Tyrosine-protein kinase transforming protein RYK | NA | NA | 2.09e-05 | NA |
| 7. B | Q6L5D4 | Mitogen-activated protein kinase 9 | 4.42e-05 | NA | 8.96e-14 | NA |
| 7. B | Q00993 | Tyrosine-protein kinase receptor UFO | 7.09e-08 | NA | 1.51e-06 | NA |
| 7. B | P49841 | Glycogen synthase kinase-3 beta | 2.54e-07 | NA | 1.15e-05 | NA |
| 7. B | Q8RWC9 | CBL-interacting serine/threonine-protein kinase 1 | 7.69e-09 | NA | 6.35e-18 | NA |
| 7. B | Q4KM34 | Cyclin-dependent kinase 20 | 2.92e-09 | NA | 1.27e-18 | NA |
| 7. B | Q7TPK6 | Serine/threonine-protein kinase WNK4 | 4.24e-05 | NA | 2.25e-07 | NA |
| 7. B | Q3UHC2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 3.57e-02 | NA | 5.30e-06 | NA |
| 7. B | Q16620 | BDNF/NT-3 growth factors receptor | 1.84e-08 | NA | 9.43e-09 | NA |
| 7. B | Q6L5F7 | Mitogen-activated protein kinase 17 | 5.99e-06 | NA | 4.13e-14 | NA |
| 7. B | Q9NR20 | Dual specificity tyrosine-phosphorylation-regulated kinase 4 | 7.93e-09 | NA | 2.83e-08 | NA |
| 7. B | Q9ZVR7 | Phytosulfokine receptor 1 | 1.06e-03 | NA | 1.91e-09 | NA |
| 7. B | O75460 | Serine/threonine-protein kinase/endoribonuclease IRE1 | 1.27e-03 | NA | 1.79e-07 | NA |
| 7. B | Q9M020 | Lectin-domain containing receptor kinase VI.3 | 3.26e-04 | NA | 6.40e-08 | NA |
| 7. B | O64817 | Casein kinase II subunit alpha-3 | 2.11e-08 | NA | 1.20e-04 | NA |
| 7. B | P53668 | LIM domain kinase 1 | 1.44e-07 | NA | 3.74e-04 | NA |
| 7. B | O08874 | Serine/threonine-protein kinase N2 | 4.44e-05 | NA | 2.29e-08 | NA |
| 7. B | O64783 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370 | 3.59e-04 | NA | 7.21e-06 | NA |
| 7. B | Q9FL28 | LRR receptor-like serine/threonine-protein kinase FLS2 | 4.50e-03 | NA | 2.89e-08 | NA |
| 7. B | Q9FF29 | PR5-like receptor kinase | 4.04e-04 | NA | 3.47e-10 | NA |
| 7. B | Q9SSL9 | Leucine-rich repeat receptor-like protein kinase PEPR1 | 6.71e-03 | NA | 1.68e-07 | NA |
| 7. B | O75385 | Serine/threonine-protein kinase ULK1 | 2.86e-05 | NA | 3.66e-19 | NA |
| 7. B | Q9ASQ5 | Calmodulin-binding receptor-like cytoplasmic kinase 3 | 5.98e-06 | NA | 1.54e-13 | NA |
| 7. B | Q8VYG0 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3 | 5.28e-05 | NA | 8.82e-11 | NA |
| 7. B | Q9S9V0 | Calcium-dependent protein kinase 31 | 2.99e-08 | NA | 2.70e-10 | NA |
| 7. B | Q7T6Y2 | Putative serine/threonine-protein kinase/receptor R831 | NA | NA | 9.49e-14 | NA |
| 7. B | Q9WTR2 | Mitogen-activated protein kinase kinase kinase 6 | 2.98e-03 | NA | 3.00e-11 | NA |
| 7. B | Q94E49 | Protein kinase PINOID 2 | 5.44e-06 | NA | 4.97e-05 | NA |
| 7. B | Q08732 | Serine/threonine-protein kinase HRK1 | 1.09e-05 | NA | 2.38e-04 | NA |
| 7. B | P31938 | Dual specificity mitogen-activated protein kinase kinase 1 | 3.81e-09 | NA | 3.65e-09 | NA |
| 7. B | O88866 | Hormonally up-regulated neu tumor-associated kinase | 1.66e-06 | NA | 2.08e-18 | NA |
| 7. B | O80939 | L-type lectin-domain containing receptor kinase IV.1 | 2.84e-04 | NA | 7.78e-09 | NA |
| 7. B | P0C8E4 | Mitogen-activated protein kinase kinase kinase 7 | 1.69e-06 | NA | 2.87e-11 | NA |
| 7. B | Q2H6X2 | Serine/threonine-protein kinase ATG1 | 5.33e-06 | NA | 8.12e-08 | NA |
| 7. B | Q810W7 | Microtubule-associated serine/threonine-protein kinase 1 | 1.28e-03 | NA | 8.02e-16 | NA |
| 7. B | P00524 | Tyrosine-protein kinase transforming protein Src | NA | NA | 6.62e-09 | NA |
| 7. B | Q01986 | Dual specificity mitogen-activated protein kinase kinase 1 | 8.19e-14 | NA | 3.40e-09 | NA |
| 7. B | Q9NYV4 | Cyclin-dependent kinase 12 | 3.25e-03 | NA | 4.61e-07 | NA |
| 7. B | Q9SIQ7 | Calcium-dependent protein kinase 24 | 2.06e-07 | NA | 1.69e-11 | NA |
| 7. B | Q6P4S6 | Serine/threonine-protein kinase SIK3 | 2.30e-04 | NA | 1.19e-12 | NA |
| 7. B | Q05438 | Bone morphogenetic protein receptor type-1B | 1.97e-10 | NA | 3.02e-04 | NA |
| 7. B | Q8GXZ3 | Probable serine/threonine-protein kinase PBL8 | 1.90e-05 | NA | 2.63e-13 | NA |
| 7. B | P38938 | Serine/threonine-protein kinase cek1 | 1.66e-03 | NA | 2.75e-12 | NA |
| 7. B | Q8NCB2 | CaM kinase-like vesicle-associated protein | 9.68e-10 | NA | 2.00e-07 | NA |
| 7. B | C0LGX1 | Probable LRR receptor-like serine/threonine-protein kinase At5g65240 | 5.84e-05 | NA | 9.54e-07 | NA |
| 7. B | Q9BWU1 | Cyclin-dependent kinase 19 | 1.45e-05 | NA | 2.81e-05 | NA |
| 7. B | Q08466 | Casein kinase II subunit alpha-2 | 1.58e-06 | NA | 3.22e-05 | NA |
| 7. B | Q9SW11 | U-box domain-containing protein 35 | 3.99e-04 | NA | 0.001 | NA |
| 7. B | Q05655 | Protein kinase C delta type | 2.50e-06 | NA | 7.26e-12 | NA |
| 7. B | Q8LPZ7 | Calcium-dependent protein kinase 3 | 2.40e-09 | NA | 3.94e-17 | NA |
| 7. B | Q922R0 | cAMP-dependent protein kinase catalytic subunit PRKX | 1.40e-14 | NA | 2.69e-08 | NA |
| 7. B | G5EFU0 | Serine/threonine-protein kinase pak-2 | 9.76e-08 | NA | 6.76e-10 | NA |
| 7. B | Q9LY03 | Probable LRR receptor-like serine/threonine-protein kinase IRK | 4.36e-04 | NA | 1.36e-08 | NA |
| 7. B | Q10364 | Serine/threonine-protein kinase sck2 | 9.47e-07 | NA | 0.004 | NA |
| 7. B | Q54DC8 | Probable serine/threonine-protein kinase DDB_G0292350 | 2.51e-04 | NA | 4.04e-12 | NA |
| 7. B | Q54DF2 | Probable serine/threonine-protein kinase MARK-A | 5.81e-06 | NA | 3.75e-12 | NA |
| 7. B | P30290 | Mitosis inhibitor protein kinase mik1 | 1.09e-07 | NA | 4.10e-10 | NA |
| 7. B | Q86UE8 | Serine/threonine-protein kinase tousled-like 2 | 1.47e-09 | NA | 1.27e-14 | NA |
| 7. B | Q9CAL8 | Proline-rich receptor-like protein kinase PERK13 | 1.15e-04 | NA | 2.74e-07 | NA |
| 7. B | P31693 | Tyrosine-protein kinase transforming protein Src | NA | NA | 2.47e-09 | NA |
| 7. B | Q9SNA3 | Putative receptor-like protein kinase At3g46340 | 2.81e-04 | NA | 4.76e-09 | NA |
| 7. B | P06242 | Serine/threonine-protein kinase KIN28 | 4.22e-15 | NA | 6.74e-09 | NA |
| 7. B | Q9M6A7 | Leucine-rich repeat receptor-like kinase protein CLV1B | 1.49e-03 | NA | 3.95e-05 | NA |
| 7. B | Q16659 | Mitogen-activated protein kinase 6 | 4.58e-07 | NA | 1.74e-13 | NA |
| 7. B | Q6DBX4 | Serine/threonine-protein kinase greatwall | 1.10e-02 | NA | 2.16e-09 | NA |
| 7. B | P36897 | TGF-beta receptor type-1 | 2.25e-10 | NA | 0.001 | NA |
| 7. B | P16066 | Atrial natriuretic peptide receptor 1 | 4.42e-04 | NA | 0.003 | NA |
| 7. B | Q944Q0 | Serine/threonine-protein kinase WNK8 | 2.33e-06 | NA | 5.14e-08 | NA |
| 7. B | Q8VYY5 | Receptor-like serine/threonine-protein kinase NCRK | 5.35e-05 | NA | 3.51e-05 | NA |
| 7. B | P38990 | SNF1-activating kinase 1 | 2.71e-04 | NA | 4.19e-09 | NA |
| 7. B | Q09639 | G protein-coupled receptor kinase 2 | 1.62e-06 | NA | 7.75e-17 | NA |
| 7. B | G5ECP4 | Pelle-like serine/threonine-protein kinase pik-1 | 2.43e-06 | NA | 1.77e-04 | NA |
| 7. B | P00522 | Tyrosine-protein kinase Abl | 2.85e-03 | NA | 1.62e-09 | NA |
| 7. B | Q9SCT4 | Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 | 1.54e-03 | NA | 3.83e-07 | NA |
| 7. B | Q8W4G6 | Cysteine-rich receptor-like protein kinase 15 | 3.07e-05 | NA | 4.71e-08 | NA |
| 7. B | P39746 | Dual specificity mitogen-activated protein kinase kinase 3 (Fragment) | 1.15e-02 | NA | 6.23e-06 | NA |
| 7. B | Q03146 | Epithelial discoidin domain-containing receptor 1 | 4.07e-05 | NA | 7.66e-07 | NA |
| 7. B | Q9M9V8 | Calcium-dependent protein kinase 10 | 1.87e-08 | NA | 1.09e-10 | NA |
| 7. B | Q8RXY0 | Probable inactive protein kinase At3g63330 | 1.34e-04 | NA | 8.26e-07 | NA |
| 7. B | P32350 | Dual specificity protein kinase KNS1 | 1.47e-04 | NA | 5.78e-05 | NA |
| 7. B | Q8S8S7 | U-box domain-containing protein 34 | 1.71e-03 | NA | 1.24e-06 | NA |
| 7. B | Q6FQ83 | Serine/threonine-protein kinase BUR1 | 1.11e-05 | NA | 3.09e-04 | NA |
| 7. B | Q501V0 | Serine/threonine-protein kinase H1 homolog | 4.72e-08 | NA | 1.99e-12 | NA |
| 7. B | Q9S713 | Serine/threonine-protein kinase STN7, chloroplastic | 2.74e-05 | NA | 6.12e-04 | NA |
| 7. B | Q54TA3 | Probable serine/threonine-protein kinase MARK-C | 8.96e-07 | NA | 4.49e-14 | NA |
| 7. B | P54759 | Ephrin type-A receptor 7 | 1.49e-04 | NA | 7.33e-13 | NA |
| 7. B | Q9LMP1 | Wall-associated receptor kinase 2 | 7.63e-05 | NA | 5.22e-08 | NA |
| 7. B | Q9C5C0 | Mitogen-activated protein kinase 18 | 8.13e-05 | NA | 2.98e-14 | NA |
| 7. B | P35590 | Tyrosine-protein kinase receptor Tie-1 | 6.24e-05 | NA | 1.10e-04 | NA |
| 7. B | Q9SFB6 | MAP3K epsilon protein kinase 2 | 7.85e-04 | NA | 1.32e-15 | NA |
| 7. B | O64782 | G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29 | 1.86e-03 | NA | 2.30e-06 | NA |
| 7. B | O61125 | Serine/threonine-protein kinase 4 homolog A | 5.86e-09 | NA | 1.13e-12 | NA |
| 7. B | Q9LPZ3 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410 | 8.66e-04 | NA | 1.90e-06 | NA |
| 7. B | Q9Y7W4 | Serine/threonine-protein kinase BUR1 | 3.91e-05 | NA | 6.01e-10 | NA |
| 7. B | P18161 | Dual specificity protein kinase splB | 1.39e-04 | NA | 2.69e-06 | NA |
| 7. B | P9WI73 | Serine/threonine-protein kinase PknG | 5.51e-05 | NA | 7.78e-04 | NA |
| 7. B | Q9VWQ2 | Serine/threonine-protein kinase S6KL | 1.19e-06 | NA | 4.11e-10 | NA |
| 7. B | Q54Y55 | Dual specificity protein kinase shkC | 8.27e-08 | NA | 1.04e-12 | NA |
| 7. B | Q59KM8 | Cell cycle protein kinase DBF2 | 8.98e-05 | NA | 2.10e-04 | NA |
| 7. B | Q9LET1 | CDPK-related kinase 7 | 6.69e-08 | NA | 9.69e-15 | NA |
| 7. B | D7SFH9 | Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4 | 5.84e-03 | NA | 9.32e-07 | NA |
| 7. B | A2ASS6 | Titin | NA | NA | 2.63e-12 | NA |
| 7. B | Q99MK8 | Beta-adrenergic receptor kinase 1 | 1.59e-06 | NA | 6.37e-15 | NA |
| 7. B | Q1PEM5 | Proline-rich receptor-like protein kinase PERK3 | 1.18e-05 | NA | 7.51e-09 | NA |
| 7. B | O43353 | Receptor-interacting serine/threonine-protein kinase 2 | 3.40e-09 | NA | 3.41e-05 | NA |
| 7. B | P45985 | Dual specificity mitogen-activated protein kinase kinase 4 | 2.28e-09 | NA | 2.36e-11 | NA |
| 7. B | P49186 | Mitogen-activated protein kinase 9 | 6.88e-06 | NA | 8.03e-16 | NA |
| 7. B | Q9FN37 | Phytosulfokine receptor 2 | 1.13e-03 | NA | 7.61e-09 | NA |
| 7. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 6.21e-04 | NA |
| 7. B | Q6X4A2 | CBL-interacting protein kinase 31 | 9.03e-09 | NA | 1.22e-17 | NA |
| 7. B | Q9LW83 | G-type lectin S-receptor-like serine/threonine-protein kinase CES101 | 2.59e-04 | NA | 9.17e-10 | NA |
| 7. B | Q9ZP16 | Cysteine-rich receptor-like protein kinase 11 | 7.38e-04 | NA | 1.66e-07 | NA |
| 7. B | Q9Z1J2 | Serine/threonine-protein kinase Nek4 | 2.85e-07 | NA | 3.25e-15 | NA |
| 7. B | P22455 | Fibroblast growth factor receptor 4 | 5.81e-05 | NA | 3.44e-09 | NA |
| 7. B | Q9LY50 | Putative serine/threonine-protein kinase-like protein CCR3 | 2.38e-04 | NA | 2.37e-06 | NA |
| 7. B | G5EGQ3 | Serine/threonine-protein kinase max-2 | 9.88e-06 | NA | 6.07e-08 | NA |
| 7. B | P97820 | Mitogen-activated protein kinase kinase kinase kinase 4 | 2.45e-04 | NA | 1.69e-10 | NA |
| 7. B | P29322 | Ephrin type-A receptor 8 | 1.37e-04 | NA | 1.33e-16 | NA |
| 7. B | Q9FIM9 | CDPK-related kinase 4 | 7.39e-08 | NA | 1.69e-16 | NA |
| 7. B | Q60670 | Serine/threonine-protein kinase SIK1 | 3.59e-06 | NA | 7.46e-11 | NA |
| 7. B | Q9NRP7 | Serine/threonine-protein kinase 36 | 2.11e-04 | NA | 3.02e-10 | NA |
| 7. B | P51954 | Serine/threonine-protein kinase Nek1 | 2.89e-06 | NA | 4.85e-19 | NA |
| 7. B | Q39010 | Shaggy-related protein kinase zeta | 7.26e-08 | NA | 5.46e-06 | NA |
| 7. B | P9WI69 | Serine/threonine-protein kinase PknI | 7.55e-08 | NA | 1.69e-08 | NA |
| 7. B | O64793 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 | 1.47e-07 | NA | 1.53e-08 | NA |
| 7. B | Q9LJD8 | MAP3K epsilon protein kinase 1 | 7.25e-04 | NA | 1.09e-15 | NA |
| 7. B | P50528 | Serine/threonine-protein kinase plo1 | 5.69e-07 | NA | 2.64e-19 | NA |
| 7. B | Q9H4B4 | Serine/threonine-protein kinase PLK3 | 6.83e-06 | NA | 9.96e-16 | NA |
| 7. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 6.24e-07 | NA |
| 7. B | P80202 | Activin receptor type-1B | 3.06e-10 | NA | 8.46e-04 | NA |
| 7. B | Q9LP51 | CBL-interacting serine/threonine-protein kinase 18 | 4.41e-07 | NA | 8.32e-18 | NA |
| 7. B | C0LGV1 | LRR receptor-like serine/threonine-protein kinase RGI2 | 3.22e-03 | NA | 1.54e-06 | NA |
| 7. B | Q6GM53 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 8.31e-06 | NA | 7.11e-10 | NA |
| 7. B | Q05512 | Serine/threonine-protein kinase MARK2 | 4.99e-06 | NA | 5.35e-15 | NA |
| 7. B | Q9M345 | L-type lectin-domain containing receptor kinase IV.2 | 2.44e-04 | NA | 9.99e-09 | NA |
| 7. B | Q9Y463 | Dual specificity tyrosine-phosphorylation-regulated kinase 1B | 3.32e-07 | NA | 2.22e-07 | NA |
| 7. B | P24583 | Protein kinase C-like 1 | 3.05e-05 | NA | 2.68e-12 | NA |
| 7. B | Q62137 | Tyrosine-protein kinase JAK3 | 2.90e-04 | NA | 1.55e-09 | NA |
| 7. B | Q68Y49 | CBL-interacting protein kinase 19 | 5.72e-07 | NA | 1.27e-18 | NA |
| 7. B | P92208 | Stress-activated protein kinase JNK | 3.72e-06 | NA | 1.73e-14 | NA |
| 7. B | Q20347 | MAP kinase kinase mkk-4 | 2.15e-10 | NA | 7.48e-11 | NA |
| 7. B | Q6PHZ2 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 3.76e-08 | NA | 2.10e-15 | NA |
| 7. B | Q8NE63 | Homeodomain-interacting protein kinase 4 | 3.32e-06 | NA | 1.29e-04 | NA |
| 7. B | Q2QYM3 | CBL-interacting protein kinase 14 | 9.42e-09 | NA | 9.04e-21 | NA |
| 7. B | Q96287 | Shaggy-related protein kinase theta | 8.03e-07 | NA | 8.10e-07 | NA |
| 7. B | Q8IVH8 | Mitogen-activated protein kinase kinase kinase kinase 3 | 1.20e-04 | NA | 1.64e-13 | NA |
| 7. B | Q5Z7J0 | Shaggy-related protein kinase GSK4 | 1.83e-07 | NA | 1.93e-07 | NA |
| 7. B | Q10SC8 | CBL-interacting protein kinase 9 | 1.00e-07 | NA | 5.92e-19 | NA |
| 7. B | Q6ZWH5 | Serine/threonine-protein kinase Nek10 | 5.07e-06 | NA | 2.50e-16 | NA |
| 7. B | Q9LMB9 | Cysteine-rich receptor-like protein kinase 1 | 1.93e-05 | NA | 1.36e-09 | NA |
| 7. B | Q3U214 | Microtubule-associated serine/threonine-protein kinase 3 | 1.32e-03 | NA | 2.65e-16 | NA |
| 7. B | Q06187 | Tyrosine-protein kinase BTK | 3.20e-10 | NA | 8.96e-08 | NA |
| 7. B | Q7FAZ2 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2 | 1.94e-04 | NA | 4.24e-10 | NA |
| 7. B | Q95ZV7 | Discoidin domain-containing receptor tyrosine kinase B | 1.18e-05 | NA | 1.69e-07 | NA |
| 7. B | Q7F8Q9 | Leucine-rich repeat receptor protein kinase MSL1 | 2.18e-02 | NA | 5.90e-08 | NA |
| 7. B | Q54Y06 | Probable cyclin-dependent serine/threonine-protein kinase DDB_G0278487 | 4.30e-07 | NA | 6.13e-08 | NA |
| 7. B | Q08881 | Tyrosine-protein kinase ITK/TSK | 1.61e-11 | NA | 3.01e-11 | NA |
| 7. B | O60674 | Tyrosine-protein kinase JAK2 | 1.21e-03 | NA | 5.07e-10 | NA |
| 7. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 4.56e-06 | NA | 2.08e-08 | NA |
| 7. B | Q9LJF3 | Receptor-like protein kinase BRI1-like 3 | 5.18e-03 | NA | 3.53e-11 | NA |
| 7. B | Q8R4V0 | Serine/threonine-protein kinase Sgk3 | 5.78e-08 | NA | 5.90e-10 | NA |
| 7. B | Q9GT24 | Probable serine/threonine-protein kinase zyg-1 | 2.32e-03 | NA | 1.07e-14 | NA |
| 7. B | P20794 | Serine/threonine-protein kinase MAK | 5.27e-08 | NA | 4.23e-08 | NA |
| 7. B | Q9SYS7 | Putative cysteine-rich receptor-like protein kinase 39 | 6.44e-05 | NA | 3.24e-08 | NA |
| 7. B | A0JM20 | Tyrosine-protein kinase receptor TYRO3 | 1.04e-07 | NA | 5.28e-06 | NA |
| 7. B | Q54IH8 | Probable serine/threonine-protein kinase ndrB | 6.46e-05 | NA | 2.99e-11 | NA |
| 7. B | P15127 | Insulin receptor | 4.78e-03 | NA | 1.33e-09 | NA |
| 7. B | Q63932 | Dual specificity mitogen-activated protein kinase kinase 2 | 4.41e-09 | NA | 5.12e-08 | NA |
| 7. B | O45539 | Tyrosine protein-kinase src-2 | 1.31e-12 | NA | 4.64e-07 | NA |
| 7. B | Q06805 | Tyrosine-protein kinase receptor Tie-1 | 4.84e-05 | NA | 1.10e-04 | NA |
| 7. B | P00541 | Tyrosine-protein kinase transforming protein Fps | NA | NA | 2.77e-13 | NA |
| 7. B | Q5WA76 | U-box domain-containing protein 70 | 1.00e-03 | NA | 4.51e-06 | NA |
| 7. B | Q8MY86 | Fibroblast growth factor receptor 1 | 4.15e-06 | NA | 4.32e-07 | NA |
| 7. B | Q9C562 | CBL-interacting serine/threonine-protein kinase 10 | 1.72e-08 | NA | 1.26e-18 | NA |
| 7. B | P42679 | Megakaryocyte-associated tyrosine-protein kinase | 1.46e-11 | NA | 7.44e-12 | NA |
| 7. B | Q5RKH1 | Serine/threonine-protein kinase PRP4 homolog | 1.49e-07 | NA | 5.13e-08 | NA |
| 7. B | Q8NE28 | Serine/threonine kinase-like domain-containing protein STKLD1 | 1.35e-04 | NA | 0.017 | NA |
| 7. B | O88850 | Homeodomain-interacting protein kinase 3 | 4.22e-05 | NA | 1.99e-06 | NA |
| 7. B | Q13153 | Serine/threonine-protein kinase PAK 1 | 2.57e-07 | NA | 1.30e-12 | NA |
| 7. B | F1LM93 | Tyrosine-protein kinase Yes | 4.31e-11 | NA | 5.56e-06 | NA |
| 7. B | Q6CVA2 | Serine/threonine-protein kinase STE20 | 2.24e-06 | NA | 1.05e-11 | NA |
| 7. B | Q5VQQ5 | Calcium-dependent protein kinase 2 | 3.20e-10 | NA | 6.70e-11 | NA |
| 7. B | Q09092 | Putative serine/threonine-protein kinase receptor | 2.78e-03 | NA | 3.66e-05 | NA |
| 7. B | Q84TI6 | Cyclin-dependent kinase E-1 | 1.24e-10 | NA | 5.57e-08 | NA |
| 7. B | P54758 | Ephrin type-A receptor 6 | 1.79e-04 | NA | 4.29e-08 | NA |
| 7. B | Q63686 | Cyclin-dependent kinase 16 | 1.10e-11 | NA | 2.52e-12 | NA |
| 7. B | Q924U5 | Dual specificity testis-specific protein kinase 2 | 8.91e-06 | NA | 0.040 | NA |
| 7. B | Q9WTQ1 | Serine/threonine-protein kinase D1 | 5.03e-04 | NA | 1.49e-10 | NA |
| 7. B | G5EDB2 | Probable dual specificity protein kinase madd-3 | 7.12e-06 | NA | 7.16e-11 | NA |
| 7. B | P14085 | Tyrosine-protein kinase transforming protein Src | NA | NA | 2.92e-08 | NA |
| 7. B | A7TGR2 | Probable serine/threonine-protein kinase HAL5-like | 3.38e-04 | NA | 4.59e-07 | NA |
| 7. B | P59895 | Serine/threonine-protein kinase Nek6 | 1.11e-16 | NA | 7.70e-20 | NA |
| 7. B | P38692 | Serine/threonine-protein kinase KIC1 | 9.77e-06 | NA | 3.38e-16 | NA |
| 7. B | Q9QYZ3 | Sperm motility kinase 2B | 8.45e-08 | NA | 3.63e-10 | NA |
| 7. B | O13148 | Ephrin type-A receptor 4a (Fragment) | 2.35e-09 | NA | 2.54e-10 | NA |
| 7. B | P41240 | Tyrosine-protein kinase CSK | 3.27e-08 | NA | 4.74e-10 | NA |
| 7. B | P05771 | Protein kinase C beta type | 1.50e-07 | NA | 1.01e-08 | NA |
| 7. B | Q7XUF4 | Cyclin-dependent kinase G-2 | 3.22e-06 | NA | 1.01e-12 | NA |
| 7. B | Q99ML2 | Non-receptor tyrosine-protein kinase TNK1 | 3.26e-06 | NA | 1.11e-08 | NA |
| 7. B | O42900 | Serine/threonine-protein kinase ppk19 | 4.41e-03 | NA | 0.007 | NA |
| 7. B | Q15375 | Ephrin type-A receptor 7 | 2.99e-04 | NA | 6.82e-13 | NA |
| 7. B | Q9XTR1 | Cyclin-dependent kinase 4 homolog | 7.82e-13 | NA | 1.07e-08 | NA |
| 7. B | O45797 | Serine/threonine-protein kinase WARTS homolog | 1.38e-05 | NA | 4.99e-05 | NA |
| 7. B | P21709 | Ephrin type-A receptor 1 | 2.86e-04 | NA | 5.40e-09 | NA |
| 7. B | P90866 | Cyclin-dependent kinase 8 | 1.96e-04 | NA | 1.08e-06 | NA |
| 7. B | Q9SCS2 | CDPK-related kinase 5 | 1.45e-06 | NA | 1.24e-13 | NA |
| 7. B | P20444 | Protein kinase C alpha type | 3.23e-06 | NA | 1.53e-10 | NA |
| 7. B | Q23977 | Dual specificity mitogen-activated protein kinase kinase hemipterous | 2.47e-04 | NA | 4.30e-12 | NA |
| 7. B | Q9LZM4 | Wall-associated receptor kinase-like 20 | 4.36e-05 | NA | 8.79e-08 | NA |
| 7. B | Q94CU5 | Serine/threonine-protein kinase Nek5 | 3.43e-05 | NA | 5.56e-17 | NA |
| 7. B | P42680 | Tyrosine-protein kinase Tec | 1.19e-10 | NA | 1.89e-10 | NA |
| 7. B | Q90ZY6 | Serine/threonine-protein kinase tousled-like 1-B | 1.12e-09 | NA | 5.21e-12 | NA |
| 7. B | O43293 | Death-associated protein kinase 3 | 2.48e-09 | NA | 1.70e-15 | NA |
| 7. B | P49025 | Citron Rho-interacting kinase | 1.24e-03 | NA | 2.14e-14 | NA |
| 7. B | O75116 | Rho-associated protein kinase 2 | 7.28e-04 | NA | 1.87e-13 | NA |
| 7. B | Q15759 | Mitogen-activated protein kinase 11 | 7.18e-08 | NA | 1.95e-16 | NA |
| 7. B | Q8CE90 | Dual specificity mitogen-activated protein kinase kinase 7 | 3.18e-08 | NA | 5.33e-13 | NA |
| 7. B | O64556 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 | 4.76e-04 | NA | 1.54e-13 | NA |
| 7. B | P63318 | Protein kinase C gamma type | 2.69e-05 | NA | 3.08e-09 | NA |
| 7. B | Q2NL51 | Glycogen synthase kinase-3 alpha | 8.42e-07 | NA | 4.19e-06 | NA |
| 7. B | Q4FZD7 | Inactive serine/threonine-protein kinase PLK5 | 1.26e-06 | NA | 1.22e-16 | NA |
| 7. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 4.73e-02 | NA | 0.030 | NA |
| 7. B | Q17941 | Serine/threonine-protein kinase akt-1 | 1.69e-07 | NA | 5.82e-12 | NA |
| 7. B | O13839 | G2-specific protein kinase fin1 | 1.46e-08 | NA | 8.23e-09 | NA |
| 7. B | Q6ZCZ2 | Brassinosteroid LRR receptor kinase BRL3 | 9.31e-03 | NA | 4.04e-08 | NA |
| 7. B | P55144 | Tyrosine-protein kinase receptor TYRO3 | 1.01e-05 | NA | 6.68e-06 | NA |
| 7. B | Q6PCN3 | Tau-tubulin kinase 1 | 1.78e-04 | NA | 1.60e-06 | NA |
| 7. B | P06784 | Serine/threonine-protein kinase STE7 | 1.95e-10 | NA | 7.13e-11 | NA |
| 7. B | Q10056 | Serine/threonine-protein kinase shk2 | 2.23e-06 | NA | 5.55e-12 | NA |
| 7. B | Q4V793 | Homeodomain-interacting protein kinase 4 | 4.54e-05 | NA | 6.78e-05 | NA |
| 7. B | Q9ERH7 | Homeodomain-interacting protein kinase 3 | 4.54e-05 | NA | 5.12e-06 | NA |
| 7. B | Q54YZ5 | Probable serine/threonine-protein kinase DDB_G0277989 | 6.04e-03 | NA | 0.006 | NA |
| 7. B | Q2KFH6 | PAN2-PAN3 deadenylation complex subunit PAN3 | 1.44e-06 | NA | 0.002 | NA |
| 7. B | O64477 | G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130 | 9.65e-04 | NA | 2.03e-07 | NA |
| 7. B | O65554 | CBL-interacting serine/threonine-protein kinase 6 | 1.05e-08 | NA | 4.82e-17 | NA |
| 7. B | C0LGQ5 | LRR receptor-like serine/threonine-protein kinase GSO1 | 1.45e-02 | NA | 9.85e-06 | NA |
| 7. B | Q21776 | Mitotic checkpoint serine/threonine-protein kinase bub-1 | 6.10e-05 | NA | 0.021 | NA |
| 7. B | P68404 | Protein kinase C beta type | 1.99e-07 | NA | 1.30e-08 | NA |
| 7. B | Q05101 | Serine/threonine-protein kinase US3 homolog | NA | NA | 3.46e-06 | NA |
| 7. B | Q559A2 | Probable serine/threonine-protein kinase irlA | 5.27e-03 | NA | 0.009 | NA |
| 7. B | Q61532 | Mitogen-activated protein kinase 6 | 4.84e-07 | NA | 1.64e-13 | NA |
| 7. B | Q8VDU5 | SNF-related serine/threonine-protein kinase | 1.79e-06 | NA | 3.68e-13 | NA |
| 7. B | P34152 | Focal adhesion kinase 1 | 1.77e-04 | NA | 1.08e-10 | NA |
| 7. B | Q62925 | Mitogen-activated protein kinase kinase kinase 1 | 6.53e-06 | NA | 1.37e-09 | NA |
| 7. B | Q9QZL0 | Receptor-interacting serine/threonine-protein kinase 3 | 2.57e-07 | NA | 2.13e-04 | NA |
| 7. B | O01700 | Mitogen-activated protein kinase kinase kinase dlk-1 | 1.57e-05 | NA | 2.64e-14 | NA |
| 7. B | P48479 | G2-specific protein kinase nim-1 | 1.92e-07 | NA | 2.60e-07 | NA |
| 7. B | Q8TDX7 | Serine/threonine-protein kinase Nek7 | 0.00e+00 | NA | 6.14e-19 | NA |
| 7. B | P11345 | RAF proto-oncogene serine/threonine-protein kinase | 3.64e-09 | NA | 9.67e-15 | NA |
| 7. B | Q61846 | Maternal embryonic leucine zipper kinase | 6.36e-07 | NA | 1.01e-11 | NA |
| 7. B | Q63092 | CaM kinase-like vesicle-associated protein | 1.03e-09 | NA | 2.48e-07 | NA |
| 7. B | C0LGJ1 | Probable LRR receptor-like serine/threonine-protein kinase At1g74360 | 1.92e-03 | NA | 2.08e-08 | NA |
| 7. B | Q17833 | Tyrosine-protein kinase receptor old-1 | 3.44e-09 | NA | 1.58e-07 | NA |
| 7. B | Q1MX30 | Receptor kinase-like protein Xa21 | 8.00e-03 | NA | 6.05e-05 | NA |
| 7. B | P43250 | G protein-coupled receptor kinase 6 | 2.63e-06 | NA | 4.11e-13 | NA |
| 7. B | P29317 | Ephrin type-A receptor 2 | 4.71e-05 | NA | 1.20e-14 | NA |
| 7. B | Q05999 | Serine/threonine-protein kinase D6PKL3 | 2.66e-07 | NA | 3.11e-05 | NA |
| 7. B | Q84M93 | Mitogen-activated protein kinase 17 | 1.63e-06 | NA | 2.29e-10 | NA |
| 7. B | Q8VHF0 | MAP/microtubule affinity-regulating kinase 3 | 1.07e-05 | NA | 1.18e-14 | NA |
| 7. B | Q9NRH2 | SNF-related serine/threonine-protein kinase | 2.49e-06 | NA | 3.50e-12 | NA |
| 7. B | Q14004 | Cyclin-dependent kinase 13 | 2.30e-03 | NA | 1.76e-07 | NA |
| 7. B | Q42371 | LRR receptor-like serine/threonine-protein kinase ERECTA | 3.62e-03 | NA | 1.98e-07 | NA |
| 7. B | P51568 | Serine/threonine-protein kinase AFC3 | 2.79e-07 | NA | 7.03e-14 | NA |
| 7. B | Q8K348 | Activin receptor type-1C | 1.64e-10 | NA | 1.01e-05 | NA |
| 7. B | P09759 | Ephrin type-B receptor 1 | 2.16e-04 | NA | 1.54e-13 | NA |
| 7. B | O43066 | Serine/threonine-protein kinase ppk30 | 5.28e-06 | NA | 1.39e-07 | NA |
| 7. B | C0LGV0 | Probable LRR receptor-like serine/threonine-protein kinase At5g48740 | 4.10e-04 | NA | 4.64e-11 | NA |
| 7. B | P36002 | Serine/threonine-protein kinase PTK1/STK1 | 9.35e-05 | NA | 6.53e-08 | NA |
| 7. B | Q9Z138 | Tyrosine-protein kinase transmembrane receptor ROR2 | 1.71e-07 | NA | 2.76e-05 | NA |
| 7. B | Q8RX80 | Cysteine-rich receptor-like protein kinase 18 | 2.42e-04 | NA | 1.03e-07 | NA |
| 7. B | Q9M3D8 | L-type lectin-domain containing receptor kinase I.3 | 3.12e-04 | NA | 6.04e-04 | NA |
| 7. B | Q9SIB6 | Probable serine/threonine-protein kinase PBL6 | 5.36e-05 | NA | 1.06e-12 | NA |
| 7. B | A1CX69 | Serine/threonine-protein kinase atg1 | 5.31e-05 | NA | 9.79e-08 | NA |
| 7. B | P00542 | Tyrosine-protein kinase transforming protein Fes | NA | NA | 9.71e-13 | NA |
| 7. B | Q9VBW3 | Tyrosine kinase receptor Cad96Ca | 8.58e-09 | NA | 5.21e-12 | NA |
| 7. B | Q8H1E3 | Probable serine/threonine-protein kinase PBL17 | 1.21e-04 | NA | 2.66e-13 | NA |
| 7. B | P21127 | Cyclin-dependent kinase 11B | 2.29e-05 | NA | 8.99e-11 | NA |
| 7. B | P97874 | Cyclin-G-associated kinase | 3.40e-04 | NA | 6.87e-06 | NA |
| 7. B | P36895 | Bone morphogenetic protein receptor type-1A | 3.94e-10 | NA | 0.001 | NA |
| 7. B | P07527 | Mitosis inhibitor protein kinase wee1 | 6.24e-05 | NA | 1.79e-11 | NA |
| 7. B | P00544 | Tyrosine-protein kinase transforming protein Fgr | NA | NA | 7.52e-07 | NA |
| 7. B | Q8RWZ5 | G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5 | 2.48e-03 | NA | 1.53e-09 | NA |
| 7. B | C0LGU1 | Probable LRR receptor-like serine/threonine-protein kinase At5g37450 | 9.40e-04 | NA | 1.37e-14 | NA |
| 7. B | Q3UYH7 | Beta-adrenergic receptor kinase 2 | 1.41e-06 | NA | 2.92e-15 | NA |
| 7. B | Q54UA9 | Probable serine/threonine-protein kinase clkA | 5.67e-08 | NA | 4.89e-04 | NA |
| 7. B | Q21038 | Tyrosine-protein kinase receptor ver-3 | 1.11e-04 | NA | 9.17e-08 | NA |
| 7. B | P43637 | Serine/threonine-protein kinase TOS3 | 8.55e-07 | NA | 3.47e-10 | NA |
| 7. B | Q9WTL4 | Insulin receptor-related protein | 1.47e-03 | NA | 2.65e-09 | NA |
| 7. B | Q8R4K2 | Interleukin-1 receptor-associated kinase 4 | 7.96e-06 | NA | 7.61e-12 | NA |
| 7. B | Q61526 | Receptor tyrosine-protein kinase erbB-3 | 1.95e-04 | NA | 1.60e-05 | NA |
| 7. B | Q9STK6 | Probable serine/threonine-protein kinase WNK3 | 2.10e-06 | NA | 2.17e-07 | NA |
| 7. B | Q60629 | Ephrin type-A receptor 5 | 2.46e-05 | NA | 9.12e-12 | NA |
| 7. B | P51617 | Interleukin-1 receptor-associated kinase 1 | 2.50e-04 | NA | 2.36e-04 | NA |
| 7. B | P28829 | Protein kinase byr2 | 7.05e-12 | NA | 8.65e-12 | NA |
| 7. B | Q54PB4 | Probable myosin light chain kinase DDB_G0284661 | 9.14e-08 | NA | 9.68e-10 | NA |
| 7. B | Q03526 | Tyrosine-protein kinase ITK/TSK | 2.59e-10 | NA | 4.25e-11 | NA |
| 7. B | Q9HGN1 | eIF-2-alpha kinase GCN2 | 7.15e-03 | NA | 4.18e-08 | NA |
| 7. B | Q9C8I6 | LRR receptor-like serine/threonine-protein kinase IOS1 | 9.38e-04 | NA | 2.59e-09 | NA |
| 7. B | Q5A961 | Actin-regulating kinase PRK1 | 3.27e-07 | NA | 3.05e-06 | NA |
| 7. B | Q9C7T7 | Receptor protein-tyrosine kinase CEPR2 | 7.33e-04 | NA | 1.15e-09 | NA |
| 7. B | P18961 | Serine/threonine-protein kinase YPK2/YKR2 | 2.45e-06 | NA | 7.26e-10 | NA |
| 7. B | P39951 | Cyclin-dependent kinase 1 | 9.99e-16 | NA | 1.82e-09 | NA |
| 7. B | Q9QZS5 | Serine/threonine-protein kinase Sgk2 | 3.96e-09 | NA | 9.31e-11 | NA |
| 7. B | P29376 | Leukocyte tyrosine kinase receptor | 1.38e-05 | NA | 2.00e-09 | NA |
| 7. B | O14098 | CTD kinase subunit alpha | 1.22e-07 | NA | 2.43e-05 | NA |
| 7. B | O60307 | Microtubule-associated serine/threonine-protein kinase 3 | 3.13e-04 | NA | 1.54e-16 | NA |
| 7. B | Q08467 | Casein kinase II subunit alpha-1 | 1.69e-06 | NA | 4.29e-05 | NA |
| 7. B | O14976 | Cyclin-G-associated kinase | 3.97e-05 | NA | 1.65e-06 | NA |
| 7. B | Q54R82 | Mitogen-activated protein kinase kinase kinase A | 1.82e-05 | NA | 8.11e-15 | NA |
| 7. B | Q84UI5 | Mitogen-activated protein kinase 1 | 1.47e-06 | NA | 7.78e-14 | NA |
| 7. B | Q80UW5 | Serine/threonine-protein kinase MRCK gamma | 2.91e-03 | NA | 6.87e-12 | NA |
| 7. B | Q5Z859 | Mitogen-activated protein kinase 4 | 9.64e-08 | NA | 2.92e-12 | NA |
| 7. B | A3B529 | CBL-interacting protein kinase 28 | 1.01e-08 | NA | 9.42e-17 | NA |
| 7. B | P05130 | Protein kinase C, brain isozyme | 1.64e-07 | NA | 5.17e-12 | NA |
| 7. B | P43565 | Serine/threonine-protein kinase RIM15 | 1.21e-01 | NA | 1.04e-08 | NA |
| 7. B | O23081 | Cysteine-rich receptor-like protein kinase 41 | 7.56e-05 | NA | 1.54e-07 | NA |
| 7. B | Q6I5I8 | Calcium-dependent protein kinase 16 | 1.69e-08 | NA | 7.18e-16 | NA |
| 7. B | Q5UQC1 | Putative serine/threonine-protein kinase L232 | NA | NA | 7.40e-07 | NA |
| 7. B | Q5ZJB4 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 7.30e-04 | NA | 2.23e-11 | NA |
| 7. B | O80902 | CBL-interacting serine/threonine-protein kinase 22 | 8.73e-09 | NA | 1.67e-21 | NA |
| 7. B | P07331 | Serine/threonine-protein kinase-transforming protein mos | NA | NA | 1.44e-12 | NA |
| 7. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 8.88e-05 | NA | 4.15e-04 | NA |
| 7. B | Q9SII6 | Probable serine/threonine-protein kinase PIX13 | 2.15e-06 | NA | 3.29e-11 | NA |
| 7. B | Q9ZR08 | G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 | 8.10e-04 | NA | 1.12e-08 | NA |
| 7. B | P04412 | Epidermal growth factor receptor | 2.84e-04 | NA | 1.59e-08 | NA |
| 7. B | P34099 | cAMP-dependent protein kinase catalytic subunit | 9.83e-08 | NA | 6.12e-09 | NA |
| 7. B | Q8AYG3 | Dual specificity protein kinase Ttk | 1.09e-04 | NA | 3.03e-05 | NA |
| 7. B | A2XW02 | Salt tolerance receptor-like cytoplasmic kinase 1 | 4.24e-07 | NA | 1.33e-04 | NA |
| 7. B | O65530 | Proline-rich receptor-like protein kinase PERK14 | 7.82e-05 | NA | 9.00e-07 | NA |
| 7. B | P51813 | Cytoplasmic tyrosine-protein kinase BMX | 4.24e-10 | NA | 3.63e-12 | NA |
| 7. B | P43288 | Shaggy-related protein kinase alpha | 1.51e-09 | NA | 2.00e-07 | NA |
| 7. B | Q55DJ9 | Probable serine/threonine-protein kinase irlD | 2.22e-02 | NA | 5.13e-05 | NA |
| 7. B | P19454 | Casein kinase II subunit alpha' | 1.13e-12 | NA | 5.35e-06 | NA |
| 7. B | P18654 | Ribosomal protein S6 kinase alpha-3 | 1.64e-06 | NA | 4.52e-15 | NA |
| 7. B | Q10KY3 | Calcium/calmodulin-dependent serine/threonine-protein kinase 1 | 1.12e-07 | NA | 1.01e-15 | NA |
| 7. B | Q9M1L7 | Pollen receptor-like kinase 3 | 9.57e-05 | NA | 0.015 | NA |
| 7. B | Q5AHK2 | Serine/threonine-protein kinase SSN3 | 2.96e-06 | NA | 2.23e-06 | NA |
| 7. B | F4I2N7 | Receptor-like protein kinase 7 | 1.74e-03 | NA | 6.22e-09 | NA |
| 7. B | Q0CLX3 | Serine/threonine-protein kinase atg1 | 2.88e-06 | NA | 6.51e-10 | NA |
| 7. B | Q9FJ54 | CBL-interacting serine/threonine-protein kinase 20 | 1.08e-08 | NA | 9.96e-19 | NA |
| 7. B | P26817 | Beta-adrenergic receptor kinase 1 | 7.78e-07 | NA | 8.21e-15 | NA |
| 7. B | P08631 | Tyrosine-protein kinase HCK | 3.03e-11 | NA | 4.01e-13 | NA |
| 7. B | P16054 | Protein kinase C epsilon type | 2.92e-06 | NA | 3.86e-12 | NA |
| 7. B | P38970 | Serine/threonine-protein kinase HAL5 | 1.34e-04 | NA | 1.51e-09 | NA |
| 7. B | P11730 | Calcium/calmodulin-dependent protein kinase type II subunit gamma | 1.47e-09 | NA | 1.38e-14 | NA |
| 7. B | Q9NY57 | Serine/threonine-protein kinase 32B | 8.15e-08 | NA | 8.75e-12 | NA |
| 7. B | P54753 | Ephrin type-B receptor 3 | 1.49e-04 | NA | 3.61e-11 | NA |
| 7. B | P35761 | Dual specificity protein kinase TTK | 2.26e-06 | NA | 7.04e-10 | NA |
| 7. B | Q922K9 | Tyrosine-protein kinase FRK | 5.23e-12 | NA | 9.53e-09 | NA |
| 7. B | Q63433 | Serine/threonine-protein kinase N1 | 2.54e-06 | NA | 6.69e-08 | NA |
| 7. B | Q28043 | Activin receptor type-2A | 1.69e-06 | NA | 1.45e-08 | NA |
| 7. B | Q8K4B2 | Interleukin-1 receptor-associated kinase 3 | 1.83e-04 | NA | 0.008 | NA |
| 7. B | Q05688 | Insulin-like growth factor 1 receptor (Fragment) | 1.28e-06 | NA | 6.98e-12 | NA |
| 7. B | Q24324 | Dual specificity mitogen-activated protein kinase kinase dSOR1 | 3.27e-08 | NA | 6.48e-12 | NA |
| 7. B | Q09831 | Serine/threonine-protein kinase ppk14 | 3.31e-08 | NA | 5.36e-10 | NA |
| 7. B | P17801 | Putative receptor protein kinase ZmPK1 | 8.82e-05 | NA | 6.04e-09 | NA |
| 7. B | Q10664 | Dual specificity mitogen-activated protein kinase kinase mek-2 | 2.60e-11 | NA | 7.29e-09 | NA |
| 7. B | P97793 | ALK tyrosine kinase receptor | 1.55e-03 | NA | 7.89e-07 | NA |
| 7. B | Q9UK32 | Ribosomal protein S6 kinase alpha-6 | 1.79e-06 | NA | 1.72e-13 | NA |
| 7. B | P97756 | Calcium/calmodulin-dependent protein kinase kinase 1 | 2.62e-07 | NA | 4.17e-11 | NA |
| 7. B | Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 | 2.19e-06 | NA | 1.12e-17 | NA |
| 7. B | Q28889 | Mast/stem cell growth factor receptor Kit | 7.87e-05 | NA | 2.14e-07 | NA |
| 7. B | Q9SIT1 | Receptor-like kinase TMK3 | 3.27e-03 | NA | 1.94e-07 | NA |
| 7. B | P0CD62 | Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 | 9.89e-08 | NA | 7.35e-08 | NA |
| 7. B | Q61271 | Activin receptor type-1B | 2.00e-10 | NA | 0.001 | NA |
| 7. B | Q8TD08 | Mitogen-activated protein kinase 15 | 5.90e-07 | NA | 3.94e-13 | NA |
| 7. B | Q52EB3 | Serine/threonine-protein kinase ATG1 | 5.55e-08 | NA | 4.00e-07 | NA |
| 7. B | P47810 | Wee1-like protein kinase | 6.49e-08 | NA | 5.49e-04 | NA |
| 7. B | P0CP71 | Serine/threonine-protein kinase ATG1 | 6.33e-05 | NA | 2.34e-07 | NA |
| 7. B | Q95126 | Activin receptor type-2B | 1.01e-05 | NA | 4.42e-07 | NA |
| 7. B | Q9UTE5 | Eukaryotic translation initiation factor 2-alpha kinase 2 | 2.63e-03 | NA | 0.001 | NA |
| 7. B | Q8C0Q4 | Serine/threonine-protein kinase Nek11 | 3.15e-10 | NA | 3.86e-16 | NA |
| 7. B | P00520 | Tyrosine-protein kinase ABL1 | 6.80e-04 | NA | 1.74e-09 | NA |
| 7. B | P06239 | Tyrosine-protein kinase Lck | 3.83e-08 | NA | 8.76e-10 | NA |
| 7. B | Q39050 | Casein kinase 1-like protein 11 | 1.08e-12 | NA | 1.57e-09 | NA |
| 7. B | Q8L710 | Cysteine-rich receptor-like protein kinase 17 | 5.89e-05 | NA | 1.03e-07 | NA |
| 7. B | Q86V86 | Serine/threonine-protein kinase pim-3 | 6.81e-10 | NA | 2.60e-08 | NA |
| 7. B | Q1ZXI5 | Probable serine/threonine-protein kinase DDB_G0278845 | 7.41e-03 | NA | 9.54e-10 | NA |
| 7. B | Q9QVP9 | Protein-tyrosine kinase 2-beta | 3.51e-04 | NA | 2.95e-08 | NA |
| 7. B | Q9QY01 | Serine/threonine-protein kinase ULK2 | 2.97e-05 | NA | 7.17e-16 | NA |
| 7. B | Q9C823 | C-type lectin receptor-like tyrosine-protein kinase At1g52310 | 1.17e-05 | NA | 1.21e-05 | NA |
| 7. B | Q9Z1W9 | STE20/SPS1-related proline-alanine-rich protein kinase | 7.88e-08 | NA | 3.41e-16 | NA |
| 7. B | Q60855 | Receptor-interacting serine/threonine-protein kinase 1 | 8.80e-07 | NA | 4.43e-09 | NA |
| 7. B | P00529 | Tyrosine-protein kinase transforming protein ros | NA | NA | 1.60e-10 | NA |
| 7. B | Q02779 | Mitogen-activated protein kinase kinase kinase 10 | 4.36e-07 | NA | 4.69e-11 | NA |
| 7. B | Q9SZD5 | L-type lectin-domain containing receptor kinase V.9 | 8.94e-04 | NA | 1.39e-07 | NA |
| 7. B | Q9DE49 | Platelet-derived growth factor receptor alpha | 1.58e-03 | NA | 1.26e-05 | NA |
| 7. B | Q8RXG3 | Mitogen-activated protein kinase kinase 5 | 2.78e-15 | NA | 9.00e-18 | NA |
| 7. B | Q9STV4 | CBL-interacting serine/threonine-protein kinase 8 | 1.67e-08 | NA | 3.17e-17 | NA |
| 7. B | B4QC63 | Tyrosine-protein kinase-like otk | 2.70e-04 | NA | 0.002 | NA |
| 7. B | Q4P5N0 | Serine/threonine-protein kinase SMU1 | 2.08e-05 | NA | 1.18e-13 | NA |
| 7. B | O74815 | Serine/threonine-protein kinase ppk27 | 2.40e-12 | NA | 3.73e-06 | NA |
| 7. B | G5EBT1 | Mitogen-activated protein kinase sma-5 | 7.11e-06 | NA | 1.49e-11 | NA |
| 7. B | F1RDG9 | Tyrosine-protein kinase fynb | 7.03e-11 | NA | 2.67e-10 | NA |
| 7. B | Q1PDW3 | Receptor-like kinase LIP1 | 9.15e-05 | NA | 8.22e-08 | NA |
| 7. B | Q552C6 | Dual specificity protein kinase zak2 | 2.21e-09 | NA | 4.39e-06 | NA |
| 7. B | O73791 | Tyrosine-protein kinase receptor Tie-2 | 4.76e-07 | NA | 9.93e-05 | NA |
| 7. B | Q9SL76 | Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein | 3.87e-04 | NA | 0.008 | NA |
| 7. B | O08679 | Serine/threonine-protein kinase MARK2 | 2.66e-06 | NA | 7.03e-15 | NA |
| 7. B | Q62673 | Serine/threonine-protein kinase PLK1 | 1.35e-07 | NA | 1.53e-18 | NA |
| 7. B | P9WI65 | Serine/threonine-protein kinase PknK | 7.00e-05 | NA | 1.08e-14 | NA |
| 7. B | P00527 | Tyrosine-protein kinase transforming protein Yes (Fragment) | NA | NA | 2.72e-07 | NA |
| 7. B | Q5AHG6 | Serine/threonine-protein kinase SCH9 | 1.96e-06 | NA | 1.18e-10 | NA |
| 7. B | P47116 | Serine/threonine-protein kinase PTK2/STK2 | 2.28e-04 | NA | 4.77e-10 | NA |
| 7. B | C0LGI2 | Probable LRR receptor-like serine/threonine-protein kinase At1g67720 | 1.49e-03 | NA | 9.46e-09 | NA |
| 7. B | G5EDT6 | Dual specificity mitogen-activated protein kinase kinase jkk-1 | 1.09e-07 | NA | 6.77e-13 | NA |
| 7. B | Q9ESG9 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase | 4.60e-08 | NA | 4.91e-11 | NA |
| 7. B | P23298 | Protein kinase C eta type | 1.16e-06 | NA | 2.15e-10 | NA |
| 7. B | P36582 | Protein kinase C-like 1 | 4.82e-05 | NA | 2.00e-12 | NA |
| 7. B | P29323 | Ephrin type-B receptor 2 | 2.71e-04 | NA | 7.70e-14 | NA |
| 7. B | O08648 | Mitogen-activated protein kinase kinase kinase 4 | 1.89e-05 | NA | 8.63e-08 | NA |
| 7. B | Q9UBE8 | Serine/threonine-protein kinase NLK | 6.00e-06 | NA | 1.27e-11 | NA |
| 7. B | Q9Z2B5 | Eukaryotic translation initiation factor 2-alpha kinase 3 | 3.12e-02 | NA | 1.94e-11 | NA |
| 7. B | P93749 | Probable protein kinase At2g41970 | 3.01e-06 | NA | 6.78e-06 | NA |
| 7. B | Q9SR05 | Receptor-like protein kinase ANXUR1 | 6.47e-04 | NA | 3.54e-09 | NA |
| 7. B | Q55CL6 | Dual specificity mitogen-activated protein kinase kinase 1 | 4.91e-05 | NA | 1.38e-14 | NA |
| 7. B | Q6PFQ0 | Ribosomal protein S6 kinase alpha-6 | 1.14e-06 | NA | 2.33e-15 | NA |
| 7. B | Q8WQL7 | Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 | 4.83e-06 | NA | 4.36e-04 | NA |
| 7. B | Q9WUI1 | Mitogen-activated protein kinase 11 | 8.81e-08 | NA | 1.86e-16 | NA |
| 7. B | F4JPX3 | Probable serine/threonine-protein kinase PBL20 | 6.05e-06 | NA | 1.30e-11 | NA |
| 7. B | P14234 | Tyrosine-protein kinase Fgr | 3.29e-11 | NA | 7.68e-09 | NA |
| 7. B | O02827 | Myosin light chain kinase, smooth muscle (Fragment) | NA | NA | 1.48e-15 | NA |
| 7. B | O45818 | Serine/threonine-protein kinase dkf-2 | 4.77e-04 | NA | 5.22e-13 | NA |
| 7. B | Q2MHE4 | Serine/threonine/tyrosine-protein kinase HT1 | 1.50e-11 | NA | 2.69e-13 | NA |
| 7. B | Q39016 | Calcium-dependent protein kinase 11 | 3.72e-10 | NA | 3.03e-13 | NA |
| 7. B | Q3UHL1 | CaM kinase-like vesicle-associated protein | 1.20e-09 | NA | 2.01e-07 | NA |
| 7. B | Q9E6L8 | Protein kinase US3 homolog | NA | NA | 1.87e-06 | NA |
| 7. B | Q90XF2 | Protein kinase C iota type | 1.65e-07 | NA | 3.08e-14 | NA |
| 7. B | F4JTP5 | Serine/threonine-protein kinase STY46 | 7.26e-07 | NA | 4.36e-14 | NA |
| 7. B | Q54VC0 | Probable serine/threonine-protein kinase DDB_G0280461 | 1.11e-08 | NA | 3.51e-11 | NA |
| 7. B | Q90Z00 | Fibroblast growth factor receptor 1-A | 5.55e-05 | NA | 2.08e-08 | NA |
| 7. B | Q8BKG3 | Inactive tyrosine-protein kinase 7 | 9.77e-05 | NA | 2.89e-07 | NA |
| 7. B | P93604 | Rust resistance kinase Lr10 | 7.97e-05 | NA | 1.54e-07 | NA |
| 7. B | Q9LMT9 | Putative wall-associated receptor kinase-like 13 | 8.66e-05 | NA | 1.61e-07 | NA |
| 7. B | O22040 | Mitogen-activated protein kinase kinase kinase ANP1 | 7.97e-07 | NA | 1.38e-15 | NA |
| 7. B | Q6PHR2 | Serine/threonine-protein kinase ULK3 | 9.11e-09 | NA | 7.45e-18 | NA |
| 7. B | P32516 | Serine/threonine-protein kinase | NA | NA | 3.47e-06 | NA |
| 7. B | Q9V3Q6 | Mitogen-activated protein kinase kinase kinase 7 | 2.56e-07 | NA | 1.36e-11 | NA |
| 7. B | A2YMV6 | Probable serine/threonine-protein kinase WNK1 | 1.45e-04 | NA | 2.71e-05 | NA |
| 7. B | P0DL10 | Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 | 1.11e-03 | NA | 5.70e-04 | NA |
| 7. B | Q9C098 | Serine/threonine-protein kinase DCLK3 | 1.42e-08 | NA | 8.96e-13 | NA |
| 7. B | P23458 | Tyrosine-protein kinase JAK1 | 2.52e-04 | NA | 7.39e-11 | NA |
| 7. B | Q02763 | Angiopoietin-1 receptor | 5.60e-05 | NA | 5.33e-06 | NA |
| 7. B | Q9LSS0 | L-type lectin-domain containing receptor kinase I.7 | 3.17e-04 | NA | 3.25e-04 | NA |
| 7. B | Q9FJV0 | Mitogen-activated protein kinase kinase 6 | 7.50e-11 | NA | 7.40e-12 | NA |
| 7. B | O14305 | Serine/threonine-protein kinase sid1 | 7.69e-10 | NA | 8.77e-15 | NA |
| 7. B | G5EEN4 | Germinal center kinase 3 | 1.13e-07 | NA | 2.46e-14 | NA |
| 7. B | Q16512 | Serine/threonine-protein kinase N1 | 2.99e-05 | NA | 8.71e-08 | NA |
| 7. B | Q8AXC6 | Mast/stem cell growth factor receptor Kit | 7.31e-04 | NA | 4.20e-08 | NA |
| 7. B | Q80XI6 | Mitogen-activated protein kinase kinase kinase 11 | 4.48e-08 | NA | 1.82e-10 | NA |
| 7. B | Q8RXC8 | Receptor-like cytosolic serine/threonine-protein kinase RBK2 | 3.01e-05 | NA | 3.36e-07 | NA |
| 7. B | Q641K5 | NUAK family SNF1-like kinase 1 | 8.49e-07 | NA | 3.46e-12 | NA |
| 7. B | Q9JM01 | Cyclin-dependent kinase-like 3 | 4.47e-08 | NA | 5.79e-16 | NA |
| 7. B | Q9LWN0 | Shaggy-related protein kinase GSK1 | 1.81e-07 | NA | 3.45e-08 | NA |
| 7. B | Q42396 | Calcium-dependent protein kinase 12 | 2.68e-08 | NA | 4.05e-07 | NA |
| 7. B | P07947 | Tyrosine-protein kinase Yes | 5.71e-11 | NA | 2.45e-06 | NA |
| 7. B | Q9ZV15 | Calcium-dependent protein kinase 20 | 1.19e-07 | NA | 8.43e-11 | NA |
| 7. B | Q13237 | cGMP-dependent protein kinase 2 | 9.71e-07 | NA | 6.97e-09 | NA |
| 7. B | P38622 | Serine/threonine-protein kinase RCK1 | 3.22e-08 | NA | 2.36e-08 | NA |
| 7. B | A4L9P5 | Homeodomain-interacting protein kinase 1 | 4.26e-05 | NA | 1.50e-05 | NA |
| 7. B | Q20471 | Casein kinase I isoform delta | 3.05e-09 | NA | 7.01e-10 | NA |
| 7. B | E9PT87 | Myosin light chain kinase 3 | 3.38e-06 | NA | 1.00e-13 | NA |
| 7. B | Q9LZF8 | Serine/threonine-protein kinase PCRK2 | 2.02e-06 | NA | 9.77e-06 | NA |
| 7. B | Q05609 | Serine/threonine-protein kinase CTR1 | 6.02e-09 | NA | 7.58e-12 | NA |
| 7. B | Q6XHA7 | Probable serine/threonine-protein kinase roco9 | NA | NA | 3.81e-05 | NA |
| 7. B | Q5Z9J0 | Mitogen-activated protein kinase 12 | 4.40e-06 | NA | 7.02e-14 | NA |
| 7. B | P09215 | Protein kinase C delta type | 3.64e-06 | NA | 1.27e-11 | NA |
| 7. B | Q4WUN7 | Mitogen-activated protein kinase mpkC | 1.11e-07 | NA | 5.03e-15 | NA |
| 7. B | Q9LK03 | Proline-rich receptor-like protein kinase PERK2 | 1.87e-04 | NA | 3.32e-08 | NA |
| 7. B | Q55FV4 | Probable serine/threonine-protein kinase fnkB | 1.38e-07 | NA | 3.81e-07 | NA |
| 7. B | Q5U2X5 | Activated CDC42 kinase 1 | 1.50e-07 | NA | 7.42e-08 | NA |
| 7. B | Q02956 | Protein kinase C zeta type | 1.22e-07 | NA | 4.15e-13 | NA |
| 7. B | P18266 | Glycogen synthase kinase-3 beta | 1.93e-07 | NA | 1.87e-05 | NA |
| 7. B | Q03351 | NT-3 growth factor receptor | 3.28e-08 | NA | 0.001 | NA |
| 7. B | Q64729 | TGF-beta receptor type-1 | 2.38e-10 | NA | 8.60e-04 | NA |
| 7. B | Q9M092 | Wall-associated receptor kinase-like 17 | 3.43e-04 | NA | 8.83e-12 | NA |
| 7. B | P46551 | Cyclin-dependent kinase 12 | 5.45e-06 | NA | 3.69e-05 | NA |
| 7. B | Q15418 | Ribosomal protein S6 kinase alpha-1 | 1.66e-06 | NA | 2.61e-15 | NA |
| 7. B | Q5Z6X0 | CBL-interacting protein kinase 25 | 9.87e-08 | NA | 3.10e-15 | NA |
| 7. B | O60145 | Serine/threonine-protein kinase ppk23 | 2.65e-09 | NA | 1.42e-07 | NA |
| 7. B | Q9FG33 | Probable L-type lectin-domain containing receptor kinase S.5 | 4.93e-05 | NA | 2.76e-13 | NA |
| 7. B | Q8BTW9 | Serine/threonine-protein kinase PAK 4 | 1.26e-05 | NA | 4.70e-12 | NA |
| 7. B | Q09537 | G protein-coupled receptor kinase 1 | 1.15e-06 | NA | 1.03e-11 | NA |
| 7. B | Q9UL54 | Serine/threonine-protein kinase TAO2 | 1.51e-04 | NA | 2.77e-06 | NA |
| 7. B | P29295 | Casein kinase I homolog HRR25 | 1.34e-09 | NA | 1.72e-09 | NA |
| 7. B | P00535 | Tyrosine-protein kinase transforming protein erbB | NA | NA | 7.31e-12 | NA |
| 7. B | Q69Z98 | Serine/threonine-protein kinase BRSK2 | 2.11e-06 | NA | 8.07e-17 | NA |
| 7. B | O13146 | Ephrin type-A receptor 3 | 5.74e-06 | NA | 3.22e-11 | NA |
| 7. B | Q7ZUQ3 | Serine/threonine-protein kinase 3 | 5.15e-08 | NA | 4.42e-09 | NA |
| 7. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.74e-05 | NA | 1.49e-04 | NA |
| 7. B | Q2RAX3 | CBL-interacting protein kinase 33 | 1.06e-08 | NA | 9.90e-19 | NA |
| 7. B | P42685 | Tyrosine-protein kinase FRK | 1.46e-11 | NA | 6.60e-10 | NA |
| 7. B | P52332 | Tyrosine-protein kinase JAK1 | 2.76e-04 | NA | 5.70e-11 | NA |
| 7. B | Q00495 | Macrophage colony-stimulating factor 1 receptor | 6.40e-05 | NA | 1.24e-06 | NA |
| 7. B | Q96KB5 | Lymphokine-activated killer T-cell-originated protein kinase | 1.68e-13 | NA | 0.001 | NA |
| 7. B | Q8RX66 | Serine/threonine-protein kinase Nek3 | 1.72e-07 | NA | 1.56e-16 | NA |
| 7. B | Q95KV1 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 2.16e-04 | NA | 1.21e-11 | NA |
| 7. B | O04160 | Shaggy-related protein kinase theta | 9.62e-07 | NA | 5.12e-07 | NA |
| 7. B | A2VDU3 | Mitogen-activated protein kinase kinase kinase 7 | 1.13e-06 | NA | 2.48e-11 | NA |
| 7. B | P21137 | cAMP-dependent protein kinase catalytic subunit | 7.49e-10 | NA | 7.12e-08 | NA |
| 7. B | Q3E884 | Putative L-type lectin-domain containing receptor kinase I.10 | 1.46e-04 | NA | 1.21e-04 | NA |
| 7. B | Q9WVS7 | Dual specificity mitogen-activated protein kinase kinase 5 | 1.58e-09 | NA | 9.41e-09 | NA |
| 7. B | Q3E9C0 | Calcium-dependent protein kinase 34 | 7.50e-08 | NA | 5.87e-11 | NA |
| 7. B | Q54W86 | Probable myosin light chain kinase DDB_G0279831 | 3.32e-05 | NA | 1.04e-09 | NA |
| 7. B | Q9S9M1 | Wall-associated receptor kinase-like 5 | 6.71e-04 | NA | 1.46e-09 | NA |
| 7. B | Q99KH8 | Serine/threonine-protein kinase 24 | 1.24e-10 | NA | 3.32e-08 | NA |
| 7. B | Q9W354 | Extracellular signal-regulated kinase 7 | 5.44e-05 | NA | 1.05e-12 | NA |
| 7. B | Q9FVS6 | Shaggy-related protein kinase delta | 3.71e-07 | NA | 4.98e-07 | NA |
| 7. B | P43293 | Probable serine/threonine-protein kinase PBL11 | 2.66e-06 | NA | 1.50e-11 | NA |
| 7. B | Q9FX43 | Mitogen-activated protein kinase kinase 9 | 1.09e-14 | NA | 2.29e-20 | NA |
| 7. B | Q64FQ2 | Protein kinase PINOID 2 | 6.85e-05 | NA | 1.14e-06 | NA |
| 7. B | P80204 | TGF-beta receptor type-1 | 2.17e-10 | NA | 7.27e-04 | NA |
| 7. B | Q9SXB8 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 | 9.16e-04 | NA | 9.10e-09 | NA |
| 7. B | Q64725 | Tyrosine-protein kinase SYK | 1.17e-10 | NA | 5.96e-10 | NA |
| 7. B | P47811 | Mitogen-activated protein kinase 14 | 9.75e-08 | NA | 1.88e-17 | NA |
| 7. B | C0LGR6 | Probable LRR receptor-like serine/threonine-protein kinase At4g29180 | 4.09e-05 | NA | 1.53e-11 | NA |
| 7. B | O43930 | Putative serine/threonine-protein kinase PRKY | 4.60e-13 | NA | 7.20e-10 | NA |
| 7. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 4.87e-06 | NA | 1.84e-08 | NA |
| 7. B | O48963 | Phototropin-1 | 6.75e-05 | NA | 2.79e-06 | NA |
| 7. B | P70600 | Protein-tyrosine kinase 2-beta | 1.77e-04 | NA | 3.61e-08 | NA |
| 7. B | F4I3V3 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.5 | 6.46e-05 | NA | 7.65e-08 | NA |
| 7. B | Q16584 | Mitogen-activated protein kinase kinase kinase 11 | 1.54e-07 | NA | 1.72e-10 | NA |
| 7. B | Q9SJG9 | Mitogen-activated protein kinase 20 | 7.32e-07 | NA | 1.58e-13 | NA |
| 7. B | Q4G3H4 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 3.38e-04 | NA | 8.74e-08 | NA |
| 7. B | Q10156 | Dual specificity protein kinase lkh1 | 2.50e-04 | NA | 1.01e-09 | NA |
| 7. B | P90980 | Protein kinase C-like 2 | 1.19e-05 | NA | 1.57e-09 | NA |
| 7. B | Q9ZU46 | Receptor protein kinase-like protein ZAR1 | 7.01e-05 | NA | 9.86e-05 | NA |
| 7. B | Q9ZQ31 | Serine/threonine-protein kinase STY13 | 2.20e-08 | NA | 1.29e-12 | NA |
| 7. B | Q9LN59 | Putative wall-associated receptor kinase-like 11 | 1.02e-04 | NA | 1.31e-07 | NA |
| 7. B | Q8AXC7 | Platelet-derived growth factor receptor alpha | 1.53e-03 | NA | 9.63e-07 | NA |
| 7. B | Q9MA15 | Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic | 3.62e-02 | NA | 0.007 | NA |
| 7. B | Q9SRH7 | Serine/threonine-protein kinase PBL35 | 2.91e-04 | NA | 8.72e-12 | NA |
| 7. B | O97143 | Serine/threonine-protein kinase PLK4 | 6.91e-07 | NA | 1.30e-15 | NA |
| 7. B | P54645 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | 5.18e-09 | NA | 3.66e-16 | NA |
| 7. B | Q7XIT1 | Serine/threonine-protein kinase/endoribonuclease IRE1 | 1.36e-04 | NA | 2.13e-07 | NA |
| 7. B | Q9DGE2 | Mitogen-activated protein kinase 14A | 6.03e-08 | NA | 1.10e-16 | NA |
| 7. B | Q9XIW0 | CBL-interacting serine/threonine-protein kinase 7 | 4.72e-09 | NA | 9.84e-26 | NA |
| 7. B | Q1ECX4 | Serine/threonine-protein kinase tousled-like 2 | 3.51e-10 | NA | 8.17e-14 | NA |
| 7. B | Q54R98 | Probable serine/threonine-protein kinase DDB_G0283301 | 2.81e-07 | NA | 4.77e-04 | NA |
| 7. B | Q7RZD3 | Serine/threonine-protein kinase ste20 | 2.36e-05 | NA | 2.58e-10 | NA |
| 7. B | Q54QQ1 | Serine/threonine-protein kinase phg2 | 9.44e-06 | NA | 2.59e-13 | NA |
| 7. B | O74135 | Casein kinase I homolog 3 | 1.19e-09 | NA | 4.01e-05 | NA |
| 7. B | Q13233 | Mitogen-activated protein kinase kinase kinase 1 | 9.65e-06 | NA | 4.39e-09 | NA |
| 7. B | P54199 | Serine/threonine-protein kinase MPS1 | 7.67e-06 | NA | 2.01e-07 | NA |
| 7. B | P25848 | Light-sensor Protein kinase | 2.08e-04 | NA | 8.45e-13 | NA |
| 7. B | Q9HFW2 | Serine/threonine-protein kinase CLA4 | 5.76e-05 | NA | 3.10e-12 | NA |
| 7. B | Q86AE1 | Probable serine/threonine-protein kinase DDB_G0271538 | 7.61e-07 | NA | 3.49e-05 | NA |
| 7. B | O09127 | Ephrin type-A receptor 8 | 3.89e-04 | NA | 5.34e-14 | NA |
| 7. B | Q93105 | Insulin-like receptor | 3.30e-04 | NA | 1.31e-09 | NA |
| 7. B | P15056 | Serine/threonine-protein kinase B-raf | 1.29e-08 | NA | 2.09e-15 | NA |
| 7. B | P38444 | Activin receptor type-2A | 1.41e-06 | NA | 1.02e-08 | NA |
| 7. B | Q9Z1M4 | Ribosomal protein S6 kinase beta-2 | 4.77e-08 | NA | 5.35e-15 | NA |
| 7. B | Q66HE7 | Cyclin-dependent kinase-like 1 | 1.39e-09 | NA | 3.61e-13 | NA |
| 7. B | Q63562 | Mitogen-activated protein kinase kinase kinase 8 | 7.72e-09 | NA | 4.18e-06 | NA |
| 7. B | Q9C9U5 | Probable serine/threonine-protein kinase SIS8 | 1.35e-05 | NA | 4.95e-10 | NA |
| 7. B | Q54PX0 | Probable serine/threonine-protein kinase DDB_G0284251 | 2.76e-10 | NA | 9.95e-19 | NA |
| 7. B | P87248 | Serine/threonine-protein kinase ATG1 | 4.33e-10 | NA | 8.21e-08 | NA |
| 7. B | Q40518 | Shaggy-related protein kinase NtK-1 | 1.71e-09 | NA | 3.41e-07 | NA |
| 7. B | Q9FFW5 | Proline-rich receptor-like protein kinase PERK8 | 9.62e-05 | NA | 5.40e-07 | NA |
| 7. B | Q5TCY1 | Tau-tubulin kinase 1 | 2.05e-04 | NA | 1.60e-06 | NA |
| 7. B | Q96GX5 | Serine/threonine-protein kinase greatwall | 1.75e-02 | NA | 2.87e-10 | NA |
| 7. B | F4HQ23 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.7 | 1.80e-03 | NA | 8.47e-11 | NA |
| 7. B | Q552Z2 | Probable serine/threonine-protein kinase fnkE | 1.45e-03 | NA | 8.67e-08 | NA |
| 7. B | P08581 | Hepatocyte growth factor receptor | 5.78e-04 | NA | 1.78e-05 | NA |
| 7. B | P54761 | Ephrin type-B receptor 4 | 6.35e-04 | NA | 1.24e-10 | NA |
| 7. B | Q6ZN16 | Mitogen-activated protein kinase kinase kinase 15 | 5.08e-03 | NA | 5.12e-13 | NA |
| 7. B | P36896 | Activin receptor type-1B | 2.42e-10 | NA | 8.69e-04 | NA |
| 7. B | Q9M3D7 | Putative L-type lectin-domain containing receptor kinase I.4 | 1.00e-03 | NA | 4.16e-04 | NA |
| 7. B | Q61006 | Muscle, skeletal receptor tyrosine-protein kinase | 7.96e-06 | NA | 4.41e-05 | NA |
| 7. B | Q9YI66 | Tyrosine-protein kinase receptor TYRO3 | 5.77e-08 | NA | 6.32e-08 | NA |
| 7. B | Q53UA7 | Serine/threonine-protein kinase TAO3 | 8.12e-06 | NA | 1.18e-06 | NA |
| 7. B | D7UPN3 | LysM domain receptor-like kinase 10 | 4.41e-04 | NA | 1.33e-07 | NA |
| 7. B | P29618 | Cyclin-dependent kinase A-1 | 1.11e-16 | NA | 6.76e-09 | NA |
| 7. B | P16092 | Fibroblast growth factor receptor 1 | 6.52e-05 | NA | 7.93e-10 | NA |
| 7. B | P00521 | Tyrosine-protein kinase transforming protein Abl | NA | NA | 7.10e-09 | NA |
| 7. B | Q54QD5 | Probable serine/threonine-protein kinase nek1 | 3.37e-07 | NA | 2.69e-19 | NA |
| 7. B | Q5EG47 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | 1.77e-07 | NA | 3.37e-16 | NA |
| 7. B | Q60700 | Mitogen-activated protein kinase kinase kinase 12 | 6.23e-07 | NA | 1.67e-13 | NA |
| 7. B | Q75GE8 | Calcium-dependent protein kinase 8 | 9.88e-08 | NA | 5.80e-12 | NA |
| 7. B | Q0D598 | Probable serine/threonine-protein kinase WNK1 | 2.63e-05 | NA | 2.57e-05 | NA |
| 7. B | Q3V3A1 | Cyclin-dependent kinase 15 | 2.60e-09 | NA | 1.07e-11 | NA |
| 7. B | P34208 | Serine/threonine-protein kinase chk1 | 5.08e-06 | NA | 5.35e-15 | NA |
| 7. B | O54949 | Serine/threonine-protein kinase NLK | 6.89e-06 | NA | 1.27e-11 | NA |
| 7. B | Q9SXB5 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11303 | 3.41e-04 | NA | 1.75e-09 | NA |
| 7. B | Q03407 | Serine/threonine-protein kinase PKH1 | 2.22e-05 | NA | 1.10e-10 | NA |
| 7. B | Q9P2K8 | eIF-2-alpha kinase GCN2 | 2.41e-02 | NA | 5.26e-09 | NA |
| 7. B | Q10GB1 | Serine/threonine-protein kinase Nek1 | 4.91e-07 | NA | 1.04e-16 | NA |
| 7. B | Q78DX7 | Proto-oncogene tyrosine-protein kinase ROS | 1.21e-02 | NA | 1.05e-07 | NA |
| 7. B | Q6Z2M9 | Calcium-dependent protein kinase 4 | 2.57e-06 | NA | 2.95e-17 | NA |
| 7. B | P36507 | Dual specificity mitogen-activated protein kinase kinase 2 | 4.71e-09 | NA | 2.05e-08 | NA |
| 7. B | O48788 | Probable inactive receptor kinase At2g26730 | 2.66e-05 | NA | 1.35e-05 | NA |
| 7. B | Q05513 | Protein kinase C zeta type | 1.52e-07 | NA | 4.84e-13 | NA |
| 7. B | B9DFG5 | PTI1-like tyrosine-protein kinase 3 | 1.36e-04 | NA | 8.98e-07 | NA |
| 7. B | Q5Z9N5 | Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 | 1.28e-03 | NA | 3.29e-05 | NA |
| 7. B | Q9ZW09 | Probable inactive L-type lectin-domain containing receptor kinase III.1 | 2.18e-05 | NA | 0.016 | NA |
| 7. B | Q9M1Z5 | Mitogen-activated protein kinase 10 | 1.36e-07 | NA | 2.25e-14 | NA |
| 7. B | Q5TCX8 | Mitogen-activated protein kinase kinase kinase 21 | 1.51e-06 | NA | 2.81e-08 | NA |
| 7. B | Q03145 | Ephrin type-A receptor 2 | 1.28e-04 | NA | 1.35e-14 | NA |
| 7. B | Q7SY24 | Protein kinase C beta type | 3.15e-06 | NA | 1.70e-09 | NA |
| 7. B | Q8IZL9 | Cyclin-dependent kinase 20 | 5.92e-10 | NA | 1.27e-18 | NA |
| 7. B | P53684 | Calcium-dependent protein kinase 7 | 8.91e-07 | NA | 6.63e-09 | NA |
| 7. B | C0LGQ9 | LRR receptor-like serine/threonine-protein kinase GHR1 | 1.59e-03 | NA | 0.002 | NA |
| 7. B | Q3UH66 | Serine/threonine-protein kinase WNK2 | 2.80e-03 | NA | 1.32e-09 | NA |
| 7. B | Q9VA38 | Serine/threonine-protein kinase Warts | 6.60e-04 | NA | 3.09e-10 | NA |
| 7. B | Q15569 | Dual specificity testis-specific protein kinase 1 | 2.89e-07 | NA | 2.82e-04 | NA |
| 7. B | Q9VI13 | Serine/threonine-protein kinase Pak | 2.60e-06 | NA | 6.82e-10 | NA |
| 7. B | Q55DJ8 | Probable serine/threonine-protein kinase irlC | 2.68e-02 | NA | 1.64e-05 | NA |
| 7. B | P51566 | Serine/threonine-protein kinase AFC1 | 2.01e-06 | NA | 8.99e-09 | NA |
| 7. B | Q99N57 | RAF proto-oncogene serine/threonine-protein kinase | 1.33e-07 | NA | 2.98e-14 | NA |
| 7. B | Q5F3W3 | Mitogen-activated protein kinase 6 | 5.64e-07 | NA | 1.14e-13 | NA |
| 7. B | Q63699 | Cyclin-dependent kinase 2 | 2.22e-16 | NA | 1.95e-12 | NA |
| 7. B | O70126 | Aurora kinase B | 2.93e-14 | NA | 3.82e-08 | NA |
| 7. B | E9Q3S4 | Mitogen-activated protein kinase kinase kinase 19 | 1.28e-06 | NA | 3.63e-11 | NA |
| 7. B | Q5VJL3 | Probable serine/threonine-protein kinase gdt9 | 3.44e-05 | NA | 7.06e-06 | NA |
| 7. B | Q07002 | Cyclin-dependent kinase 18 | 4.78e-12 | NA | 3.28e-13 | NA |
| 7. B | O62305 | Calcium/calmodulin-dependent protein kinase type II | 6.78e-08 | NA | 1.30e-14 | NA |
| 7. B | Q9JLS3 | Serine/threonine-protein kinase TAO2 | 1.61e-04 | NA | 2.77e-06 | NA |
| 7. B | O00238 | Bone morphogenetic protein receptor type-1B | 2.00e-10 | NA | 5.25e-04 | NA |
| 7. B | Q9SX31 | Proline-rich receptor-like protein kinase PERK9 | 2.54e-04 | NA | 1.45e-08 | NA |
| 7. B | Q9VPC0 | Serine/threonine-protein kinase PITSLRE | 7.88e-06 | NA | 4.51e-06 | NA |
| 7. B | Q3ECH2 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.8 | 1.82e-03 | NA | 1.13e-07 | NA |
| 7. B | Q64595 | cGMP-dependent protein kinase 2 | 2.93e-09 | NA | 1.91e-09 | NA |
| 7. B | P35739 | High affinity nerve growth factor receptor | 2.42e-06 | NA | 1.19e-06 | NA |
| 7. B | Q9W0V1 | 3-phosphoinositide-dependent protein kinase 1 | 3.13e-05 | NA | 5.39e-06 | NA |
| 7. B | Q62073 | Mitogen-activated protein kinase kinase kinase 7 | 8.52e-07 | NA | 2.84e-11 | NA |
| 7. B | O00506 | Serine/threonine-protein kinase 25 | 1.73e-08 | NA | 3.47e-08 | NA |
| 7. B | Q9NAH6 | Ribosomal protein S6 kinase beta | 1.89e-07 | NA | 2.00e-11 | NA |
| 7. B | Q7ZTW4 | Serine/threonine-protein kinase Sgk1 | 3.73e-08 | NA | 8.33e-11 | NA |
| 7. B | Q62838 | Muscle, skeletal receptor tyrosine protein kinase | 9.15e-06 | NA | 3.36e-05 | NA |
| 7. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 6.36e-05 | NA | 2.40e-06 | NA |
| 7. B | P93025 | Phototropin-2 | 3.98e-06 | NA | 3.50e-05 | NA |
| 7. B | Q6ERS4 | CBL-interacting protein kinase 16 | 2.36e-07 | NA | 4.58e-25 | NA |
| 7. B | Q9LFP7 | Serine/threonine-protein kinase PBL34 | 1.46e-04 | NA | 1.38e-11 | NA |
| 7. B | P43405 | Tyrosine-protein kinase SYK | 1.83e-10 | NA | 1.24e-09 | NA |
| 7. B | Q15139 | Serine/threonine-protein kinase D1 | 3.56e-04 | NA | 1.35e-10 | NA |
| 7. B | Q9FG74 | Serine/threonine-protein kinase D6PK | 7.95e-08 | NA | 1.39e-05 | NA |
| 7. B | Q9LQM8 | Mitogen-activated protein kinase kinase 10 | 4.86e-14 | NA | 6.13e-12 | NA |
| 7. B | Q84M95 | Probable serine/threonine-protein kinase PBL28 | 5.54e-07 | NA | 1.52e-07 | NA |
| 7. B | Q99KY4 | Cyclin-G-associated kinase | 2.69e-04 | NA | 3.33e-06 | NA |
| 7. B | P41892 | Cell division control protein 7 | 2.16e-06 | NA | 2.95e-19 | NA |
| 7. B | Q8AXB4 | Serine/threonine-protein kinase PAK 3 | 3.93e-07 | NA | 1.31e-11 | NA |
| 7. B | Q9I7F7 | Activated Cdc42 kinase-like | 6.10e-04 | NA | 3.31e-06 | NA |
| 7. B | Q7RX99 | Serine/threonine-protein kinase apg-1 | 4.84e-08 | NA | 8.27e-07 | NA |
| 7. B | O22187 | Probable receptor-like protein kinase At2g23200 | 5.92e-04 | NA | 1.01e-05 | NA |
| 7. B | Q54QB1 | Extracellular signal-regulated kinase 2 | 4.00e-09 | NA | 4.77e-13 | NA |
| 7. B | P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret | 8.25e-04 | NA | 1.70e-08 | NA |
| 7. B | Q9SA25 | Wall-associated receptor kinase-like 8 | 2.12e-04 | NA | 3.31e-11 | NA |
| 7. B | J4W0G2 | Serine/threonine-protein kinase ATG1 | 5.93e-06 | NA | 4.23e-07 | NA |
| 7. B | Q6AVM3 | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase | 8.17e-10 | NA | 2.05e-11 | NA |
| 7. B | O70291 | G protein-coupled receptor kinase 4 | 3.53e-07 | NA | 4.00e-11 | NA |
| 7. B | Q63553 | SNF-related serine/threonine-protein kinase | 1.53e-06 | NA | 3.45e-13 | NA |
| 7. B | Q64617 | Protein kinase C eta type | 1.19e-06 | NA | 2.27e-10 | NA |
| 7. B | C0LGQ7 | Probable LRR receptor-like serine/threonine-protein kinase At4g20450 | 4.03e-04 | NA | 4.95e-09 | NA |
| 7. B | Q9SFX0 | Probable serine/threonine-protein kinase PBL22 | 1.81e-05 | NA | 4.21e-08 | NA |
| 7. B | Q9LYQ8 | CBL-interacting serine/threonine-protein kinase 2 | 2.34e-07 | NA | 2.81e-14 | NA |
| 7. B | Q54PK8 | Probable serine/threonine-protein kinase DDB_G0284491 | 2.29e-04 | NA | 1.22e-05 | NA |
| 7. B | P05532 | Mast/stem cell growth factor receptor Kit | 8.55e-04 | NA | 8.07e-07 | NA |
| 7. B | P16277 | Tyrosine-protein kinase Blk | 8.84e-12 | NA | 2.79e-10 | NA |
| 7. B | P14616 | Insulin receptor-related protein | 1.39e-03 | NA | 1.19e-09 | NA |
| 7. B | Q93VD3 | CBL-interacting serine/threonine-protein kinase 23 | 1.76e-07 | NA | 1.89e-20 | NA |
| 7. B | P63185 | Tyrosine-protein kinase transforming protein Src | NA | NA | 1.71e-09 | NA |
| 7. B | Q90670 | Activin receptor type-2B | 3.67e-05 | NA | 1.79e-07 | NA |
| 7. B | O65468 | Cysteine-rich receptor-like protein kinase 8 | 6.45e-05 | NA | 5.87e-08 | NA |
| 7. B | Q0D4B2 | CBL-interacting protein kinase 21 | 1.00e-07 | NA | 1.23e-18 | NA |
| 7. B | Q65X23 | Probable serine/threonine-protein kinase WNK2 | 5.24e-06 | NA | 3.20e-06 | NA |
| 7. B | P36894 | Bone morphogenetic protein receptor type-1A | 2.21e-07 | NA | 0.001 | NA |
| 7. B | F4JZW1 | Serine/threonine-protein kinase PBL13 | 2.83e-07 | NA | 1.98e-11 | NA |
| 7. B | Q9SJM3 | Serine/threonine-protein kinase KIPK2 | 2.88e-05 | NA | 1.51e-04 | NA |
| 7. B | Q8IVW4 | Cyclin-dependent kinase-like 3 | 4.38e-08 | NA | 7.45e-15 | NA |
| 7. B | O74304 | MAP kinase kinase kinase win1 | 2.26e-04 | NA | 1.01e-13 | NA |
| 7. B | Q9SAH3 | Putative receptor-like protein kinase At1g80870 | 2.10e-02 | NA | 5.09e-04 | NA |
| 7. B | Q9S9M2 | Wall-associated receptor kinase-like 4 | 3.78e-04 | NA | 2.11e-12 | NA |
| 7. B | Q05397 | Focal adhesion kinase 1 | 1.66e-04 | NA | 1.02e-10 | NA |
| 7. B | O65238 | G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 | 1.04e-03 | NA | 1.16e-10 | NA |
| 7. B | Q9XEC7 | Cysteine-rich receptor-like protein kinase 37 | 5.60e-05 | NA | 1.57e-08 | NA |
| 7. B | C0LGH3 | Probable LRR receptor-like serine/threonine-protein kinase At1g56140 | 2.65e-03 | NA | 6.11e-08 | NA |
| 7. B | Q9C5S2 | Serine/threonine-protein kinase/endoribonuclease IRE1a | 4.66e-04 | NA | 3.39e-07 | NA |
| 7. B | Q9M8J5 | Mitogen-activated protein kinase kinase 8 | 7.75e-10 | NA | 3.70e-11 | NA |
| 7. B | Q6Z8C8 | Cyclin-dependent kinase F-4 | 1.46e-08 | NA | 2.00e-10 | NA |
| 7. B | Q7ZVS3 | Serine/threonine-protein kinase PLK4 | 4.00e-08 | NA | 2.68e-17 | NA |
| 7. B | P00530 | Tyrosine-protein kinase transforming protein Fps | NA | NA | 6.63e-13 | NA |
| 7. B | O61267 | Ovarian-specific serine/threonine-protein kinase Lok | 4.68e-09 | NA | 1.30e-21 | NA |
| 7. B | Q6VAB6 | Kinase suppressor of Ras 2 | 5.32e-06 | NA | 3.65e-04 | NA |
| 7. B | P14084 | Tyrosine-protein kinase transforming protein Src | NA | NA | 2.90e-08 | NA |
| 7. B | Q6R2J8 | Protein STRUBBELIG-RECEPTOR FAMILY 8 | 8.09e-05 | NA | 4.45e-04 | NA |
| 7. B | O94804 | Serine/threonine-protein kinase 10 | 3.90e-06 | NA | 9.58e-13 | NA |
| 7. B | O49545 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 | 3.83e-06 | NA | 3.16e-05 | NA |
| 7. B | P51567 | Serine/threonine-protein kinase AFC2 | 2.35e-07 | NA | 3.79e-10 | NA |
| 7. B | E9PTG8 | Serine/threonine-protein kinase 10 | 5.20e-06 | NA | 1.66e-13 | NA |
| 7. B | P00536 | Proto-oncogene serine/threonine-protein kinase mos | 1.80e-13 | NA | 1.11e-12 | NA |
| 7. B | P67999 | Ribosomal protein S6 kinase beta-1 | 1.17e-07 | NA | 4.79e-12 | NA |
| 7. B | A1CHL6 | Serine/threonine-protein kinase atg1 | 3.28e-08 | NA | 1.07e-07 | NA |
| 7. B | F4JY37 | Serine/threonine-protein kinase RUNKEL | 1.25e-04 | NA | 3.60e-10 | NA |
| 7. B | Q9T0J1 | Cysteine-rich receptor-like protein kinase 26 | 3.27e-04 | NA | 6.83e-09 | NA |
| 7. B | Q9Z1B7 | Mitogen-activated protein kinase 13 | 1.13e-07 | NA | 1.05e-13 | NA |
| 7. B | O13147 | Ephrin type-B receptor 3 (Fragment) | 2.32e-06 | NA | 9.73e-13 | NA |
| 7. B | Q13188 | Serine/threonine-protein kinase 3 | 4.24e-08 | NA | 5.52e-09 | NA |
| 7. B | P31152 | Mitogen-activated protein kinase 4 | 5.28e-08 | NA | 1.97e-12 | NA |
| 7. B | Q63117 | Dual specificity protein kinase CLK3 | 1.82e-08 | NA | 1.16e-10 | NA |
| 7. B | Q76MJ5 | Serine/threonine-protein kinase/endoribonuclease IRE2 | 1.74e-03 | NA | 1.33e-08 | NA |
| 7. B | F4I4F2 | Serine/threonine-protein kinase RHS3 | 7.99e-07 | NA | 8.79e-05 | NA |
| 7. B | Q5APR8 | Serine/threonine-protein kinase CLA4 | 6.04e-05 | NA | 2.60e-11 | NA |
| 7. B | P18475 | Tyrosine-protein kinase receptor torso | 7.07e-05 | NA | 6.42e-08 | NA |
| 7. B | P10533 | Serine/threonine-protein kinase-transforming protein Rmil | NA | NA | 5.41e-16 | NA |
| 7. B | P38147 | Serine/threonine-protein kinase CHK1 | 9.81e-07 | NA | 1.50e-15 | NA |
| 7. B | Q54C38 | Probable serine/threonine-protein kinase DDB_G0293292 | 4.16e-02 | NA | 7.32e-08 | NA |
| 7. B | P48562 | Serine/threonine-protein kinase CLA4 | 1.36e-05 | NA | 4.39e-12 | NA |
| 7. B | Q54VU4 | Probable serine/threonine-protein kinase DDB_G0280133 | 5.08e-04 | NA | 1.55e-11 | NA |
| 7. B | Q54TW2 | Probable serine/threonine-protein kinase pdkA | 6.80e-05 | NA | 4.98e-10 | NA |
| 7. B | Q5CD18 | TGF-beta receptor type-1 | 2.36e-10 | NA | 0.001 | NA |
| 7. B | O65482 | Putative cysteine-rich receptor-like protein kinase 23 | 8.72e-04 | NA | 3.24e-08 | NA |
| 7. B | O12990 | Tyrosine-protein kinase JAK1 | 2.03e-04 | NA | 2.16e-11 | NA |
| 7. B | Q0V7T5 | Probable receptor-like protein kinase At1g80640 | 1.21e-04 | NA | 5.32e-07 | NA |
| 7. B | Q9LDT0 | Putative cysteine-rich receptor-like protein kinase 30 | 9.84e-05 | NA | 4.05e-07 | NA |
| 7. B | Q3Y416 | Calcium/calmodulin-dependent protein kinase kinase | 6.09e-07 | NA | 1.72e-13 | NA |
| 7. B | Q8JG38 | Fibroblast growth factor receptor 2 | 6.58e-05 | NA | 1.34e-08 | NA |
| 7. B | Q9M3E5 | Putative L-type lectin-domain containing receptor kinase I.1 | 5.09e-04 | NA | 5.74e-05 | NA |
| 7. B | O54874 | Serine/threonine-protein kinase MRCK alpha | 1.89e-03 | NA | 1.50e-15 | NA |
| 7. B | Q14AX6 | Cyclin-dependent kinase 12 | 1.49e-03 | NA | 8.36e-07 | NA |
| 7. B | Q03114 | Cyclin-dependent-like kinase 5 | 1.44e-15 | NA | 1.43e-11 | NA |
| 7. B | P22216 | Serine/threonine-protein kinase RAD53 | 5.43e-06 | NA | 1.80e-14 | NA |
| 7. B | Q69ZA1 | Cyclin-dependent kinase 13 | 5.48e-03 | NA | 1.76e-07 | NA |
| 7. B | Q6Z9F4 | CBL-interacting protein kinase 6 | 1.24e-08 | NA | 7.42e-18 | NA |
| 7. B | Q9C660 | Proline-rich receptor-like protein kinase PERK10 | 2.11e-04 | NA | 1.22e-06 | NA |
| 7. B | Q9Z2P5 | Receptor-interacting serine/threonine-protein kinase 3 | 3.57e-08 | NA | 2.42e-05 | NA |
| 7. B | Q28317 | Mast/stem cell growth factor receptor Kit | 2.10e-02 | NA | 1.84e-07 | NA |
| 7. B | P32866 | G protein-coupled receptor kinase 2 | 3.69e-06 | NA | 7.06e-11 | NA |
| 7. B | O22476 | Protein BRASSINOSTEROID INSENSITIVE 1 | 3.78e-03 | NA | 1.50e-11 | NA |
| 7. B | Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 | 4.08e-02 | NA | 5.20e-07 | NA |
| 7. B | O94806 | Serine/threonine-protein kinase D3 | 1.40e-04 | NA | 5.89e-11 | NA |
| 7. B | Q7PLI7 | Serine/threonine-protein kinase CG17528 | 7.26e-10 | NA | 8.59e-10 | NA |
| 7. B | Q8WQG9 | Stress-activated protein kinase jnk-1 | 7.62e-07 | NA | 5.33e-14 | NA |
| 7. B | Q5XIT0 | Cyclin-dependent kinase-like 2 | 6.91e-10 | NA | 3.81e-13 | NA |
| 7. B | Q23551 | Twitchin | NA | NA | 3.31e-17 | NA |
| 7. B | Q22146 | Fer-related kinase 1 | 1.24e-12 | NA | 1.57e-07 | NA |
| 7. B | Q9ZUE0 | Proline-rich receptor-like protein kinase PERK12 | 1.25e-04 | NA | 3.40e-07 | NA |
| 7. B | Q8GYF5 | Wall-associated receptor kinase-like 21 | 3.08e-04 | NA | 1.19e-08 | NA |
| 7. B | O24585 | Putative receptor protein kinase CRINKLY4 | 1.03e-03 | NA | 4.17e-08 | NA |
| 7. B | Q9R1L5 | Microtubule-associated serine/threonine-protein kinase 1 | 1.56e-03 | NA | 8.02e-16 | NA |
| 7. B | Q5QN75 | Mitogen-activated protein kinase kinase 1 | 7.58e-11 | NA | 7.47e-11 | NA |
| 7. B | P42682 | Tyrosine-protein kinase TXK | 2.97e-11 | NA | 1.01e-09 | NA |
| 7. B | Q8GX23 | Proline-rich receptor-like protein kinase PERK5 | 5.69e-05 | NA | 4.25e-06 | NA |
| 7. B | Q39024 | Mitogen-activated protein kinase 4 | 4.97e-08 | NA | 1.71e-12 | NA |
| 7. B | Q5AHA0 | Histidine protein kinase 1 | 4.36e-01 | NA | 3.09e-06 | NA |
| 7. B | Q9C9L5 | Wall-associated receptor kinase-like 9 | 5.96e-04 | NA | 3.27e-09 | NA |
| 7. B | G4SLH0 | Titin homolog | NA | NA | 9.62e-12 | NA |
| 7. B | Q07407 | Fibroblast growth factor receptor homolog 1 | 2.43e-05 | NA | 1.87e-07 | NA |
| 7. B | Q67X31 | LRR receptor kinase SERK2 | 3.44e-04 | NA | 1.25e-07 | NA |
| 7. B | Q6FN53 | Serine/threonine-protein kinase STE20 | 7.97e-07 | NA | 1.49e-10 | NA |
| 7. B | Q8VBY2 | Calcium/calmodulin-dependent protein kinase kinase 1 | 2.76e-07 | NA | 1.69e-10 | NA |
| 7. B | Q09499 | Serine/threonine-protein kinase/endoribonuclease ire-1 | 3.07e-04 | NA | 2.55e-07 | NA |
| 7. B | Q61161 | Mitogen-activated protein kinase kinase kinase kinase 2 | 4.35e-05 | NA | 1.85e-16 | NA |
| 7. B | P06782 | Carbon catabolite-derepressing protein kinase | 2.00e-07 | NA | 2.66e-13 | NA |
| 7. B | P32593 | Serine/threonine-protein kinase-transforming protein mos | NA | NA | 7.43e-11 | NA |
| 7. B | Q6EWH2 | Tyrosine-protein kinase fyna | 6.09e-11 | NA | 6.25e-10 | NA |
| 7. B | Q9S7I6 | LRR receptor-like serine/threonine-protein kinase RPK2 | 3.41e-03 | NA | 3.98e-09 | NA |
| 7. B | P43298 | Receptor protein kinase TMK1 | 2.85e-03 | NA | 4.98e-09 | NA |
| 7. B | E9PSL7 | Citron rho-interacting kinase | 5.62e-03 | NA | 2.25e-16 | NA |
| 7. B | Q9LZV7 | Leucine-rich repeat receptor-like protein kinase PXC2 | 1.41e-03 | NA | 1.22e-12 | NA |
| 7. B | P70451 | Tyrosine-protein kinase Fer | 1.13e-08 | NA | 1.35e-12 | NA |
| 7. B | P06240 | Proto-oncogene tyrosine-protein kinase LCK | 1.45e-08 | NA | 1.22e-09 | NA |
| 7. B | Q14680 | Maternal embryonic leucine zipper kinase | 7.13e-07 | NA | 1.44e-10 | NA |
| 7. B | Q13308 | Inactive tyrosine-protein kinase 7 | 4.68e-07 | NA | 1.65e-08 | NA |
| 7. B | Q54DY0 | Probable serine/threonine-protein kinase DDB_G0291918 | 1.18e-05 | NA | 0.006 | NA |
| 7. B | A2KF29 | Sperm motility kinase Tcr mutant form | 1.27e-07 | NA | 1.37e-10 | NA |
| 7. B | C0LGH2 | Probable LRR receptor-like serine/threonine-protein kinase At1g56130 | 1.04e-03 | NA | 1.89e-08 | NA |
| 7. B | P9WI81 | Serine/threonine-protein kinase PknB | 6.37e-08 | NA | 5.11e-23 | NA |
| 7. B | P28652 | Calcium/calmodulin-dependent protein kinase type II subunit beta | 2.50e-09 | NA | 1.43e-13 | NA |
| 7. B | O08775 | Vascular endothelial growth factor receptor 2 | 1.98e-05 | NA | 2.92e-07 | NA |
| 7. B | O55098 | Serine/threonine-protein kinase 10 | 3.77e-06 | NA | 1.08e-13 | NA |
| 7. B | A0A0B4J2F2 | Putative serine/threonine-protein kinase SIK1B | 2.14e-06 | NA | 8.47e-11 | NA |
| 7. B | Q8UVR8 | Macrophage colony-stimulating factor 1 receptor 2 | 1.28e-04 | NA | 1.63e-06 | NA |
| 7. B | Q9UKE5 | TRAF2 and NCK-interacting protein kinase | 4.42e-04 | NA | 4.41e-14 | NA |
| 7. B | Q9SYS3 | Cysteine-rich receptor-like protein kinase 40 | 5.29e-05 | NA | 3.97e-07 | NA |
| 7. B | Q94C77 | Receptor protein kinase-like protein At4g34220 | 6.77e-05 | NA | 3.56e-06 | NA |
| 7. B | Q6CXN5 | Probable serine/threonine-protein kinase HAL5-like | 8.53e-05 | NA | 5.18e-08 | NA |
| 7. B | Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 | 1.73e-06 | NA | 5.89e-09 | NA |
| 7. B | P48609 | Cyclin-dependent kinase 5 homolog | 2.11e-15 | NA | 1.04e-11 | NA |
| 7. B | Q336X9 | Mitogen-activated protein kinase 6 | 5.63e-08 | NA | 3.07e-13 | NA |
| 7. B | O35099 | Mitogen-activated protein kinase kinase kinase 5 | 3.87e-03 | NA | 8.40e-16 | NA |
| 7. B | Q25AG2 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4 | 1.54e-04 | NA | 6.67e-11 | NA |
| 7. B | Q9T058 | G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900 | 3.63e-04 | NA | 2.71e-07 | NA |
| 7. B | Q3UGM2 | Serine/threonine-protein kinase Nek10 | 3.76e-06 | NA | 4.73e-16 | NA |
| 7. B | Q9FXQ3 | Calcium-dependent protein kinase 13 | 1.54e-09 | NA | 7.00e-12 | NA |
| 7. B | Q9FZ36 | Mitogen-activated protein kinase kinase kinase 2 | 1.63e-07 | NA | 1.72e-16 | NA |
| 7. B | D3ZBE5 | Serine/threonine-protein kinase Nek7 | 0.00e+00 | NA | 1.12e-18 | NA |
| 7. B | Q8BYR2 | Serine/threonine-protein kinase LATS1 | 4.16e-03 | NA | 9.59e-07 | NA |
| 7. B | Q04735 | Cyclin-dependent kinase 16 | 2.90e-12 | NA | 5.56e-13 | NA |
| 7. B | Q9FLV4 | G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080 | 1.72e-03 | NA | 2.19e-10 | NA |
| 7. B | Q6NKZ9 | Probable receptor-like serine/threonine-protein kinase At4g34500 | 1.66e-05 | NA | 3.25e-08 | NA |
| 7. B | Q53P85 | Calcium-dependent protein kinase 24 | 4.15e-10 | NA | 9.18e-13 | NA |
| 7. B | P25859 | Cyclin-dependent kinase B1-1 | 5.66e-15 | NA | 7.22e-08 | NA |
| 7. B | Q54U65 | Seven transmembrane domain-containing serine/threonine-protein kinase 2 | 7.27e-03 | NA | 0.015 | NA |
| 7. B | Q9Z139 | Inactive tyrosine-protein kinase transmembrane receptor ROR1 | 1.47e-07 | NA | 1.31e-04 | NA |
| 7. B | P20792 | Cell surface receptor daf-1 | 1.01e-05 | NA | 6.02e-07 | NA |
| 7. B | O70405 | Serine/threonine-protein kinase ULK1 | 2.95e-05 | NA | 2.94e-18 | NA |
| 7. B | Q3MJK5 | Cyclin-dependent kinase 12 | 2.88e-03 | NA | 8.36e-07 | NA |
| 7. B | O44997 | Death-associated protein kinase dapk-1 | 6.10e-05 | NA | 1.87e-16 | NA |
| 7. B | Q9LX29 | Serine/threonine-protein kinase-like protein ACR4 | 2.01e-03 | NA | 8.41e-09 | NA |
| 7. B | O14328 | Serine/threonine-protein kinase ksp1 | 7.52e-08 | NA | 9.34e-15 | NA |
| 7. B | Q9ZQR3 | Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 | 2.21e-03 | NA | 2.08e-05 | NA |
| 7. B | Q90413 | Fibroblast growth factor receptor 4 | 1.64e-05 | NA | 3.27e-07 | NA |
| 7. B | Q86IX1 | Serine/threonine-protein kinase dst1 | 2.30e-06 | NA | 8.82e-12 | NA |
| 7. B | Q9R011 | Serine/threonine-protein kinase PLK3 | 2.95e-06 | NA | 8.73e-17 | NA |
| 7. B | Q852Q2 | Serine/threonine protein kinase OSK1 | 4.35e-08 | NA | 4.21e-17 | NA |
| 7. B | Q8C0X8 | Sperm motility kinase X | 5.71e-07 | NA | 8.98e-12 | NA |
| 7. B | Q28041 | Activin receptor type-1 | 2.21e-10 | NA | 3.88e-05 | NA |
| 7. B | Q6ICW6 | Probable serine/threonine-protein kinase WNK11 | 9.69e-14 | NA | 6.83e-08 | NA |
| 7. B | P16234 | Platelet-derived growth factor receptor alpha | 1.92e-03 | NA | 3.85e-05 | NA |
| 7. B | Q0PW40 | Cysteine-rich receptor-like protein kinase 13 | 1.30e-04 | NA | 8.96e-07 | NA |
| 7. B | P27636 | Cell division control protein 15 | 2.09e-05 | NA | 8.92e-14 | NA |
| 7. B | Q96GD4 | Aurora kinase B | 3.03e-14 | NA | 1.09e-05 | NA |
| 7. B | Q9VKN7 | Aurora kinase B | 2.87e-08 | NA | 1.93e-11 | NA |
| 7. B | Q7SY49 | CaM kinase-like vesicle-associated protein | 2.18e-10 | NA | 3.20e-07 | NA |
| 7. B | Q09815 | Serine/threonine-protein kinase ppk5 | 1.29e-06 | NA | 3.58e-10 | NA |
| 7. B | Q9FL63 | Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100 | 1.26e-04 | NA | 9.18e-07 | NA |
| 7. B | Q54VI1 | Probable serine/threonine-protein kinase fhkE | 2.22e-07 | NA | 1.13e-16 | NA |
| 7. B | Q1LUA6 | Triple functional domain protein | NA | NA | 2.08e-10 | NA |
| 7. B | O88831 | Calcium/calmodulin-dependent protein kinase kinase 2 | 9.62e-07 | NA | 2.13e-12 | NA |
| 7. B | Q9NYL2 | Mitogen-activated protein kinase kinase kinase 20 | 3.92e-07 | NA | 1.18e-06 | NA |
| 7. B | Q9ASQ6 | Probable LRR receptor-like serine/threonine-protein kinase At1g29720 | 3.95e-03 | NA | 1.42e-11 | NA |
| 7. B | Q8L4H4 | Nodulation receptor kinase | 7.15e-03 | NA | 3.86e-06 | NA |
| 7. B | P9WI71 | Serine/threonine-protein kinase PknH | 1.38e-09 | NA | 1.19e-24 | NA |
| 7. B | P28926 | Serine/threonine-protein kinase US3 homolog | NA | NA | 3.29e-06 | NA |
| 7. B | P06241 | Tyrosine-protein kinase Fyn | 6.28e-11 | NA | 1.13e-09 | NA |
| 7. B | A2YCH5 | Cyclin-dependent kinase F-1 | 6.70e-05 | NA | 5.75e-08 | NA |
| 7. B | Q60680 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 2.30e-04 | NA | 2.67e-11 | NA |
| 7. B | Q9LVI6 | Probable inactive receptor kinase RLK902 | 5.94e-09 | NA | 3.23e-07 | NA |
| 7. B | Q63132 | Proto-oncogene tyrosine-protein kinase ROS | 1.38e-03 | NA | 2.27e-07 | NA |
| 7. B | G5EFM9 | Serine/threonine-protein kinase nekl-3 | 0.00e+00 | NA | 7.53e-19 | NA |
| 7. B | Q63184 | Interferon-induced, double-stranded RNA-activated protein kinase | 6.36e-06 | NA | 2.06e-11 | NA |
| 7. B | Q9H0K1 | Serine/threonine-protein kinase SIK2 | 1.74e-05 | NA | 3.34e-08 | NA |
| 7. B | Q5F2E8 | Serine/threonine-protein kinase TAO1 | 4.90e-06 | NA | 8.10e-08 | NA |
| 7. B | Q8C078 | Calcium/calmodulin-dependent protein kinase kinase 2 | 9.35e-07 | NA | 2.08e-12 | NA |
| 7. B | Q07912 | Activated CDC42 kinase 1 | 3.17e-05 | NA | 9.41e-08 | NA |
| 7. B | P00540 | Proto-oncogene serine/threonine-protein kinase mos | 2.19e-13 | NA | 1.32e-12 | NA |
| 7. B | P11275 | Calcium/calmodulin-dependent protein kinase type II subunit alpha | 1.76e-08 | NA | 3.60e-13 | NA |
| 7. B | Q55F45 | Probable serine/threonine-protein kinase DDB_G0268642 | 1.10e-01 | NA | 0.005 | NA |
| 7. B | Q86HN7 | Probable serine/threonine-protein kinase PLK | 2.02e-06 | NA | 3.14e-15 | NA |
| 7. B | P43481 | Mast/stem cell growth factor receptor Kit | 7.40e-04 | NA | 1.99e-07 | NA |
| 7. B | Q54B48 | Probable serine/threonine-protein kinase DDB_G0293958 | 5.89e-03 | NA | 3.10e-04 | NA |
| 7. B | O49564 | Cysteine-rich receptor-like protein kinase 27 | 1.57e-04 | NA | 2.56e-07 | NA |
| 7. B | Q2HWD6 | Mast/stem cell growth factor receptor Kit | 1.76e-03 | NA | 2.03e-07 | NA |
| 7. B | Q9QUK0 | Cyclin-dependent kinase-like 2 | 8.15e-09 | NA | 4.97e-13 | NA |
| 7. B | Q14289 | Protein-tyrosine kinase 2-beta | 1.22e-04 | NA | 1.29e-07 | NA |
| 7. B | P21803 | Fibroblast growth factor receptor 2 | 5.24e-05 | NA | 9.98e-08 | NA |
| 7. B | C0LGE4 | Probable LRR receptor-like serine/threonine-protein kinase At1g12460 | 1.86e-04 | NA | 0.045 | NA |
| 7. B | P07333 | Macrophage colony-stimulating factor 1 receptor | 5.05e-04 | NA | 3.77e-08 | NA |
| 7. B | Q9FF31 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.1 | 2.16e-04 | NA | 7.55e-07 | NA |
| 7. B | P22607 | Fibroblast growth factor receptor 3 | 5.38e-05 | NA | 3.35e-07 | NA |
| 7. B | P49615 | Cyclin-dependent-like kinase 5 | 1.55e-15 | NA | 4.87e-12 | NA |
| 7. B | Q91VB2 | Calcium/calmodulin-dependent protein kinase type 1G | 2.04e-09 | NA | 5.92e-16 | NA |
| 7. B | Q9SXB3 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 | 4.47e-04 | NA | 1.04e-05 | NA |
| 7. B | Q8C015 | Serine/threonine-protein kinase PAK 5 | 6.39e-05 | NA | 4.07e-12 | NA |
| 7. B | P53671 | LIM domain kinase 2 | 9.14e-08 | NA | 3.43e-05 | NA |
| 7. B | Q62868 | Rho-associated protein kinase 2 | 5.76e-04 | NA | 8.56e-13 | NA |
| 7. B | P07948 | Tyrosine-protein kinase Lyn | 1.21e-11 | NA | 3.08e-11 | NA |
| 7. B | P35991 | Tyrosine-protein kinase BTK | 2.89e-10 | NA | 6.99e-08 | NA |
| 7. B | O73798 | Insulin-like growth factor 1 receptor | 4.49e-04 | NA | 2.91e-10 | NA |
| 7. B | P87347 | Serine/threonine-protein kinase mos (Fragment) | 2.86e-08 | NA | 4.63e-09 | NA |
| 7. B | Q9SH71 | Putative inactive receptor-like protein kinase At1g64210 | 1.65e-05 | NA | 4.33e-05 | NA |
| 7. B | Q9M0X5 | Cysteine-rich receptor-like protein kinase 25 | 8.08e-05 | NA | 7.25e-09 | NA |
| 7. B | Q9FL51 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 | 4.58e-04 | NA | 6.32e-05 | NA |
| 7. B | Q2RBE3 | Probable serine/threonine-protein kinase WNK7 | 2.28e-05 | NA | 3.01e-07 | NA |
| 7. B | P9WI67 | Serine/threonine-protein kinase PknJ | 2.37e-10 | NA | 7.18e-17 | NA |
| 7. B | Q13177 | Serine/threonine-protein kinase PAK 2 | 1.64e-07 | NA | 3.34e-11 | NA |
| 7. B | Q852Q1 | Serine/threonine protein kinase OSK4 | 8.75e-08 | NA | 2.63e-14 | NA |
| 7. B | Q11179 | Mitogen-activated protein kinase 15 | 7.13e-08 | NA | 4.91e-15 | NA |
| 7. B | P27450 | Probable serine/threonine-protein kinase CST | 1.35e-05 | NA | 5.11e-12 | NA |
| 7. B | O14733 | Dual specificity mitogen-activated protein kinase kinase 7 | 1.10e-09 | NA | 1.87e-13 | NA |
| 7. B | Q6UD73 | LysM domain receptor-like kinase 3 | 1.60e-04 | NA | 4.18e-08 | NA |
| 7. B | Q8IR79 | LIM domain kinase 1 | 2.20e-03 | NA | 0.003 | NA |
| 7. B | P49336 | Cyclin-dependent kinase 8 | 4.66e-07 | NA | 4.18e-05 | NA |
| 7. B | P97504 | Cytoplasmic tyrosine-protein kinase BMX | 1.74e-07 | NA | 6.39e-12 | NA |
| 7. B | Q60823 | RAC-beta serine/threonine-protein kinase | 3.12e-08 | NA | 2.08e-14 | NA |
| 7. B | Q9SR87 | Probable L-type lectin-domain containing receptor kinase VI.1 | 1.16e-04 | NA | 2.33e-07 | NA |
| 7. B | Q93V58 | Serine/threonine-protein kinase GRIK1 | 2.68e-09 | NA | 2.89e-15 | NA |
| 7. B | Q9R0G8 | Nik-related protein kinase | 4.78e-04 | NA | 2.01e-15 | NA |
| 7. B | Q54S77 | Probable serine/threonine-protein kinase vps15 | 3.06e-02 | NA | 0.004 | NA |
| 7. B | P53767 | Vascular endothelial growth factor receptor 1 | 2.54e-05 | NA | 1.39e-08 | NA |
| 7. B | F4IB81 | LysM domain receptor-like kinase 3 | 4.62e-04 | NA | 1.53e-06 | NA |
| 7. B | Q9FYK0 | Receptor-like kinase TMK2 | 1.57e-03 | NA | 8.95e-08 | NA |
| 7. B | Q9BYP7 | Serine/threonine-protein kinase WNK3 | 7.58e-04 | NA | 6.03e-10 | NA |
| 7. B | Q9H093 | NUAK family SNF1-like kinase 2 | 3.98e-08 | NA | 2.21e-13 | NA |
| 7. B | Q06486 | Casein kinase I isoform delta | 2.17e-10 | NA | 5.94e-13 | NA |
| 7. B | P00525 | Tyrosine-protein kinase transforming protein Src | NA | NA | 6.62e-09 | NA |
| 7. B | Q76P07 | Probable serine/threonine-protein kinase DDB_G0277165 | 3.05e-05 | NA | 6.42e-23 | NA |
| 7. B | O95382 | Mitogen-activated protein kinase kinase kinase 6 | 4.15e-03 | NA | 1.04e-11 | NA |
| 7. B | Q93YN1 | Cold-responsive protein kinase 1 | 1.52e-06 | NA | 1.53e-11 | NA |
| 7. B | Q9XIC7 | Somatic embryogenesis receptor kinase 2 | 6.25e-04 | NA | 1.22e-06 | NA |
| 7. B | Q62662 | Tyrosine-protein kinase FRK | 1.09e-11 | NA | 3.68e-09 | NA |
| 7. B | P38623 | Serine/threonine-protein kinase RCK2 | 9.89e-08 | NA | 3.26e-08 | NA |
| 7. B | Q60EZ2 | Shaggy-related protein kinase GSK2 | 1.43e-08 | NA | 1.13e-07 | NA |
| 7. B | C0LGD9 | Probable LRR receptor-like serine/threonine-protein kinase At1g07560 | 7.33e-04 | NA | 3.88e-07 | NA |
| 7. B | O76360 | cGMP-dependent protein kinase egl-4 | 1.30e-06 | NA | 7.55e-09 | NA |
| 7. B | O55173 | 3-phosphoinositide-dependent protein kinase 1 | 3.20e-07 | NA | 2.34e-11 | NA |
| 7. B | F4J0D2 | Serine/threonine-protein kinase PBL36 | 8.74e-06 | NA | 1.27e-11 | NA |
| 7. B | C0LGX3 | LRR receptor-like serine/threonine-protein kinase HSL2 | 1.26e-03 | NA | 9.90e-08 | NA |
| 7. B | O75914 | Serine/threonine-protein kinase PAK 3 | 4.05e-07 | NA | 5.65e-12 | NA |
| 7. B | Q9ZWB3 | Casein kinase 1-like protein 9 | 7.82e-09 | NA | 4.21e-10 | NA |
| 7. B | Q9XEC6 | Cysteine-rich receptor-like protein kinase 36 | 2.34e-04 | NA | 2.82e-09 | NA |
| 7. B | C0LGP9 | Probable leucine-rich repeat receptor-like protein kinase IMK3 | 2.44e-04 | NA | 2.16e-04 | NA |
| 7. B | P43404 | Tyrosine-protein kinase ZAP-70 | 9.70e-08 | NA | 9.73e-10 | NA |
| 7. B | Q75JN1 | Probable serine/threonine-protein kinase ifkC | 8.17e-01 | NA | 2.51e-04 | NA |
| 7. B | O64639 | Receptor-like serine/threonine-protein kinase At2g45590 | 4.17e-02 | NA | 1.76e-05 | NA |
| 7. B | Q06806 | Tyrosine-protein kinase receptor Tie-1 | 6.91e-07 | NA | 1.10e-04 | NA |
| 7. B | P08103 | Tyrosine-protein kinase HCK | 3.84e-11 | NA | 1.78e-11 | NA |
| 7. B | Q9JIH7 | Serine/threonine-protein kinase WNK1 | 3.67e-03 | NA | 1.82e-09 | NA |
| 7. B | Q75KK8 | Mitogen-activated protein kinase 14 | 1.85e-05 | NA | 4.65e-17 | NA |
| 7. B | Q5UPU3 | Putative serine/threonine-protein kinase L268 | NA | NA | 1.61e-07 | NA |
| 7. B | Q5GIT4 | Vascular endothelial growth factor receptor 2 | 2.98e-05 | NA | 2.05e-06 | NA |
| 7. B | Q9C9N5 | Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 | 4.36e-05 | NA | 6.50e-05 | NA |
| 7. B | Q9LTC0 | Probable serine/threonine-protein kinase PBL19 | 1.25e-05 | NA | 4.26e-10 | NA |
| 7. B | Q8BWD8 | Cyclin-dependent kinase 19 | 9.99e-05 | NA | 3.14e-05 | NA |
| 7. B | P49657 | Serine/threonine-protein kinase minibrain | 1.29e-05 | NA | 1.65e-09 | NA |
| 7. B | Q95UN8 | Mitogen-activated protein kinase kinase kinase | 2.46e-06 | NA | 7.95e-07 | NA |
| 7. B | Q8NER5 | Activin receptor type-1C | 1.52e-10 | NA | 4.47e-06 | NA |
| 7. B | Q9LHP4 | LRR receptor-like serine/threonine-protein kinase RGI1 | 2.35e-02 | NA | 1.58e-05 | NA |
| 7. B | Q9FID6 | Probable receptor-like protein kinase At5g39020 | 2.00e-03 | NA | 1.28e-04 | NA |
| 7. B | P70236 | Dual specificity mitogen-activated protein kinase kinase 6 | 2.00e-10 | NA | 1.71e-12 | NA |
| 7. B | Q63531 | Ribosomal protein S6 kinase alpha-1 | 1.80e-06 | NA | 5.92e-15 | NA |
| 7. B | O15021 | Microtubule-associated serine/threonine-protein kinase 4 | 3.04e-02 | NA | 7.68e-16 | NA |
| 7. B | G3V9H8 | Proto-oncogene tyrosine-protein kinase receptor Ret | 2.06e-03 | NA | 3.37e-09 | NA |
| 7. B | Q6XHB2 | Probable serine/threonine-protein kinase roco4 | 1.63e-03 | NA | 6.15e-09 | NA |
| 7. B | Q11090 | Putative serine/threonine-protein kinase C01C4.3 | 4.01e-06 | NA | 1.18e-04 | NA |
| 7. B | Q9XTF3 | Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 | 2.75e-05 | NA | 1.91e-09 | NA |
| 7. B | P34244 | Probable serine/threonine-protein kinase HSL1 | 2.39e-03 | NA | 8.64e-13 | NA |
| 7. B | Q0JEU6 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3 | 1.76e-04 | NA | 1.58e-09 | NA |
| 7. B | Q9FHX3 | L-type lectin-domain containing receptor kinase S.6 | 2.39e-04 | NA | 3.77e-08 | NA |
| 7. B | A1A5H8 | Tyrosine-protein kinase yes | 5.19e-11 | NA | 5.29e-07 | NA |
| 7. B | P70507 | G protein-coupled receptor kinase 4 | 2.19e-06 | NA | 4.56e-12 | NA |
| 7. B | Q07174 | Mitogen-activated protein kinase kinase kinase 8 | 1.54e-07 | NA | 3.47e-06 | NA |
| 7. B | Q3E9X6 | Cysteine-rich receptor-like protein kinase 21 | 7.60e-05 | NA | 4.77e-06 | NA |
| 7. B | P54644 | RAC family serine/threonine-protein kinase homolog | 3.65e-08 | NA | 4.04e-12 | NA |
| 7. B | Q8BYG9 | Ephrin type-A receptor 10 | 1.54e-04 | NA | 2.35e-07 | NA |
| 7. B | Q62413 | Ephrin type-A receptor 6 | 7.82e-04 | NA | 6.44e-08 | NA |
| 7. B | P06213 | Insulin receptor | 3.81e-04 | NA | 5.11e-09 | NA |
| 7. B | Q5XIS9 | Serine/threonine-protein kinase D2 | 5.89e-05 | NA | 2.23e-12 | NA |
| 7. B | O01583 | Serine/threonine-protein kinase mrck-1 | 1.13e-03 | NA | 3.42e-10 | NA |
| 7. B | Q8K3H5 | Myosin-IIIa | 1.42e-03 | NA | 1.54e-16 | NA |
| 7. B | P25020 | Tyrosine-protein kinase transforming protein Src | NA | NA | 8.80e-09 | NA |
| 7. B | Q66T47 | Activin receptor type-2B | 1.97e-07 | NA | 2.18e-06 | NA |
| 7. B | Q61084 | Mitogen-activated protein kinase kinase kinase 3 | 4.57e-11 | NA | 5.08e-12 | NA |
| 7. B | C0LGG7 | Probable LRR receptor-like serine/threonine-protein kinase At1g53420 | 6.38e-04 | NA | 7.66e-08 | NA |
| 7. B | Q01919 | Serine/threonine-protein kinase KIN4 | 5.55e-07 | NA | 3.59e-12 | NA |
| 7. B | G5EE56 | Tyrosine protein-kinase src-1 | 8.89e-11 | NA | 3.52e-08 | NA |
| 7. B | Q7L7X3 | Serine/threonine-protein kinase TAO1 | 2.06e-05 | NA | 7.23e-08 | NA |
| 7. B | Q09147 | Fibroblast growth factor receptor homolog 2 | 4.08e-04 | NA | 6.49e-06 | NA |
| 7. B | P70106 | Heat-stable enterotoxin receptor | 2.75e-04 | NA | 0.032 | NA |
| 7. B | Q9LUL2 | Serine/threonine-protein kinase WAG2 | 2.77e-11 | NA | 0.006 | NA |
| 7. B | P54350 | Wee1-like protein kinase | 1.08e-06 | NA | 1.52e-05 | NA |
| 7. B | Q9ESL4 | Mitogen-activated protein kinase kinase kinase 20 | 5.08e-07 | NA | 5.57e-07 | NA |
| 7. B | Q16539 | Mitogen-activated protein kinase 14 | 2.16e-08 | NA | 5.13e-18 | NA |
| 7. B | C0LGK9 | Probable LRR receptor-like serine/threonine-protein kinase At2g24230 | 2.18e-04 | NA | 1.87e-08 | NA |
| 7. B | Q9UU87 | Serine/threonine-protein kinase ppk34 | 5.74e-10 | NA | 1.13e-06 | NA |
| 7. B | Q84SN3 | Cyclin-dependent kinase F-3 | 1.48e-09 | NA | 5.78e-14 | NA |
| 7. B | Q8SSV3 | Probable serine/threonine-protein kinase mkcD | 2.21e-06 | NA | 1.67e-12 | NA |
| 7. B | Q8IMC6 | Tau-tubulin kinase homolog Asator | 3.16e-06 | NA | 1.96e-07 | NA |
| 7. B | Q9Y884 | MAP kinase kinase skh1/pek1 | 1.33e-09 | NA | 6.57e-10 | NA |
| 7. B | Q9LHI7 | Serine/threonine-protein kinase Nek7 | 6.77e-07 | NA | 4.22e-04 | NA |
| 7. B | Q6ZQ29 | Serine/threonine-protein kinase TAO2 | 1.66e-04 | NA | 2.77e-06 | NA |
| 7. B | P27041 | Activin receptor type-2B | 1.16e-05 | NA | 2.29e-06 | NA |
| 7. B | P08923 | Leukocyte tyrosine kinase receptor | 1.50e-05 | NA | 6.64e-10 | NA |
| 7. B | O70444 | Serine/threonine-protein kinase pim-3 | 1.18e-09 | NA | 1.54e-08 | NA |
| 7. B | Q07014 | Tyrosine-protein kinase Lyn | 1.02e-11 | NA | 1.49e-11 | NA |
| 7. B | P51138 | Glycogen synthase kinase-3 homolog MsK-2 | 2.66e-07 | NA | 7.77e-07 | NA |
| 7. B | P51139 | Glycogen synthase kinase-3 homolog MsK-3 | 1.80e-09 | NA | 9.58e-09 | NA |
| 7. B | P0C263 | Serine/threonine-protein kinase SBK2 | 6.23e-07 | NA | 8.77e-06 | NA |
| 7. B | Q9LVM0 | Probable inactive receptor kinase At5g58300 | 2.19e-04 | NA | 2.96e-06 | NA |
| 7. B | Q8C0P0 | Serine/threonine-protein kinase greatwall | 1.58e-02 | NA | 2.30e-09 | NA |
| 7. B | Q9LEU7 | CBL-interacting serine/threonine-protein kinase 5 | 1.26e-08 | NA | 3.53e-22 | NA |
| 7. B | Q00168 | Calcium/calmodulin-dependent protein kinase type II alpha chain | 1.13e-09 | NA | 4.52e-15 | NA |
| 7. B | O76324 | Discs overgrown protein kinase | 2.31e-08 | NA | 3.36e-10 | NA |
| 7. B | Q9I8N6 | Macrophage colony-stimulating factor 1 receptor | 1.06e-04 | NA | 2.36e-08 | NA |
| 7. B | Q9TW45 | Serine/threonine-protein kinase par-1 | 4.25e-04 | NA | 1.56e-19 | NA |
| 7. B | Q9C9Y8 | Probable inactive receptor kinase At3g08680 | 4.72e-05 | NA | 5.64e-11 | NA |
| 7. B | P06245 | cAMP-dependent protein kinase type 2 | 4.72e-10 | NA | 6.58e-12 | NA |
| 7. B | P49840 | Glycogen synthase kinase-3 alpha | 5.69e-07 | NA | 2.97e-06 | NA |
| 7. B | P97711 | G protein-coupled receptor kinase 6 | 2.44e-06 | NA | 5.93e-12 | NA |
| 7. B | Q9LVN2 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 | 3.91e-04 | NA | 5.29e-06 | NA |
| 7. B | Q63604 | BDNF/NT-3 growth factors receptor | 1.90e-08 | NA | 5.79e-09 | NA |
| 7. B | Q8VYA3 | Wall-associated receptor kinase-like 10 | 2.95e-04 | NA | 1.43e-09 | NA |
| 7. B | Q66GN2 | Lectin-domain containing receptor kinase VI.4 | 2.58e-04 | NA | 6.59e-08 | NA |
| 7. B | Q07292 | Raf homolog serine/threonine-protein kinase | 3.44e-06 | NA | 7.02e-09 | NA |
| 7. B | O14132 | Sporulation protein kinase pit1 | 3.10e-10 | NA | 2.48e-10 | NA |
| 7. B | Q86CS2 | Serine/threonine-protein kinase atg1 | 2.19e-10 | NA | 2.48e-20 | NA |
| 7. B | Q21029 | Mitogen-activated protein kinase kinase kinase nsy-1 | 3.72e-04 | NA | 3.48e-09 | NA |
| 7. B | Q7XUN6 | L-type lectin-domain containing receptor kinase SIT2 | 3.41e-04 | NA | 2.23e-08 | NA |
| 7. B | P04626 | Receptor tyrosine-protein kinase erbB-2 | 6.72e-04 | NA | 7.21e-10 | NA |
| 7. B | P27040 | Activin receptor type-2B | 1.30e-06 | NA | 4.54e-07 | NA |
| 7. B | Q8CFE4 | SCY1-like protein 2 | 9.87e-04 | NA | 0.016 | NA |
| 7. B | C0LGG3 | Probable LRR receptor-like serine/threonine-protein kinase At1g51820 | 4.71e-04 | NA | 2.58e-09 | NA |
| 7. B | P13185 | Serine/threonine protein kinase KIN1 | 1.44e-06 | NA | 9.72e-07 | NA |
| 7. B | P30291 | Wee1-like protein kinase | 5.22e-08 | NA | 4.69e-04 | NA |
| 7. B | Q9XUJ7 | Serine/threonine-protein kinase dkf-1 | 3.98e-07 | NA | 6.79e-12 | NA |
| 7. B | Q5KQF5 | CBL-interacting protein kinase 22 | 4.86e-07 | NA | 2.16e-16 | NA |
| 7. B | Q06BH3 | Protein STRUBBELIG-RECEPTOR FAMILY 1 | 1.39e-03 | NA | 1.36e-05 | NA |
| 7. B | Q41328 | Pto-interacting protein 1 | 2.72e-06 | NA | 6.49e-08 | NA |
| 7. B | Q5UNT4 | Putative serine/threonine-protein kinase L670 | NA | NA | 1.04e-06 | NA |
| 7. B | Q9LQQ8 | Probable serine/threonine-protein kinase PBL5 | 1.53e-05 | NA | 5.82e-12 | NA |
| 7. B | P84199 | Serine/threonine-protein kinase D1044.8 | 1.06e-06 | NA | 1.13e-13 | NA |
| 7. B | Q9LE81 | Probable serine/threonine protein kinase IRE | 9.37e-05 | NA | 2.99e-14 | NA |
| 7. B | Q9JHU3 | Cyclin-dependent kinase 20 | 1.83e-09 | NA | 1.16e-18 | NA |
| 7. B | Q5HZ38 | Serine/threonine-protein kinase GRIK2 | 1.13e-09 | NA | 7.10e-13 | NA |
| 7. B | Q8LPB4 | Phytosulfokine receptor 1 | 8.32e-04 | NA | 6.16e-07 | NA |
| 7. B | O70293 | G protein-coupled receptor kinase 6 | 2.45e-06 | NA | 3.36e-12 | NA |
| 7. B | O60229 | Kalirin | NA | NA | 1.61e-09 | NA |
| 7. B | Q54UL8 | Probable serine/threonine-protein kinase mps1 | 1.25e-07 | NA | 1.97e-11 | NA |
| 7. B | Q9Y6R4 | Mitogen-activated protein kinase kinase kinase 4 | 1.71e-05 | NA | 3.74e-08 | NA |
| 7. B | B0LT89 | Serine/threonine-protein kinase 24 | 1.14e-10 | NA | 3.77e-08 | NA |
| 7. B | O64777 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61430 | 1.29e-03 | NA | 2.31e-07 | NA |
| 7. B | Q9DC28 | Casein kinase I isoform delta | 2.04e-10 | NA | 5.94e-13 | NA |
| 7. B | O43283 | Mitogen-activated protein kinase kinase kinase 13 | 3.43e-06 | NA | 8.42e-14 | NA |
| 7. B | Q9Y2K2 | Serine/threonine-protein kinase SIK3 | 1.70e-04 | NA | 9.27e-13 | NA |
| 7. B | Q0WR59 | Probable inactive receptor kinase At5g10020 | 8.98e-04 | NA | 2.39e-04 | NA |
| 7. B | O48814 | Serine/threonine-protein kinase BIK1 | 1.20e-05 | NA | 1.20e-10 | NA |
| 7. B | X5M5N0 | Serine/threonine-protein kinase WNK | 3.91e-04 | NA | 6.40e-12 | NA |
| 7. B | Q9LM33 | Mitogen-activated protein kinase 8 | 1.99e-05 | NA | 3.44e-14 | NA |
| 7. B | Q07538 | Serine/threonine-protein kinase prp4 | 7.39e-12 | NA | 4.46e-11 | NA |
| 7. B | Q5JLS2 | CBL-interacting protein kinase 12 | 1.45e-07 | NA | 2.29e-18 | NA |
| 7. B | Q9FFH8 | Casein kinase 1-like protein 7 | 9.12e-09 | NA | 1.65e-11 | NA |
| 7. B | Q9LDZ5 | Probable serine/threonine-protein kinase PBL21 | 1.68e-05 | NA | 6.87e-07 | NA |
| 7. B | Q54RJ4 | Probable serine/threonine-protein kinase iksA | 7.96e-06 | NA | 5.01e-10 | NA |
| 7. B | Q95YD4 | Inactive tyrosine-protein kinase kin-32 | 4.67e-05 | NA | 9.83e-10 | NA |
| 7. B | P15209 | BDNF/NT-3 growth factors receptor | 1.61e-08 | NA | 6.39e-09 | NA |
| 7. B | Q06807 | Angiopoietin-1 receptor | 5.38e-05 | NA | 5.33e-06 | NA |
| 7. B | P46573 | Probable serine/threonine-protein kinase PBL10 | 4.95e-05 | NA | 8.75e-11 | NA |
| 7. B | Q6ZAG3 | Cyclin-dependent kinase C-3 | 3.14e-13 | NA | 2.82e-10 | NA |
| 7. B | A0A0P0VIP0 | L-type lectin-domain containing receptor kinase S.7 | 2.25e-04 | NA | 6.45e-06 | NA |
| 7. B | P36004 | Probable serine/threonine-protein kinase KKQ8 | 4.71e-05 | NA | 4.28e-08 | NA |
| 7. B | Q54G28 | Probable tyrosine-protein kinase DDB_G0290471 | 4.43e-13 | NA | 5.62e-07 | NA |
| 7. B | P14680 | Dual specificity protein kinase YAK1 | 4.31e-04 | NA | 0.002 | NA |
| 7. B | Q8GXQ3 | Wall-associated receptor kinase-like 6 | 7.87e-07 | NA | 6.09e-09 | NA |
| 7. B | P54936 | Protein lin-2 | 8.65e-06 | NA | 2.08e-09 | NA |
| 7. B | Q5R7U1 | Mitogen-activated protein kinase 6 | 4.61e-07 | NA | 1.73e-13 | NA |
| 7. B | P23443 | Ribosomal protein S6 kinase beta-1 | 1.26e-07 | NA | 4.79e-12 | NA |
| 7. B | B9FKW9 | Calcium-dependent protein kinase 14 | 2.12e-08 | NA | 3.82e-09 | NA |
| 7. B | Q5A649 | Serine/threonine-protein kinase ATG1 | 1.21e-05 | NA | 8.91e-09 | NA |
| 7. B | P32562 | Cell cycle serine/threonine-protein kinase CDC5/MSD2 | 2.01e-07 | NA | 4.44e-17 | NA |
| 7. B | Q99JP0 | Mitogen-activated protein kinase kinase kinase kinase 3 | 2.64e-05 | NA | 1.88e-13 | NA |
| 7. B | Q9R0T8 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon | 1.52e-07 | NA | 2.93e-15 | NA |
| 7. B | Q4KSH7 | Dual specificity mitogen-activated protein kinase kinase 7 | 1.65e-09 | NA | 1.91e-13 | NA |
| 7. B | P51955 | Serine/threonine-protein kinase Nek2 | 3.16e-09 | NA | 2.38e-13 | NA |
| 7. B | O75011 | Serine/threonine-protein kinase nak1 | 5.44e-07 | NA | 1.48e-12 | NA |
| 7. B | O94487 | Serine/threonine-protein kinase ppk35 | 1.20e-05 | NA | 1.58e-08 | NA |
| 7. B | P27448 | MAP/microtubule affinity-regulating kinase 3 | 5.14e-06 | NA | 9.77e-15 | NA |
| 7. B | Q9PVZ4 | Insulin receptor | NA | NA | 5.81e-12 | NA |
| 7. B | Q9SY95 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550 | 9.73e-04 | NA | 2.21e-06 | NA |
| 7. B | P41243 | Megakaryocyte-associated tyrosine-protein kinase | 6.97e-12 | NA | 7.54e-12 | NA |
| 7. B | P20793 | Serine/threonine-protein kinase MAK | 5.93e-08 | NA | 2.62e-08 | NA |
| 7. B | Q6Z437 | Mitogen-activated protein kinase 3 | 2.45e-08 | NA | 8.41e-13 | NA |
| 7. B | Q9WUL6 | Mitogen-activated protein kinase kinase kinase 14 | 5.09e-06 | NA | 1.38e-09 | NA |
| 7. B | Q2QM77 | Protein kinase PINOID | 3.33e-11 | NA | 1.29e-04 | NA |
| 7. B | Q84VX4 | Serine/threonine-protein kinase MPS1 | 6.84e-06 | NA | 9.00e-09 | NA |
| 7. B | O54988 | STE20-like serine/threonine-protein kinase | 1.26e-04 | NA | 3.57e-17 | NA |
| 7. B | Q9M2S4 | L-type lectin-domain containing receptor kinase S.4 | 3.32e-04 | NA | 2.59e-08 | NA |
| 7. B | Q0JA29 | LRR receptor-like serine/threonine-protein kinase FLS2 | 4.09e-03 | NA | 9.68e-05 | NA |
| 7. B | Q8VDG6 | Mitogen-activated protein kinase kinase kinase 21 | 9.62e-07 | NA | 1.90e-10 | NA |
| 7. B | Q90XV8 | Serine/threonine-protein kinase mos (Fragment) | 2.98e-08 | NA | 5.54e-10 | NA |
| 7. B | P23293 | Serine/threonine-protein kinase BUR1 | 6.65e-06 | NA | 8.45e-06 | NA |
| 7. B | Q59W62 | Serine/threonine-protein kinase GIN4 | 2.55e-04 | NA | 3.11e-15 | NA |
| 7. B | A2AQW0 | Mitogen-activated protein kinase kinase kinase 15 | 2.39e-03 | NA | 5.42e-13 | NA |
| 7. B | Q4VSN1 | Dual serine/threonine and tyrosine protein kinase | 7.57e-08 | NA | 7.77e-08 | NA |
| 7. B | Q8RY67 | Wall-associated receptor kinase-like 14 | 4.29e-05 | NA | 2.82e-08 | NA |
| 7. B | Q8VYT3 | Probable LRR receptor-like serine/threonine-protein kinase At4g30520 | 4.95e-05 | NA | 7.67e-07 | NA |
| 7. B | Q8MVR1 | Cyclic GMP-binding protein C | 2.30e-02 | NA | 1.31e-04 | NA |
| 7. B | Q19187 | Receptor-type guanylate cyclase gcy-12 | 8.43e-04 | NA | 0.008 | NA |
| 7. B | Q9FZB1 | Probable LRR receptor-like serine/threonine-protein kinase At1g51880 | 4.38e-03 | NA | 1.80e-11 | NA |
| 7. B | Q2V338 | Probable serine/threonine-protein kinase WNK9 | 9.26e-07 | NA | 2.61e-06 | NA |
| 7. B | Q8K592 | Anti-Muellerian hormone type-2 receptor | 1.09e-06 | NA | 0.008 | NA |
| 7. B | C0LGG4 | Probable LRR receptor-like serine/threonine-protein kinase At1g51860 | 4.93e-03 | NA | 1.75e-10 | NA |
| 7. B | Q9SGP2 | Receptor-like protein kinase HSL1 | 4.08e-03 | NA | 9.82e-09 | NA |
| 7. B | Q9H2K8 | Serine/threonine-protein kinase TAO3 | 2.94e-07 | NA | 8.86e-07 | NA |
| 7. B | Q95YH0 | Probable cyclin-dependent kinase 8 | 2.12e-07 | NA | 9.92e-08 | NA |
| 7. B | P50526 | Serine/threonine-protein kinase ssp1 | 3.35e-06 | NA | 2.09e-15 | NA |
| 7. B | Q62406 | Interleukin-1 receptor-associated kinase 1 | 8.39e-05 | NA | 0.004 | NA |
| 7. B | Q8K1Y2 | Serine/threonine-protein kinase D3 | 9.42e-05 | NA | 6.05e-11 | NA |
| 7. B | Q3TYD6 | Serine/threonine-protein kinase LMTK2 | 6.02e-03 | NA | 4.18e-05 | NA |
| 7. B | Q9LZV4 | Serine/threonine-protein kinase STN8, chloroplastic | 1.41e-04 | NA | 4.52e-06 | NA |
| 7. B | Q6ZEZ5 | Serine/threonine-protein kinase Nek3 | 3.55e-07 | NA | 1.42e-17 | NA |
| 7. B | Q39183 | Serine/threonine-protein kinase D6PKL2 | 4.52e-10 | NA | 1.75e-04 | NA |
| 7. B | Q10925 | Tyrosine-protein kinase sid-3 | 4.75e-06 | NA | 6.29e-07 | NA |
| 7. B | Q69ZM6 | Serine/threonine-protein kinase 36 | 2.21e-05 | NA | 1.50e-10 | NA |
| 7. B | Q9Z0H0 | Cell division cycle 7-related protein kinase | 1.16e-02 | NA | 6.10e-05 | NA |
| 7. B | O35607 | Bone morphogenetic protein receptor type-2 | 8.72e-05 | NA | 5.37e-05 | NA |
| 7. B | P23291 | Casein kinase I homolog 1 | 1.52e-07 | NA | 3.65e-05 | NA |
| 7. B | Q9FGW5 | Cyclin-dependent kinase G1 | 3.39e-07 | NA | 8.51e-13 | NA |
| 7. B | Q54RZ7 | Probable serine/threonine-protein kinase DDB_G0282895 | 5.06e-05 | NA | 4.88e-19 | NA |
| 7. B | Q80UE6 | Serine/threonine-protein kinase WNK4 | 3.96e-05 | NA | 2.25e-07 | NA |
| 7. B | Q8IW41 | MAP kinase-activated protein kinase 5 | 7.17e-06 | NA | 1.72e-11 | NA |
| 7. B | Q9Z265 | Serine/threonine-protein kinase Chk2 | 2.17e-07 | NA | 9.71e-21 | NA |
| 7. B | P40494 | Actin-regulating kinase PRK1 | 1.95e-06 | NA | 8.29e-09 | NA |
| 7. B | P00537 | Serine/threonine-protein kinase-transforming protein mos | NA | NA | 1.22e-12 | NA |
| 7. B | P57059 | Serine/threonine-protein kinase SIK1 | 2.65e-06 | NA | 8.18e-11 | NA |
| 7. B | O00141 | Serine/threonine-protein kinase Sgk1 | 3.19e-10 | NA | 7.69e-12 | NA |
| 7. B | Q9LPZ9 | G-type lectin S-receptor-like serine/threonine-protein kinase SD1-13 | 8.19e-04 | NA | 2.94e-07 | NA |
| 7. B | P39688 | Tyrosine-protein kinase Fyn | 5.02e-11 | NA | 9.35e-10 | NA |
| 7. B | Q9NZJ5 | Eukaryotic translation initiation factor 2-alpha kinase 3 | 1.87e-01 | NA | 3.07e-10 | NA |
| 7. B | O01798 | Spermatocyte protein spe-8 | 9.63e-08 | NA | 1.07e-16 | NA |
| 7. B | A9TXT1 | Chitin elicitor receptor kinase 1 | 1.40e-03 | NA | 6.04e-06 | NA |
| 7. B | P25341 | Serine/threonine-protein kinase KIN82 | 4.90e-06 | NA | 7.44e-07 | NA |
| 7. B | O59790 | Serine/threonine-protein kinase ark1 | 2.52e-14 | NA | 1.37e-11 | NA |
| 7. B | G5EFD2 | Kinase suppressor of Ras A | 2.59e-09 | NA | 5.70e-07 | NA |
| 7. B | Q9ZUZ2 | CDPK-related kinase 3 | 1.69e-07 | NA | 4.07e-16 | NA |
| 7. B | P18160 | Dual specificity protein kinase splA | 1.13e-02 | NA | 2.78e-07 | NA |
| 7. B | P50530 | Serine/threonine-protein kinase sck1 | 1.48e-06 | NA | 2.59e-08 | NA |
| 7. B | B8BB68 | LRR receptor kinase BAK1 | 6.28e-04 | NA | 4.46e-08 | NA |
| 7. B | Q9FPR3 | Serine/threonine-protein kinase EDR1 | 4.01e-06 | NA | 8.88e-10 | NA |
| 7. B | P83101 | Putative glycogen synthase kinase-3 homolog | 7.14e-07 | NA | 3.53e-05 | NA |
| 7. B | Q12469 | Serine/threonine-protein kinase SKM1 | 2.29e-05 | NA | 4.99e-11 | NA |
| 7. B | Q54EG9 | Probable serine/threonine-protein kinase DDB_G0291516 | 4.81e-05 | NA | 2.01e-07 | NA |
| 7. B | Q5UQG7 | Putative serine/threonine-protein kinase/receptor R818 | NA | NA | 6.40e-11 | NA |
| 7. B | Q5XF57 | Probable receptor-like serine/threonine-protein kinase At5g57670 | 2.47e-04 | NA | 2.64e-06 | NA |
| 7. B | P41743 | Protein kinase C iota type | 2.95e-07 | NA | 6.42e-15 | NA |
| 7. B | P34947 | G protein-coupled receptor kinase 5 | 3.36e-07 | NA | 1.85e-12 | NA |
| 7. B | O22834 | Probable L-type lectin-domain containing receptor kinase V.3 | 5.16e-05 | NA | 2.00e-08 | NA |
| 7. B | Q91FD5 | Probable serine/threonine-protein kinase 389L | NA | NA | 4.65e-04 | NA |
| 7. B | P04629 | High affinity nerve growth factor receptor | 8.61e-09 | NA | 6.10e-09 | NA |
| 7. B | Q8T2I8 | Serine/threonine-protein kinase sepA | 1.07e-05 | NA | 6.25e-21 | NA |
| 7. B | Q0DYK7 | Calcium-dependent protein kinase 5 | 1.79e-09 | NA | 4.23e-13 | NA |
| 7. B | Q6P3K7 | Casein kinase I isoform delta-B | 2.00e-10 | NA | 7.88e-14 | NA |
| 7. B | P34556 | Cyclin-dependent kinase 1 | 7.77e-16 | NA | 3.96e-11 | NA |
| 7. B | Q20845 | Serine/threonine-protein kinase plk-3 | 2.56e-07 | NA | 1.49e-16 | NA |
| 7. B | P54754 | Ephrin type-B receptor 3 | 4.51e-05 | NA | 1.00e-11 | NA |
| 7. B | Q6K9N1 | Casein kinase 1 | 2.12e-09 | NA | 5.05e-10 | NA |
| 7. B | Q9SGY7 | Putative proline-rich receptor-like protein kinase PERK11 | 1.06e-04 | NA | 6.81e-07 | NA |
| 7. B | Q08097 | Serine/threonine-protein kinase US3 homolog | NA | NA | 9.18e-06 | NA |
| 7. B | Q07553 | Guanylate cyclase 32E | 6.08e-05 | NA | 0.007 | NA |
| 7. B | Q54EM1 | Probable serine/threonine-protein kinase DDB_G0291664 | 2.65e-04 | NA | 8.72e-06 | NA |
| 7. B | Q59S66 | Spindle assembly checkpoint kinase | 7.00e-12 | NA | 8.75e-09 | NA |
| 7. B | Q5A1D3 | Extracellular signal-regulated kinase 1 | 1.71e-07 | NA | 4.56e-14 | NA |
| 7. B | O08680 | Ephrin type-A receptor 3 | 7.23e-05 | NA | 1.73e-11 | NA |
| 7. B | Q9LYU7 | Inactive leucine-rich repeat receptor-like protein kinase CORYNE | 5.63e-12 | NA | 1.17e-06 | NA |
| 7. B | Q9M021 | L-type lectin-domain containing receptor kinase VI.2 | 1.41e-04 | NA | 1.85e-06 | NA |
| 7. B | Q60805 | Tyrosine-protein kinase Mer | 3.08e-07 | NA | 7.76e-07 | NA |
| 7. B | Q8H186 | Probable serine/threonine-protein kinase PBL1 | 3.60e-06 | NA | 6.52e-11 | NA |
| 7. B | Q3E8J4 | Probably inactive receptor-like protein kinase At5g41680 | 3.12e-07 | NA | 0.010 | NA |
| 7. B | Q3UVC0 | Kinase suppressor of Ras 2 | 5.88e-06 | NA | 1.73e-04 | NA |
| 7. B | P43294 | Serine/threonine-protein kinase MHK | 2.20e-09 | NA | 1.36e-10 | NA |
| 7. B | Q6ZIU9 | Calcium-dependent protein kinase 21 | 3.34e-07 | NA | 2.92e-09 | NA |
| 7. B | Q9M0G5 | Putative cysteine-rich receptor-like protein kinase 43 | 3.98e-05 | NA | 2.76e-05 | NA |
| 7. B | P26619 | Platelet-derived growth factor receptor alpha | 5.58e-03 | NA | 3.54e-06 | NA |
| 7. B | C0LGR3 | LRR receptor-like serine/threonine-protein kinase RGI3 | 2.83e-03 | NA | 0.001 | NA |
| 7. B | Q9UF33 | Ephrin type-A receptor 6 | 1.90e-04 | NA | 1.24e-07 | NA |
| 7. B | Q1LX51 | Wee1-like protein kinase 2 | 4.03e-07 | NA | 0.003 | NA |
| 7. B | Q9SY91 | Probable serine/threonine-protein kinase PBL15 | 1.50e-05 | NA | 2.42e-10 | NA |
| 7. B | Q852Q0 | Serine/threonine protein kinase OSK3 | 8.17e-08 | NA | 3.27e-14 | NA |
| 7. B | Q9LSR8 | L-type lectin-domain containing receptor kinase I.9 | 3.51e-04 | NA | 1.22e-04 | NA |
| 7. B | P25911 | Tyrosine-protein kinase Lyn | 7.63e-12 | NA | 2.97e-11 | NA |
| 7. B | Q8I7M8 | Cyclin-dependent kinase 17 | 8.23e-07 | NA | 1.31e-15 | NA |
| 7. B | Q39012 | Shaggy-related protein kinase iota | 3.85e-08 | NA | 7.99e-06 | NA |
| 7. B | P00519 | Tyrosine-protein kinase ABL1 | 2.72e-04 | NA | 1.64e-09 | NA |
| 7. B | P09217 | Protein kinase C zeta type | 1.62e-07 | NA | 4.23e-13 | NA |
| 7. B | Q54TH6 | Probable serine/threonine-protein kinase DDB_G0281745 | 2.16e-07 | NA | 3.59e-07 | NA |
| 7. B | Q9CAV6 | Serine/threonine-protein kinase WNK1 | 4.83e-06 | NA | 5.41e-07 | NA |
| 7. B | Q9NYY3 | Serine/threonine-protein kinase PLK2 | 2.01e-06 | NA | 2.45e-16 | NA |
| 7. B | Q9VZI2 | Activated Cdc42 kinase Ack | 1.91e-07 | NA | 1.07e-05 | NA |
| 7. B | Q55F27 | Probable inactive serine/threonine-protein kinase DDB_G0268656 | 6.18e-09 | NA | 0.026 | NA |
| 7. B | P07334 | Mitosis inducer protein kinase cdr1 | 2.89e-07 | NA | 6.01e-09 | NA |
| 7. B | I1RNG8 | Serine/threonine-protein kinase ATG1 | 4.30e-06 | NA | 5.20e-07 | NA |
| 7. B | P0CY24 | Serine/threonine-protein kinase CST20 | 3.23e-05 | NA | 3.39e-13 | NA |
| 7. B | Q9LFT8 | Cyclin-dependent kinase C-1 | 1.39e-07 | NA | 3.60e-06 | NA |
| 7. B | Q552C1 | Probable serine/threonine-protein kinase DDB_G0276181 | 7.55e-04 | NA | 6.84e-08 | NA |
| 7. B | F4IVI0 | Mitotic checkpoint serine/threonine-protein kinase BUB1 | 6.02e-07 | NA | 0.003 | NA |
| 7. B | P41242 | Megakaryocyte-associated tyrosine-protein kinase | 1.29e-11 | NA | 3.66e-13 | NA |
| 7. B | Q13163 | Dual specificity mitogen-activated protein kinase kinase 5 | 2.63e-09 | NA | 1.03e-08 | NA |
| 7. B | Q19238 | Putative tyrosine-protein kinase F09A5.2 | 1.09e-04 | NA | 4.00e-05 | NA |
| 7. B | Q9P6P3 | Serine/threonine-protein kinase ppk15 | 5.20e-08 | NA | 0.002 | NA |
| 7. B | Q5BCU8 | Serine/threonine-protein kinase atg1 | 3.99e-05 | NA | 9.65e-09 | NA |
| 7. B | P09619 | Platelet-derived growth factor receptor beta | 7.66e-03 | NA | 2.33e-06 | NA |
| 7. B | O81906 | G-type lectin S-receptor-like serine/threonine-protein kinase B120 | 7.35e-04 | NA | 4.31e-07 | NA |
| 7. B | Q60751 | Insulin-like growth factor 1 receptor | 1.04e-03 | NA | 8.31e-10 | NA |
| 7. B | Q00537 | Cyclin-dependent kinase 17 | 2.56e-08 | NA | 5.32e-12 | NA |
| 7. B | P50873 | Serine/threonine-protein kinase MRK1 | 1.25e-10 | NA | 0.006 | NA |
| 7. B | Q9R1U5 | Serine/threonine-protein kinase SIK1 | 2.91e-06 | NA | 3.92e-11 | NA |
| 7. B | Q9FJ55 | CBL-interacting serine/threonine-protein kinase 19 | 3.74e-08 | NA | 2.73e-16 | NA |
| 7. B | Q9ZRF9 | Probable LRR receptor-like serine/threonine-protein kinase RPK1 | 2.81e-05 | NA | 7.55e-08 | NA |
| 7. B | Q9Y3S1 | Serine/threonine-protein kinase WNK2 | 1.16e-02 | NA | 1.33e-09 | NA |
| 7. B | Q3E8W4 | Receptor-like protein kinase ANXUR2 | 6.85e-04 | NA | 8.54e-11 | NA |
| 7. B | P08069 | Insulin-like growth factor 1 receptor | 6.69e-04 | NA | 1.67e-09 | NA |
| 7. B | Q2QAV0 | Serine/threonine-protein kinase TIO | 7.22e-04 | NA | 1.25e-14 | NA |
| 7. B | Q96Q40 | Cyclin-dependent kinase 15 | 3.31e-09 | NA | 1.28e-12 | NA |
| 7. B | Q3EDL4 | Probable serine/threonine-protein kinase At1g01540 | 4.86e-05 | NA | 1.12e-09 | NA |
| 7. B | P0C661 | Cyclin-dependent kinase 8 | 2.67e-05 | NA | 1.54e-06 | NA |
| 7. B | O76039 | Cyclin-dependent kinase-like 5 | 7.39e-08 | NA | 5.75e-10 | NA |
| 7. B | F4HQ17 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4 | 5.44e-05 | NA | 9.64e-10 | NA |
| 7. B | Q99558 | Mitogen-activated protein kinase kinase kinase 14 | 7.42e-05 | NA | 8.18e-09 | NA |
| 7. B | Q6P6U0 | Tyrosine-protein kinase Fgr | 2.09e-11 | NA | 4.49e-11 | NA |
| 7. B | G5EFQ0 | Receptor-type guanylate cyclase gcy-18 | 5.03e-05 | NA | 0.008 | NA |
| 7. B | Q3ZDQ4 | Serine/threonine-protein kinase ATG1 | 4.22e-08 | NA | 1.07e-05 | NA |
| 7. B | Q6R2K1 | Protein STRUBBELIG-RECEPTOR FAMILY 5 | 2.59e-03 | NA | 1.25e-05 | NA |
| 7. B | P70268 | Serine/threonine-protein kinase N1 | 3.24e-05 | NA | 1.12e-07 | NA |
| 7. B | Q9T020 | Probable receptor-like protein kinase At4g39110 | 4.07e-03 | NA | 8.13e-07 | NA |
| 7. B | Q9DGE0 | Dual specificity mitogen-activated protein kinase kinase 6 | 4.65e-10 | NA | 1.60e-14 | NA |
| 7. B | Q8VZG8 | MDIS1-interacting receptor like kinase 2 | 7.31e-06 | NA | 4.03e-05 | NA |
| 7. B | O35492 | Dual specificity protein kinase CLK3 | 3.44e-07 | NA | 4.32e-10 | NA |
| 7. B | P38438 | TGF-beta receptor type-2 | 5.35e-07 | NA | 8.94e-08 | NA |
| 7. B | P14056 | Serine/threonine-protein kinase A-Raf | 1.29e-09 | NA | 1.09e-14 | NA |
| 7. B | A6ZU08 | Serine/threonine-protein kinase TOS3 | 3.00e-10 | NA | 3.76e-10 | NA |
| 7. B | P39073 | Meiotic mRNA stability protein kinase SSN3 | 3.22e-06 | NA | 1.20e-05 | NA |
| 7. B | Q2U0M4 | PAN2-PAN3 deadenylation complex subunit PAN3 | 2.76e-06 | NA | 0.033 | NA |
| 7. B | Q7G768 | Brassinosteroid LRR receptor kinase BRL2 | 3.17e-03 | NA | 1.82e-13 | NA |
| 7. B | Q1ZXH2 | Probable serine/threonine-protein kinase fhkB | 5.30e-05 | NA | 9.69e-07 | NA |
| 7. B | Q9SG12 | CDPK-related kinase 6 | 8.82e-08 | NA | 1.10e-15 | NA |
| 7. B | P49759 | Dual specificity protein kinase CLK1 | 4.50e-12 | NA | 1.90e-09 | NA |
| 7. B | Q6C3D7 | Serine/threonine-protein kinase STE20 | 9.34e-06 | NA | 2.90e-11 | NA |
| 7. B | Q9FRS6 | Leucine-rich repeat receptor-like protein kinase PXL1 | 2.78e-03 | NA | 9.13e-10 | NA |
| 7. B | F4IS56 | Integrin-linked protein kinase 1 | 5.67e-11 | NA | 2.38e-08 | NA |
| 7. B | P58801 | Receptor-interacting serine/threonine-protein kinase 2 | 1.16e-07 | NA | 1.06e-06 | NA |
| 7. B | P26819 | Beta-adrenergic receptor kinase 2 | 1.26e-06 | NA | 2.84e-15 | NA |
| 7. B | Q24145 | Tyrosine-protein kinase Shark | 4.18e-05 | NA | 1.38e-06 | NA |
| 7. B | Q9I8X3 | Fibroblast growth factor receptor 3 | 1.50e-08 | NA | 1.46e-07 | NA |
| 7. B | P24941 | Cyclin-dependent kinase 2 | 8.88e-16 | NA | 1.45e-12 | NA |
| 7. B | Q54YF2 | 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha | 1.89e-06 | NA | 2.37e-15 | NA |
| 7. B | Q12263 | Serine/threonine-protein kinase GIN4 | 5.83e-05 | NA | 3.64e-13 | NA |
| 7. B | Q8RWL6 | Serine/threonine-protein kinase STY17 | 6.16e-07 | NA | 1.90e-15 | NA |
| 7. B | O88904 | Homeodomain-interacting protein kinase 1 | 5.29e-05 | NA | 1.50e-05 | NA |
| 7. B | Q99MQ3 | Serine/threonine-protein kinase PINK1, mitochondrial | 4.59e-08 | NA | 3.96e-04 | NA |
| 7. B | P05480 | Neuronal proto-oncogene tyrosine-protein kinase Src | 1.32e-10 | NA | 2.08e-07 | NA |
| 7. B | Q9LDM5 | Putative cysteine-rich receptor-like protein kinase 31 | 5.81e-05 | NA | 5.90e-07 | NA |
| 7. B | Q6NW76 | Aurora kinase B | 1.03e-14 | NA | 5.03e-10 | NA |
| 7. B | P36583 | Protein kinase C-like 2 | 6.29e-05 | NA | 8.06e-13 | NA |
| 7. B | P11346 | Raf homolog serine/threonine-protein kinase Raf | 1.19e-08 | NA | 1.80e-13 | NA |
| 7. B | P41241 | Tyrosine-protein kinase CSK | 3.23e-08 | NA | 4.45e-10 | NA |
| 7. B | P24062 | Insulin-like growth factor 1 receptor | 2.04e-03 | NA | 6.59e-10 | NA |
| 7. B | Q6AVI8 | Calcium-dependent protein kinase 9 | 4.52e-08 | NA | 5.70e-12 | NA |
| 7. B | Q76II0 | Mast/stem cell growth factor receptor Kit | 1.90e-03 | NA | 1.75e-07 | NA |
| 7. B | Q38873 | Calcium-dependent protein kinase 7 | 1.45e-08 | NA | 7.19e-13 | NA |
| 7. B | Q13705 | Activin receptor type-2B | 2.13e-07 | NA | 4.79e-07 | NA |
| 7. B | A0AUV4 | Sperm motility kinase Y | 2.58e-08 | NA | 1.82e-17 | NA |
| 7. B | Q54RB2 | Cyclin-dependent kinase 11 | 8.10e-10 | NA | 1.46e-11 | NA |
| 7. B | Q9LMN8 | Wall-associated receptor kinase 3 | 1.34e-03 | NA | 6.14e-08 | NA |
| 7. B | Q968Y9 | Insulin-like receptor | 6.95e-03 | NA | 1.04e-08 | NA |
| 7. B | Q3ULB5 | Serine/threonine-protein kinase PAK 6 | 4.61e-06 | NA | 3.13e-09 | NA |
| 7. B | P38445 | Activin receptor type-2B | 1.38e-05 | NA | 4.84e-07 | NA |
| 7. B | Q9SN43 | CBL-interacting serine/threonine-protein kinase 12 | 4.79e-08 | NA | 9.60e-18 | NA |
| 7. B | Q9LT96 | Probable leucine-rich repeat receptor-like protein kinase At5g49770 | 7.53e-05 | NA | 1.21e-10 | NA |
| 7. B | Q9LRT1 | Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 | 4.50e-04 | NA | 2.53e-06 | NA |
| 7. B | Q8BRK8 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 1.11e-07 | NA | 1.18e-14 | NA |
| 7. B | Q9FLW0 | Probable receptor-like protein kinase At5g24010 | 2.03e-04 | NA | 2.63e-11 | NA |
| 7. B | Q9Y1J3 | 3-phosphoinositide-dependent protein kinase 1 | 1.56e-06 | NA | 1.34e-10 | NA |
| 7. B | Q24210 | Peripheral plasma membrane protein CASK | 4.06e-05 | NA | 4.27e-17 | NA |
| 7. B | A7MBL8 | Serine/threonine-protein kinase N2 | 3.98e-05 | NA | 1.45e-07 | NA |
| 7. B | Q9SYA0 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61500 | 3.64e-04 | NA | 4.71e-06 | NA |
| 7. B | Q6P3N6 | Cyclin-dependent kinase 8 | 6.27e-07 | NA | 5.26e-05 | NA |
| 7. B | Q9C6P3 | Calcium-dependent protein kinase 33 | 1.36e-08 | NA | 1.92e-09 | NA |
| 7. B | Q9ERE3 | Serine/threonine-protein kinase Sgk3 | 7.76e-08 | NA | 8.59e-10 | NA |
| 7. B | Q53N72 | Mitogen-activated protein kinase 15 | 2.36e-07 | NA | 2.85e-17 | NA |
| 7. B | Q13873 | Bone morphogenetic protein receptor type-2 | 4.86e-04 | NA | 1.83e-05 | NA |
| 7. B | A2ZVI7 | Calcium-dependent protein kinase 1 | 2.31e-08 | NA | 5.48e-12 | NA |
| 7. B | P37173 | TGF-beta receptor type-2 | 8.28e-10 | NA | 1.09e-07 | NA |
| 7. B | Q6BM25 | Serine/threonine-protein kinase SSN3 | 4.56e-08 | NA | 2.34e-05 | NA |
| 7. B | Q94C25 | Probable receptor-like protein kinase At5g20050 | 1.23e-04 | NA | 3.00e-06 | NA |
| 7. B | O55099 | Aurora kinase B | 2.70e-14 | NA | 2.99e-08 | NA |
| 7. B | Q54UZ1 | Probable serine/threonine-protein kinase DDB_G0280717 | 1.30e-09 | NA | 2.12e-15 | NA |
| 7. B | O43683 | Mitotic checkpoint serine/threonine-protein kinase BUB1 | 1.14e-02 | NA | 0.007 | NA |
| 7. B | Q852N6 | Calcium-dependent protein kinase 11 | 3.14e-09 | NA | 7.74e-13 | NA |
| 7. B | P05622 | Platelet-derived growth factor receptor beta | 6.35e-03 | NA | 2.68e-06 | NA |
| 7. B | Q9LUT0 | Receptor-like cytoplasmic kinase 1 | 6.87e-07 | NA | 9.73e-07 | NA |
| 7. B | D3ZHP7 | Serine/threonine-protein kinase ULK3 | 8.48e-09 | NA | 2.53e-18 | NA |
| 7. B | Q13043 | Serine/threonine-protein kinase 4 | 4.39e-08 | NA | 2.50e-09 | NA |
| 7. B | Q7XR88 | Salt tolerance receptor-like cytoplasmic kinase 1 | 4.43e-07 | NA | 1.33e-04 | NA |
| 7. B | P92937 | CBL-interacting serine/threonine-protein kinase 15 | 4.83e-08 | NA | 2.28e-21 | NA |
| 7. B | O81833 | G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 | 6.88e-04 | NA | 3.25e-09 | NA |
| 7. B | C0LGT1 | Probable LRR receptor-like serine/threonine-protein kinase At5g10290 | 2.50e-04 | NA | 3.57e-07 | NA |
| 7. B | Q9LV48 | Proline-rich receptor-like protein kinase PERK1 | 4.44e-05 | NA | 7.40e-08 | NA |
| 7. B | P49760 | Dual specificity protein kinase CLK2 | 7.51e-12 | NA | 3.40e-13 | NA |
| 7. B | Q5RFL3 | Mitogen-activated protein kinase kinase kinase 7 | 2.04e-06 | NA | 3.05e-11 | NA |
| 7. B | Q9XTC6 | Mitogen-activated protein kinase kinase kinase mom-4 | 1.34e-07 | NA | 2.13e-06 | NA |
| 7. B | Q8VCR8 | Myosin light chain kinase 2, skeletal/cardiac muscle | 1.07e-08 | NA | 1.81e-10 | NA |
| 7. B | F4HRJ4 | Mitogen-activated protein kinase kinase kinase 3 | 7.76e-08 | NA | 4.40e-10 | NA |
| 7. B | B5DFG1 | Serine/threonine-protein kinase PINK1, mitochondrial | 9.37e-07 | NA | 4.56e-04 | NA |
| 7. B | Q9LPQ3 | Mitogen-activated protein kinase kinase 7 | 7.44e-15 | NA | 1.52e-17 | NA |
| 7. B | Q9QY78 | Inhibitor of nuclear factor kappa-B kinase subunit beta | 1.91e-05 | NA | 1.24e-10 | NA |
| 7. B | Q96L34 | MAP/microtubule affinity-regulating kinase 4 | 4.03e-06 | NA | 1.73e-14 | NA |
| 7. B | O80963 | Serine/threonine-protein kinase-like protein CCR2 | 3.38e-04 | NA | 4.20e-06 | NA |
| 7. B | A0A0K3AV08 | Mitogen-activated protein kinase kinase kinase mlk-1 | 7.46e-04 | NA | 5.46e-06 | NA |
| 7. B | P34885 | Protein kinase C-like 1B | 2.10e-06 | NA | 4.61e-12 | NA |
| 7. B | Q55GV3 | Serine/threonine-protein kinase pakC | 6.78e-08 | NA | 1.97e-12 | NA |
| 7. B | Q12701 | Serine/threonine-protein kinase ksg1 | 2.05e-06 | NA | 1.17e-10 | NA |
| 7. B | P04627 | Serine/threonine-protein kinase A-Raf | 1.51e-08 | NA | 1.09e-14 | NA |
| 7. B | O96013 | Serine/threonine-protein kinase PAK 4 | 1.33e-05 | NA | 1.07e-11 | NA |
| 7. B | Q9HC98 | Serine/threonine-protein kinase Nek6 | 1.11e-16 | NA | 5.57e-20 | NA |
| 7. B | Q6Z829 | Wee1-like protein kinase | 7.76e-11 | NA | 1.28e-11 | NA |
| 7. B | O65483 | Cysteine-rich receptor-like protein kinase 24 | 3.27e-05 | NA | 9.30e-08 | NA |
| 7. B | Q8N568 | Serine/threonine-protein kinase DCLK2 | 1.09e-05 | NA | 1.97e-11 | NA |
| 7. B | P84390 | Serine/threonine-protein kinase US3 homolog | NA | NA | 3.29e-06 | NA |
| 7. B | Q86Z02 | Homeodomain-interacting protein kinase 1 | 6.52e-05 | NA | 1.50e-05 | NA |
| 7. B | Q54XJ4 | Probable serine/threonine-protein kinase DDB_G0278901 | 8.16e-05 | NA | 4.83e-22 | NA |
| 7. B | Q91ZN7 | Serine/threonine-protein kinase Chk1 | 9.55e-07 | NA | 7.60e-10 | NA |
| 7. B | Q9SUL7 | CBL-interacting serine/threonine-protein kinase 4 | 2.54e-08 | NA | 8.84e-22 | NA |
| 7. B | Q80YE7 | Death-associated protein kinase 1 | 6.65e-05 | NA | 4.84e-15 | NA |
| 7. B | Q8H1D6 | Receptor-like cytosolic serine/threonine-protein kinase RBK1 | 1.66e-05 | NA | 1.05e-05 | NA |
| 7. B | Q9FII5 | Leucine-rich repeat receptor-like protein kinase TDR | 6.72e-03 | NA | 1.58e-12 | NA |
| 7. B | Q75DK7 | Serine/threonine-protein kinase STE20 | 1.46e-06 | NA | 9.72e-11 | NA |
| 7. B | Q9LTW5 | Serine/threonine-protein kinase AGC1-5 | 9.71e-08 | NA | 1.08e-04 | NA |
| 7. B | O15111 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 2.50e-04 | NA | 4.81e-11 | NA |
| 7. B | Q8L4H0 | Wee1-like protein kinase | 1.06e-10 | NA | 3.25e-11 | NA |
| 7. B | Q8CEE6 | PAS domain-containing serine/threonine-protein kinase | 6.85e-04 | NA | 6.90e-12 | NA |
| 7. B | P0C865 | Mitogen-activated protein kinase 7 | 6.50e-06 | NA | 8.84e-12 | NA |
| 7. B | Q8GUQ5 | Brassinosteroid LRR receptor kinase | 9.44e-03 | NA | 1.65e-10 | NA |
| 7. B | Q9NBK5 | Serine/threonine-protein kinase tricornered | 1.45e-05 | NA | 2.00e-10 | NA |
| 7. B | A2QIL5 | Serine/threonine-protein kinase atg1 | 4.78e-08 | NA | 3.03e-06 | NA |
| 7. B | Q9NB31 | Serine/threonine-protein kinase cst-1 | 2.83e-08 | NA | 1.46e-11 | NA |
| 7. B | P9WI83 | Serine/threonine-protein kinase PknA | 1.11e-10 | NA | 1.15e-19 | NA |
| 7. B | Q8LPJ1 | Casein kinase 1-like protein 6 | 5.71e-08 | NA | 4.15e-10 | NA |
| 7. B | P11801 | Serine/threonine-protein kinase H1 | 7.03e-08 | NA | 5.75e-14 | NA |
| 7. B | Q13555 | Calcium/calmodulin-dependent protein kinase type II subunit gamma | 1.92e-09 | NA | 2.28e-14 | NA |
| 7. B | P28178 | Protein kinase 2 | 9.97e-08 | NA | 9.06e-10 | NA |
| 7. B | P35626 | Beta-adrenergic receptor kinase 2 | 7.23e-07 | NA | 1.16e-16 | NA |
| 7. B | Q54SJ5 | Probable myosin light chain kinase DDB_G0282429 | 2.00e-15 | NA | 8.56e-17 | NA |
| 7. B | Q32MK0 | Myosin light chain kinase 3 | 5.03e-06 | NA | 2.72e-13 | NA |
| 7. B | C0LGG8 | Probable LRR receptor-like serine/threonine-protein kinase At1g53430 | 4.19e-03 | NA | 2.98e-09 | NA |
| 7. B | Q02111 | Protein kinase C theta type | 4.96e-06 | NA | 1.32e-11 | NA |
| 7. B | P31750 | RAC-alpha serine/threonine-protein kinase | 2.68e-09 | NA | 1.60e-12 | NA |
| 7. B | Q80Y86 | Mitogen-activated protein kinase 15 | 2.79e-07 | NA | 1.82e-14 | NA |
| 7. B | Q13523 | Serine/threonine-protein kinase PRP4 homolog | 1.71e-07 | NA | 3.42e-08 | NA |
| 7. B | Q03306 | Serine/threonine-protein kinase PKH3 | 3.54e-05 | NA | 2.55e-11 | NA |
| 7. B | Q696W0 | Striated muscle preferentially expressed protein kinase | NA | NA | 1.16e-10 | NA |
| 7. B | Q8VYK9 | Casein kinase 1-like protein 12 | 3.21e-08 | NA | 9.93e-11 | NA |
| 7. B | P05696 | Protein kinase C alpha type | 1.37e-07 | NA | 1.19e-10 | NA |
| 7. B | Q9C6K9 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1 | 8.68e-05 | NA | 3.44e-09 | NA |
| 7. B | Q9Z2R9 | Eukaryotic translation initiation factor 2-alpha kinase 1 | 2.09e-02 | NA | 1.68e-07 | NA |
| 7. B | Q8BWW9 | Serine/threonine-protein kinase N2 | 4.20e-05 | NA | 1.31e-07 | NA |
| 7. B | F4HYG2 | Probable serine/threonine protein kinase IRE3 | 3.39e-04 | NA | 4.61e-13 | NA |
| 7. B | P85193 | Putative serine/threonine-protein kinase (Fragment) | 3.65e-08 | NA | 1.12e-05 | NA |
| 7. B | Q8GY82 | Cysteine-rich receptor-like protein kinase 45 | 7.74e-07 | NA | 7.74e-04 | NA |
| 7. B | O80345 | Cyclin-dependent kinase F-1 | 4.00e-05 | NA | 4.86e-11 | NA |
| 7. B | Q8H1G6 | PTI1-like tyrosine-protein kinase 1 | 1.44e-06 | NA | 6.00e-07 | NA |
| 7. B | Q16832 | Discoidin domain-containing receptor 2 | 2.06e-04 | NA | 3.92e-07 | NA |
| 7. B | Q15349 | Ribosomal protein S6 kinase alpha-2 | 1.31e-06 | NA | 9.50e-17 | NA |
| 7. B | P31374 | Serine/threonine-protein kinase PSK1 | 7.09e-06 | NA | 4.75e-07 | NA |
| 7. B | Q55CY9 | Probable serine/threonine-protein kinase gdt8 | 2.73e-03 | NA | 4.55e-04 | NA |
| 7. B | Q9LDI3 | CBL-interacting serine/threonine-protein kinase 24 | 1.44e-07 | NA | 1.17e-16 | NA |
| 7. B | Q42479 | Calcium-dependent protein kinase 3 | 2.12e-08 | NA | 2.04e-10 | NA |
| 7. B | Q38872 | Calcium-dependent protein kinase 6 | 5.47e-08 | NA | 3.89e-11 | NA |
| 7. B | Q2RAV0 | Calcium-dependent protein kinase 25 | 3.07e-09 | NA | 2.66e-12 | NA |
| 7. B | Q93ZS4 | Protein NSP-INTERACTING KINASE 3 | 7.76e-04 | NA | 2.49e-10 | NA |
| 7. B | C0LGS2 | Probable LRR receptor-like serine/threonine-protein kinase At4g36180 | 3.07e-03 | NA | 5.90e-10 | NA |
| 7. B | P83104 | Putative mitogen-activated protein kinase kinase kinase 7-like | 3.51e-12 | NA | 2.48e-09 | NA |
| 7. B | P68403 | Protein kinase C beta type | 2.01e-07 | NA | 1.30e-08 | NA |
| 7. B | G5EBZ8 | Ack-related non-receptor tyrosine kinase | 1.58e-04 | NA | 1.19e-05 | NA |
| 7. B | Q4WXY0 | Mitogen-activated protein kinase kinae kinase bck1 | NA | NA | 2.47e-09 | NA |
| 7. B | Q9CAL3 | Cysteine-rich receptor-like protein kinase 2 | 6.36e-05 | NA | 9.55e-08 | NA |
| 7. B | Q559T8 | Probable serine/threonine-protein kinase DDB_G0272282 | 7.90e-03 | NA | 2.24e-08 | NA |
| 7. B | Q6P5G0 | Mitogen-activated protein kinase 4 | 4.45e-08 | NA | 1.25e-11 | NA |
| 7. B | P24788 | Cyclin-dependent kinase 11B | 1.19e-06 | NA | 2.61e-10 | NA |
| 7. B | P09760 | Tyrosine-protein kinase Fer | 1.11e-08 | NA | 9.28e-13 | NA |
| 7. B | Q6QNF3 | Platelet-derived growth factor receptor beta | 7.69e-03 | NA | 1.70e-06 | NA |
| 7. B | Q03563 | Serine/threonine-protein kinase spk-1 | 7.16e-03 | NA | 0.022 | NA |
| 7. B | O81069 | Probable leucine-rich repeat receptor-like protein kinase At2g28990 | 8.03e-04 | NA | 8.28e-10 | NA |
| 7. B | P0DH86 | G-type lectin S-receptor-like serine/threonine-protein kinase SRK | 1.51e-03 | NA | 2.35e-08 | NA |
| 7. B | C0LGL9 | LRR receptor-like serine/threonine-protein kinase FEI 2 | 2.63e-05 | NA | 5.30e-10 | NA |
| 7. B | Q9R117 | Non-receptor tyrosine-protein kinase TYK2 | 3.28e-04 | NA | 1.12e-08 | NA |
| 7. B | Q9C8M5 | Serine/threonine-protein kinase WAG1 | 3.08e-08 | NA | 1.85e-04 | NA |
| 7. B | P11440 | Cyclin-dependent kinase 1 | 2.22e-15 | NA | 4.96e-09 | NA |
| 7. B | Q2LGB3 | Interleukin-1 receptor-associated kinase 1 | 6.53e-05 | NA | 4.39e-06 | NA |
| 7. B | P97377 | Cyclin-dependent kinase 2 | 1.18e-13 | NA | 2.44e-11 | NA |
| 7. B | Q54MV2 | Probable serine/threonine-protein kinase MARK-B | 1.57e-06 | NA | 2.78e-12 | NA |
| 7. B | A8WIP6 | Cyclin-dependent kinase 20 | 3.01e-09 | NA | 6.75e-19 | NA |
| 7. B | Q1PE17 | Calcium-dependent protein kinase 18 | 7.07e-07 | NA | 7.24e-15 | NA |
| 7. B | P00531 | Serine/threonine-protein kinase-transforming protein mil | NA | NA | 1.92e-14 | NA |
| 7. B | Q62833 | G protein-coupled receptor kinase 5 | 5.49e-07 | NA | 1.06e-13 | NA |
| 7. B | Q99683 | Mitogen-activated protein kinase kinase kinase 5 | 4.05e-03 | NA | 1.50e-15 | NA |
| 7. B | Q9SI06 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 | 9.16e-04 | NA | 6.22e-09 | NA |
| 7. B | Q02156 | Protein kinase C epsilon type | 3.65e-07 | NA | 2.53e-12 | NA |
| 7. B | Q62829 | Serine/threonine-protein kinase PAK 3 | 2.81e-07 | NA | 5.39e-12 | NA |
| 7. B | P11273 | Tyrosine-protein kinase transforming protein erbB | NA | NA | 1.49e-11 | NA |
| 7. B | O64784 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61360 | 1.11e-03 | NA | 1.89e-06 | NA |
| 7. B | O04533 | Putative L-type lectin-domain containing receptor kinase V.2 | 8.76e-05 | NA | 4.23e-10 | NA |
| 7. B | P54646 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 9.78e-08 | NA | 1.20e-14 | NA |
| 7. B | Q9SV83 | Probable receptor-like protein kinase At4g10390 | 1.88e-06 | NA | 6.49e-05 | NA |
| 7. B | Q9LFA2 | Serine/threonine-protein kinase KIPK1 | 1.90e-04 | NA | 6.70e-04 | NA |
| 7. B | P97477 | Aurora kinase A | 4.05e-10 | NA | 2.27e-07 | NA |
| 7. B | G5EDA5 | Kinase suppressor of Ras B | 3.89e-08 | NA | 1.26e-05 | NA |
| 7. B | Q6H9I1 | Serine/threonine-protein kinase ATG1 | 4.42e-05 | NA | 1.04e-05 | NA |
| 7. B | Q9H2G2 | STE20-like serine/threonine-protein kinase | 2.70e-05 | NA | 1.06e-18 | NA |
| 7. B | Q8RXE5 | Probable serine/threonine-protein kinase WNK10 | 1.36e-06 | NA | 6.11e-07 | NA |
| 7. B | F1QGZ6 | Maternal embryonic leucine zipper kinase | 7.95e-07 | NA | 2.93e-12 | NA |
| 7. B | G7JIK2 | Leucine-rich repeat receptor-like kinase protein SUNN | 1.42e-03 | NA | 1.32e-05 | NA |
| 7. B | Q09170 | Serine/threonine-protein kinase cds1 | 3.66e-10 | NA | 3.95e-18 | NA |
| 7. B | Q65XV8 | Receptor-like cytoplasmic kinase 176 | 1.41e-05 | NA | 1.16e-08 | NA |
| 7. B | P53350 | Serine/threonine-protein kinase PLK1 | 3.19e-07 | NA | 5.94e-18 | NA |
| 7. B | A8C984 | Myosin light chain kinase 3 | 5.19e-08 | NA | 3.91e-14 | NA |
| 7. B | P11798 | Calcium/calmodulin-dependent protein kinase type II subunit alpha | 1.73e-08 | NA | 3.60e-13 | NA |
| 7. B | Q8VHJ5 | Serine/threonine-protein kinase MARK1 | 4.07e-05 | NA | 1.86e-14 | NA |
| 7. B | Q9SKB2 | Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1 | 4.30e-05 | NA | 4.98e-11 | NA |
| 7. B | Q5AG71 | Serine/threonine-protein kinase HSL1 | 5.31e-04 | NA | 4.54e-16 | NA |
| 7. B | Q62371 | Discoidin domain-containing receptor 2 | 3.85e-05 | NA | 4.18e-08 | NA |
| 7. B | P79749 | Platelet-derived growth factor receptor beta | 2.36e-04 | NA | 2.11e-06 | NA |
| 7. B | Q39026 | Mitogen-activated protein kinase 6 | 1.60e-06 | NA | 7.00e-14 | NA |
| 7. B | Q9SJ61 | Calcium-dependent protein kinase 25 | 1.95e-08 | NA | 1.97e-09 | NA |
| 7. B | Q9LIG2 | Receptor-like protein kinase At3g21340 | 1.23e-03 | NA | 4.45e-09 | NA |
| 7. B | Q8LPI7 | Casein kinase 1-like protein 4 | 4.78e-10 | NA | 2.80e-09 | NA |
| 7. B | Q96LW2 | Ribosomal protein S6 kinase-related protein | 4.60e-10 | NA | 7.23e-06 | NA |
| 7. B | P24719 | Meiosis-specific serine/threonine-protein kinase MEK1 | 1.55e-07 | NA | 4.11e-12 | NA |
| 7. B | P08458 | Sporulation-specific protein 1 | 1.18e-10 | NA | 5.37e-19 | NA |
| 7. B | Q61772 | Ephrin type-A receptor 7 | 2.35e-04 | NA | 1.95e-13 | NA |
| 7. B | P57097 | Tyrosine-protein kinase Mer | 3.45e-07 | NA | 6.39e-07 | NA |
| 7. B | Q8N4C8 | Misshapen-like kinase 1 | 1.07e-04 | NA | 2.18e-12 | NA |
| 7. B | P11362 | Fibroblast growth factor receptor 1 | 5.71e-05 | NA | 8.22e-10 | NA |
| 7. B | Q15208 | Serine/threonine-protein kinase 38 | 4.22e-07 | NA | 2.88e-11 | NA |
| 7. B | Q6DGS3 | Calcium/calmodulin-dependent protein kinase type II delta 2 chain | 2.04e-09 | NA | 1.19e-14 | NA |
| 7. B | A2XQD3 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2 | 1.86e-04 | NA | 3.58e-10 | NA |
| 7. B | P11792 | Serine/threonine-protein kinase SCH9 | 3.42e-06 | NA | 3.39e-13 | NA |
| 7. B | P13234 | Calcium/calmodulin-dependent protein kinase type IV | 4.99e-08 | NA | 7.80e-16 | NA |
| 7. B | P34331 | Serine/threonine-protein kinase plk-1 | 2.33e-07 | NA | 3.28e-12 | NA |
| 7. B | Q8GZ99 | Leucine-rich repeat receptor protein kinase HPCA1 | 4.49e-05 | NA | 1.28e-09 | NA |
| 7. B | P24381 | Serine/threonine-protein kinase US3 homolog | NA | NA | 4.78e-04 | NA |
| 7. B | C0LGE0 | Probable LRR receptor-like serine/threonine-protein kinase At1g07650 | 2.08e-03 | NA | 5.64e-12 | NA |
| 7. B | Q17850 | Serine/threonine-protein kinase pak-1 | 3.36e-07 | NA | 9.87e-11 | NA |
| 7. B | Q61527 | Receptor tyrosine-protein kinase erbB-4 | 1.26e-03 | NA | 3.46e-08 | NA |
| 7. B | Q5J4W4 | Mitogen-activated protein kinase 2 | 7.77e-08 | NA | 1.50e-11 | NA |
| 7. B | P70424 | Receptor tyrosine-protein kinase erbB-2 | 8.78e-05 | NA | 1.67e-09 | NA |
| 7. B | P0CD65 | PAN2-PAN3 deadenylation complex subunit pan3 | 7.19e-06 | NA | 6.41e-04 | NA |
| 7. B | Q23023 | Serine/threonine-protein kinase unc-51 | 2.72e-05 | NA | 1.73e-18 | NA |
| 7. B | P14617 | Insulin receptor-related protein | 3.02e-04 | NA | 1.46e-09 | NA |
| 7. B | P39745 | Mitogen-activated protein kinase mpk-1 | 2.81e-08 | NA | 4.78e-16 | NA |
| 7. B | P08414 | Calcium/calmodulin-dependent protein kinase type IV | 3.71e-10 | NA | 1.22e-15 | NA |
| 7. B | Q55EC7 | RasGEF domain-containing serine/threonine-protein kinase X | 2.65e-04 | NA | 2.12e-08 | NA |
| 7. B | O49717 | Calcium-dependent protein kinase 15 | 6.26e-08 | NA | 3.13e-12 | NA |
| 7. B | Q00536 | Cyclin-dependent kinase 16 | 2.75e-12 | NA | 1.04e-12 | NA |
| 7. B | Q9Y2U5 | Mitogen-activated protein kinase kinase kinase 2 | 2.76e-11 | NA | 3.62e-12 | NA |
| 7. B | C0HKC9 | Sperm motility kinase 3B | 8.72e-08 | NA | 3.49e-10 | NA |
| 7. B | P00533 | Epidermal growth factor receptor | 7.05e-05 | NA | 5.28e-11 | NA |
| 7. B | P49185 | Mitogen-activated protein kinase 8 | 5.40e-06 | NA | 1.48e-14 | NA |
| 7. B | P54760 | Ephrin type-B receptor 4 | 1.34e-04 | NA | 1.16e-10 | NA |
| 7. B | Q62101 | Serine/threonine-protein kinase D1 | 4.39e-04 | NA | 1.19e-10 | NA |
| 7. B | Q54D75 | Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 | 5.60e-04 | NA | 2.35e-13 | NA |
| 7. B | P38070 | Serine/threonine-protein kinase YPK3 | 4.64e-07 | NA | 1.57e-11 | NA |
| 7. B | Q6P3R8 | Serine/threonine-protein kinase Nek5 | 6.39e-07 | NA | 6.00e-19 | NA |
| 7. B | Q02858 | Angiopoietin-1 receptor | 4.77e-07 | NA | 6.03e-06 | NA |
| 7. B | Q12866 | Tyrosine-protein kinase Mer | 3.00e-05 | NA | 7.92e-06 | NA |
| 7. B | Q6XUX2 | Dual serine/threonine and tyrosine protein kinase | 1.13e-07 | NA | 2.15e-06 | NA |
| 7. B | Q9SCU5 | Probable serine/threonine-protein kinase WNK5 | 7.44e-05 | NA | 5.12e-07 | NA |
| 7. B | Q12236 | Serine/threonine-protein kinase PKH2 | 8.70e-05 | NA | 5.05e-13 | NA |
| 7. B | P0C5K1 | Serine/threonine-protein kinase SBK2 | 1.12e-06 | NA | 2.88e-07 | NA |
| 7. B | Q54FR9 | Probable serine/threonine-protein kinase DDB_G0290621 | 1.11e-04 | NA | 2.68e-04 | NA |
| 7. B | P22219 | Serine/threonine-protein kinase VPS15 | 2.56e-03 | NA | 3.74e-04 | NA |
| 7. B | Q62120 | Tyrosine-protein kinase JAK2 | 2.40e-03 | NA | 4.92e-11 | NA |
| 7. B | Q5AP97 | Mitosis inhibitor protein kinase SWE1 | 6.98e-03 | NA | 5.07e-10 | NA |
| 7. B | Q66HE5 | NUAK family SNF1-like kinase 2 | 7.18e-08 | NA | 3.92e-13 | NA |
| 7. B | O43077 | Sporulation protein kinase mde3 | 3.81e-07 | NA | 2.04e-10 | NA |
| 7. B | Q9HAZ1 | Dual specificity protein kinase CLK4 | 3.36e-12 | NA | 1.33e-08 | NA |
| 7. B | Q09690 | DYRK-family kinase pom1 | 2.38e-05 | NA | 6.15e-06 | NA |
| 7. B | Q8BZ03 | Serine/threonine-protein kinase D2 | 1.28e-04 | NA | 2.25e-12 | NA |
| 7. B | Q0KHT7 | Death-associated protein kinase related | 2.08e-06 | NA | 6.74e-12 | NA |
| 7. B | Q9SXB4 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 | 1.08e-03 | NA | 6.61e-09 | NA |
| 7. B | Q63796 | Mitogen-activated protein kinase kinase kinase 12 | 7.59e-07 | NA | 1.24e-13 | NA |
| 7. B | Q6P9R2 | Serine/threonine-protein kinase OSR1 | 2.72e-08 | NA | 6.98e-16 | NA |
| 7. B | P00545 | Tyrosine-protein kinase transforming protein fms | NA | NA | 1.08e-07 | NA |
| 7. B | P29597 | Non-receptor tyrosine-protein kinase TYK2 | 3.28e-04 | NA | 5.81e-09 | NA |
| 7. B | Q62270 | Tyrosine-protein kinase Srms | 1.66e-11 | NA | 1.09e-11 | NA |
| 7. B | A8DYP0 | Obscurin | NA | NA | 1.72e-08 | NA |
| 7. B | Q9FID9 | Probable receptor-like protein kinase At5g38990 | 5.20e-03 | NA | 3.35e-08 | NA |
| 7. B | Q91Z96 | BMP-2-inducible protein kinase | 1.22e-04 | NA | 0.044 | NA |
| 7. B | P15442 | eIF-2-alpha kinase GCN2 | 2.07e-02 | NA | 1.06e-07 | NA |
| 7. B | Q39021 | Mitogen-activated protein kinase 1 | 3.05e-08 | NA | 1.07e-15 | NA |
| 7. B | Q6IQ55 | Tau-tubulin kinase 2 | 2.58e-06 | NA | 9.26e-05 | NA |
| 7. B | Q02720 | Casein kinase II subunit alpha | 1.40e-12 | NA | 3.74e-04 | NA |
| 7. B | Q13164 | Mitogen-activated protein kinase 7 | 7.80e-06 | NA | 6.21e-12 | NA |
| 7. B | P08630 | Tyrosine-protein kinase Btk29A | 3.97e-09 | NA | 3.87e-11 | NA |
| 7. B | O88643 | Serine/threonine-protein kinase PAK 1 | 2.37e-07 | NA | 1.25e-12 | NA |
| 7. B | Q55CW3 | Probable serine/threonine-protein kinase samkA | 6.83e-06 | NA | 0.009 | NA |
| 7. B | Q9ZUP4 | Casein kinase 1-like protein 5 | 1.93e-09 | NA | 7.80e-12 | NA |
| 7. B | Q64716 | Insulin receptor-related protein | 1.13e-03 | NA | 2.65e-09 | NA |
| 7. B | Q6C842 | Serine/threonine-protein kinase BUR1 | 5.66e-07 | NA | 6.45e-05 | NA |
| 7. B | Q9FX86 | CDPK-related kinase 8 | 5.90e-07 | NA | 2.82e-15 | NA |
| 7. B | Q19192 | Eukaryotic translation initiation factor 2-alpha kinase pek-1 | 1.11e-01 | NA | 0.002 | NA |
| 7. B | P31749 | RAC-alpha serine/threonine-protein kinase | 1.12e-07 | NA | 8.24e-13 | NA |
| 7. B | Q0WVM4 | Probable LRR receptor-like serine/threonine-protein kinase At2g23950 | 2.96e-04 | NA | 4.28e-07 | NA |
| 7. B | Q86UX6 | Serine/threonine-protein kinase 32C | 1.97e-07 | NA | 4.33e-14 | NA |
| 7. B | Q63272 | Tyrosine-protein kinase JAK3 | 1.53e-03 | NA | 6.68e-11 | NA |
| 7. B | P26794 | Serine/threonine-protein kinase pim-1 | 4.38e-13 | NA | 2.08e-10 | NA |
| 7. B | Q8C0V7 | Putative sperm motility kinase W | 1.17e-07 | NA | 1.58e-12 | NA |
| 7. B | Q54VV7 | Probable serine/threonine-protein kinase DDB_G0280111 | 7.17e-06 | NA | 4.80e-06 | NA |
| 7. B | Q8GUH1 | U-box domain-containing protein 33 | 3.40e-03 | NA | 8.30e-07 | NA |
| 7. B | O01761 | Muscle M-line assembly protein unc-89 | NA | NA | 2.52e-05 | NA |
| 7. B | Q5JK68 | Cyclin-dependent kinase C-2 | 1.89e-07 | NA | 1.56e-06 | NA |
| 7. B | Q7TNJ7 | Calcium/calmodulin-dependent protein kinase type 1G | 5.31e-11 | NA | 6.12e-16 | NA |
| 7. B | Q54QV3 | Probable serine/threonine-protein kinase yakA | 6.01e-03 | NA | 2.97e-06 | NA |
| 7. B | Q06850 | Calcium-dependent protein kinase 1 | 5.90e-09 | NA | 3.70e-11 | NA |
| 7. B | Q8T0S6 | Serine/threonine-protein kinase hippo | 2.69e-08 | NA | 6.06e-08 | NA |
| 7. B | Q498D6 | Fibroblast growth factor receptor 4 | 6.20e-05 | NA | 5.52e-11 | NA |
| 7. B | O00311 | Cell division cycle 7-related protein kinase | 1.78e-02 | NA | 4.10e-05 | NA |
| 7. B | Q5MAI5 | Cyclin-dependent kinase-like 4 | 4.25e-09 | NA | 4.00e-13 | NA |
| 7. B | Q06098 | Serine/threonine-protein kinase ISR1 | 1.36e-06 | NA | 4.73e-04 | NA |
| 7. B | Q9YHZ5 | Serine/threonine-protein kinase pim-2 | 3.64e-13 | NA | 2.33e-04 | NA |
| 7. B | Q54VU5 | Probable inactive serine/threonine-protein kinase DDB_G0280131 | 7.64e-04 | NA | 1.20e-06 | NA |
| 7. B | Q54V35 | Probable serine/threonine-protein kinase kinase DDB_G0280643 | 1.69e-05 | NA | 5.02e-04 | NA |
| 7. B | Q9M0E5 | Serine/threonine-protein kinase VPS15 | 1.00e-02 | NA | 3.66e-04 | NA |
| 7. B | Q2L6W9 | Serine/threonine-protein kinase sax-1 | 1.23e-05 | NA | 2.17e-11 | NA |
| 7. B | O43318 | Mitogen-activated protein kinase kinase kinase 7 | 2.76e-06 | NA | 3.00e-11 | NA |
| 7. B | P29320 | Ephrin type-A receptor 3 | 1.94e-04 | NA | 3.27e-13 | NA |
| 7. B | Q9NIV1 | Eukaryotic translation initiation factor 2-alpha kinase | 1.25e-02 | NA | 1.59e-07 | NA |
| 7. B | Q5QNM6 | Putative CBL-interacting protein kinase 13 | 6.66e-08 | NA | 1.32e-16 | NA |
| 7. B | P28708 | Serine/threonine-protein kinase PRR1 | 3.57e-11 | NA | 0.004 | NA |
| 7. B | Q6P3W7 | SCY1-like protein 2 | 7.79e-03 | NA | 0.017 | NA |
| 7. B | Q8C0V0 | Serine/threonine-protein kinase tousled-like 1 | 1.61e-09 | NA | 8.97e-12 | NA |
| 7. B | Q54EY4 | Serine/threonine-protein kinase dst3 | 1.44e-09 | NA | 5.18e-08 | NA |
| 7. B | Q10656 | Myoblast growth factor receptor egl-15 | 2.62e-04 | NA | 6.38e-09 | NA |
| 7. B | O70589 | Peripheral plasma membrane protein CASK | 1.58e-05 | NA | 3.97e-15 | NA |
| 7. B | Q0J4I1 | Cyclin-dependent kinase B2-1 | 1.05e-14 | NA | 2.35e-07 | NA |
| 7. B | Q09898 | Serine/threonine-protein kinase sid2 | 8.86e-08 | NA | 1.92e-12 | NA |
| 7. B | Q13557 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 2.20e-08 | NA | 2.10e-15 | NA |
| 7. B | Q9FIZ3 | LRR receptor-like serine/threonine-protein kinase GSO2 | 2.80e-03 | NA | 1.88e-07 | NA |
| 7. B | O73878 | Ephrin type-B receptor 4b | 6.00e-05 | NA | 2.21e-10 | NA |
| 7. B | Q9C821 | Proline-rich receptor-like protein kinase PERK15 | 4.91e-06 | NA | 2.33e-08 | NA |
| 7. B | F4JBP3 | Serine/threonine-protein kinase ATG1b | 3.75e-07 | NA | 3.78e-17 | NA |
| 7. B | P41279 | Mitogen-activated protein kinase kinase kinase 8 | 1.11e-08 | NA | 4.25e-06 | NA |
| 7. B | O35942 | Serine/threonine-protein kinase Nek2 | 2.21e-11 | NA | 3.73e-13 | NA |
| 7. B | Q5ZCI1 | Mitogen-activated protein kinase 10 | 6.53e-06 | NA | 1.62e-14 | NA |
| 7. B | Q9LRY1 | Probable serine/threonine-protein kinase PBL25 | 1.90e-06 | NA | 5.60e-08 | NA |
| 7. B | Q9XI96 | Proline-rich receptor-like protein kinase PERK7 | 1.13e-04 | NA | 5.55e-07 | NA |
| 7. B | Q9WVC6 | Serine/threonine-protein kinase Sgk1 | 2.11e-08 | NA | 9.73e-12 | NA |
| 7. B | G5ECJ6 | Tyrosine-protein kinase csk-1 | 1.53e-07 | NA | 4.63e-09 | NA |
| 7. B | Q9XEC8 | Cysteine-rich receptor-like protein kinase 38 | 4.44e-04 | NA | 7.74e-07 | NA |
| 7. B | P00546 | Cyclin-dependent kinase 1 | 1.22e-15 | NA | 1.80e-13 | NA |
| 7. B | Q8BPM2 | Mitogen-activated protein kinase kinase kinase kinase 5 | 5.37e-06 | NA | 1.67e-13 | NA |
| 7. B | Q9UHD2 | Serine/threonine-protein kinase TBK1 | 2.15e-07 | NA | 3.43e-10 | NA |
| 7. B | Q9LFG1 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590 | 1.64e-03 | NA | 2.32e-09 | NA |
| 7. B | P52304 | Serine/threonine-protein kinase polo | 1.88e-07 | NA | 1.28e-18 | NA |
| 7. B | P04049 | RAF proto-oncogene serine/threonine-protein kinase | 1.97e-09 | NA | 6.91e-14 | NA |
| 7. B | Q03137 | Ephrin type-A receptor 4 | 4.95e-05 | NA | 1.62e-11 | NA |
| 7. B | Q3UIZ8 | Myosin light chain kinase 3 | 3.90e-06 | NA | 2.81e-13 | NA |
| 7. B | Q8K045 | Serine/threonine-protein kinase N3 | 2.00e-05 | NA | 1.73e-08 | NA |
| 7. B | Q08E52 | Serine/threonine-protein kinase PAK 1 | 2.28e-07 | NA | 1.47e-12 | NA |
| 7. B | Q54G43 | Dual specificity protein kinase shkE | 1.50e-05 | NA | 7.51e-12 | NA |
| 7. B | Q91ZT1 | Vascular endothelial growth factor receptor 3 | 2.77e-03 | NA | 5.66e-08 | NA |
| 7. B | O94647 | Serine/threonine-protein kinase ppk24, mitochondrial | 2.21e-06 | NA | 4.28e-10 | NA |
| 7. B | O80397 | Mitogen-activated protein kinase kinase 4 | 3.66e-15 | NA | 7.26e-17 | NA |
| 7. B | O94235 | Serine/threonine-protein kinase mph1 | 1.42e-06 | NA | 3.68e-08 | NA |
| 7. B | H2L099 | Germinal center kinase 1 | 5.72e-08 | NA | 3.66e-10 | NA |
| 7. B | D3ZGQ5 | Serine/threonine-protein kinase Nek8 | 4.63e-09 | NA | 5.02e-11 | NA |
| 7. B | P16056 | Hepatocyte growth factor receptor | 6.88e-04 | NA | 1.17e-05 | NA |
| 7. B | Q9FKW4 | Calcium-dependent protein kinase 28 | 5.01e-07 | NA | 1.04e-15 | NA |
| 7. B | Q9Y2H1 | Serine/threonine-protein kinase 38-like | 4.94e-07 | NA | 1.11e-09 | NA |
| 7. B | O54992 | MAP kinase-activated protein kinase 5 | 2.40e-05 | NA | 4.27e-11 | NA |
| 7. B | Q9V9J3 | Tyrosine-protein kinase Src42A | 2.28e-11 | NA | 2.49e-10 | NA |
| 7. B | Q7X8C5 | Wall-associated receptor kinase-like 2 | 7.51e-05 | NA | 1.24e-12 | NA |
| 7. B | Q66JT0 | Wee1-like protein kinase 2 | 1.48e-07 | NA | 7.65e-04 | NA |
| 7. B | Q2QQR2 | Calcium-dependent protein kinase 27 | 1.94e-06 | NA | 6.26e-13 | NA |
| 7. B | P00543 | Tyrosine-protein kinase transforming protein Fes | NA | NA | 8.72e-13 | NA |
| 7. B | P52333 | Tyrosine-protein kinase JAK3 | 4.39e-04 | NA | 1.30e-09 | NA |
| 7. B | O23304 | Serine/threonine-protein kinase BLUS1 | 2.99e-08 | NA | 7.10e-09 | NA |
| 7. B | Q54P26 | Probable serine/threonine-protein kinase samkB | 2.40e-06 | NA | 6.93e-07 | NA |
| 7. B | Q55FJ6 | Probable serine/threonine-protein kinase DDB_G0268078 | 8.25e-09 | NA | 2.94e-09 | NA |
| 7. B | A8R7E6 | Chitin elicitor receptor kinase 1 | 4.77e-04 | NA | 3.95e-08 | NA |
| 7. B | P34101 | Probable serine/threonine-protein kinase fhkC | 1.08e-08 | NA | 2.18e-19 | NA |
| 7. B | Q69JN6 | Brassinosteroid LRR receptor kinase BRL1 | 1.11e-02 | NA | 4.35e-10 | NA |
| 7. B | Q55GJ2 | Probable serine/threonine-protein kinase ireA | 3.58e-04 | NA | 5.16e-10 | NA |
| 7. B | Q4V8A3 | Dual specificity tyrosine-phosphorylation-regulated kinase 3 | 9.73e-08 | NA | 1.70e-09 | NA |
| 7. B | Q8BZN4 | NUAK family SNF1-like kinase 2 | 9.80e-08 | NA | 5.93e-12 | NA |
| 7. B | Q54WS5 | Probable serine/threonine-protein kinase roco6 | 1.04e-03 | NA | 3.37e-08 | NA |
| 7. B | Q21017 | Serine/threonine-protein kinase kin-29 | 2.83e-06 | NA | 5.06e-08 | NA |
| 7. B | Q69SP5 | LRR receptor-like serine/threonine-protein kinase ER1 | 4.75e-03 | NA | 4.44e-07 | NA |
| 7. B | P00539 | Proto-oncogene serine/threonine-protein kinase mos | 1.69e-09 | NA | 6.51e-14 | NA |
| 7. B | Q6NQ87 | Cysteine-rich receptor-like protein kinase 22 | 1.62e-04 | NA | 3.39e-05 | NA |
| 7. B | Q9LP77 | Probable inactive receptor kinase At1g48480 | 2.76e-06 | NA | 0.002 | NA |
| 7. B | Q62726 | Serine/threonine-protein kinase ICK | 1.93e-10 | NA | 2.72e-10 | NA |
| 7. B | Q5RJI5 | Serine/threonine-protein kinase BRSK1 | 5.12e-06 | NA | 3.19e-15 | NA |
| 7. B | Q9H4A3 | Serine/threonine-protein kinase WNK1 | 7.17e-03 | NA | 1.84e-09 | NA |
| 7. B | O81291 | L-type lectin-domain containing receptor kinase IV.4 | 7.54e-05 | NA | 1.21e-05 | NA |
| 7. B | Q54H05 | Probable serine/threonine-protein kinase kinY | 3.80e-06 | NA | 3.53e-04 | NA |
| 7. B | Q9LEA3 | Putative L-type lectin-domain containing receptor kinase V.6 | 2.18e-05 | NA | 1.15e-07 | NA |
| 7. B | Q9WTU6 | Mitogen-activated protein kinase 9 | 5.98e-06 | NA | 3.62e-14 | NA |
| 7. B | A1Z7T0 | Serine/threonine-protein kinase N | 2.03e-04 | NA | 4.20e-08 | NA |
| 7. B | Q5W736 | CBL-interacting protein kinase 18 | 1.42e-08 | NA | 1.37e-17 | NA |
| 7. B | Q9M1G3 | Probable L-type lectin-domain containing receptor kinase I.6 | 4.02e-04 | NA | 0.032 | NA |
| 7. B | Q00532 | Cyclin-dependent kinase-like 1 | 1.24e-08 | NA | 1.56e-13 | NA |
| 7. B | Q9LSL5 | L-type lectin-domain containing receptor kinase IX.2 | 8.20e-05 | NA | 4.04e-13 | NA |
| 7. B | D4A280 | Serine/threonine-protein kinase PAK 5 | 4.78e-05 | NA | 3.88e-12 | NA |
| 7. B | Q9BYT3 | Serine/threonine-protein kinase 33 | 4.12e-09 | NA | 5.30e-12 | NA |
| 7. B | Q61410 | cGMP-dependent protein kinase 2 | 1.03e-06 | NA | 4.64e-09 | NA |
| 7. B | Q7Z2Y5 | Nik-related protein kinase | 8.31e-04 | NA | 1.10e-14 | NA |
| 7. B | Q2QY37 | Calcium-dependent protein kinase 26 | 3.13e-09 | NA | 2.34e-12 | NA |
| 7. B | Q8RY65 | Protein NSP-INTERACTING KINASE 2 | 4.96e-04 | NA | 8.72e-09 | NA |
| 7. B | Q8RZV7 | Leucine-rich repeat receptor protein kinase MSP1 | 1.29e-02 | NA | 2.70e-08 | NA |
| 7. B | Q9VXE5 | Serine/threonine-protein kinase PAK mbt | 3.49e-06 | NA | 2.39e-09 | NA |
| 7. B | Q9FGL5 | Receptor protein-tyrosine kinase CEPR1 | 1.16e-03 | NA | 4.53e-10 | NA |
| 7. B | Q9LU47 | Putative U-box domain-containing protein 53 | 4.50e-03 | NA | 3.18e-04 | NA |
| 7. B | Q7SY52 | Serine/threonine-protein kinase 10 | 3.68e-06 | NA | 5.74e-18 | NA |
| 7. B | Q9WVS4 | MAPK/MAK/MRK overlapping kinase | 8.37e-09 | NA | 8.96e-11 | NA |
| 7. B | Q8LEB6 | Probable receptor-like protein kinase At5g18500 | 2.86e-05 | NA | 1.50e-07 | NA |
| 7. B | Q9LVL5 | Probable serine/threonine-protein kinase WNK4 | 3.33e-06 | NA | 2.86e-07 | NA |
| 7. B | Q5VP69 | Mitogen-activated protein kinase 16 | 8.61e-06 | NA | 2.64e-14 | NA |
| 7. B | Q55CZ1 | Probable serine/threonine-protein kinase gdt2 | 2.44e-03 | NA | 1.30e-09 | NA |
| 7. B | Q7FAZ3 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK1 | 1.88e-04 | NA | 1.64e-09 | NA |
| 7. B | Q8S9L6 | Cysteine-rich receptor-like protein kinase 29 | 7.22e-05 | NA | 8.53e-09 | NA |
| 7. B | Q21734 | Putative ribosomal protein S6 kinase alpha-1 | 1.75e-05 | NA | 7.14e-18 | NA |
| 7. B | O54785 | LIM domain kinase 2 | 4.88e-08 | NA | 5.01e-05 | NA |
| 7. B | Q63638 | Striated muscle-specific serine/threonine-protein kinase | NA | NA | 6.14e-07 | NA |
| 7. B | Q55CA6 | Probable serine/threonine-protein kinase DDB_G0270146 | 4.02e-06 | NA | 2.01e-14 | NA |
| 7. B | C0LGF4 | LRR receptor-like serine/threonine-protein kinase FEI 1 | 1.47e-05 | NA | 3.88e-12 | NA |
| 7. B | Q2QMH1 | Serine/threonine-protein kinase Nek2 | 4.59e-07 | NA | 5.52e-17 | NA |
| 7. B | Q5VT25 | Serine/threonine-protein kinase MRCK alpha | 1.95e-03 | NA | 1.40e-14 | NA |
| 7. B | P49101 | Calcium-dependent protein kinase 2 | 1.04e-08 | NA | 4.72e-09 | NA |
| 7. B | Q8SSY6 | Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase | 5.59e-02 | NA | 9.29e-06 | NA |
| 7. B | Q54TN4 | Probable serine/threonine-protein kinase mkcE | 1.08e-07 | NA | 9.84e-07 | NA |
| 7. B | O95747 | Serine/threonine-protein kinase OSR1 | 3.90e-08 | NA | 1.03e-15 | NA |
| 7. B | P37172 | Activin receptor type-1 | 2.09e-10 | NA | 1.94e-05 | NA |
| 7. B | Q7X996 | CBL-interacting protein kinase 2 | 1.97e-08 | NA | 2.60e-19 | NA |
| 7. B | Q03142 | Fibroblast growth factor receptor 4 | 6.49e-05 | NA | 2.47e-09 | NA |
| 7. B | Q9WV60 | Glycogen synthase kinase-3 beta | 1.90e-07 | NA | 1.17e-05 | NA |
| 7. B | Q2QYL8 | Probable serine/threonine-protein kinase WNK8 | 3.12e-05 | NA | 2.13e-07 | NA |
| 7. B | O35495 | Cyclin-dependent kinase 14 | 1.43e-12 | NA | 6.74e-12 | NA |
| 7. B | P49674 | Casein kinase I isoform epsilon | 8.47e-09 | NA | 4.42e-12 | NA |
| 7. B | P23111 | Cell division control protein 2 homolog | 1.11e-16 | NA | 2.11e-10 | NA |
| 7. B | Q8JFR5 | Mast/stem cell growth factor receptor kita | 4.62e-04 | NA | 2.30e-08 | NA |
| 7. B | Q9M2Z1 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 | 7.72e-04 | NA | 1.95e-05 | NA |
| 7. B | Q23915 | Probable serine/threonine-protein kinase kinX | 4.49e-05 | NA | 1.28e-12 | NA |
| 7. B | Q4WJJ0 | Mitogen-activated protein kinase kinae mkk2 | 4.84e-08 | NA | 3.79e-12 | NA |
| 7. B | Q8BI55 | Dual specificity tyrosine-phosphorylation-regulated kinase 4 | 1.23e-10 | NA | 1.51e-08 | NA |
| 7. B | P92199 | Rho-associated protein kinase let-502 | 2.06e-04 | NA | 1.45e-13 | NA |
| 7. B | Q54XQ2 | RGS domain-containing serine/threonine-protein kinase A | 1.07e-03 | NA | 1.33e-11 | NA |
| 7. B | P04413 | Serine/threonine-protein kinase US3 | NA | NA | 0.018 | NA |
| 7. B | Q9MAM1 | CBL-interacting serine/threonine-protein kinase 9 | 7.34e-09 | NA | 1.30e-17 | NA |
| 7. B | F4JEQ2 | Probable serine/threonine-protein kinase PBL23 | 1.95e-06 | NA | 4.92e-08 | NA |
| 7. B | Q66L42 | Mitogen-activated protein kinase kinase kinase 10 | 4.84e-07 | NA | 7.13e-10 | NA |
| 7. B | P57058 | Hormonally up-regulated neu tumor-associated kinase | 3.50e-08 | NA | 2.43e-18 | NA |
| 7. B | P93759 | Calcium-dependent protein kinase 14 | 1.39e-08 | NA | 6.14e-14 | NA |
| 7. B | Q8NEV4 | Myosin-IIIa | 1.45e-03 | NA | 8.69e-17 | NA |
| 7. B | P18653 | Ribosomal protein S6 kinase alpha-1 | 1.13e-05 | NA | 8.56e-14 | NA |
| 7. B | P34891 | Receptor-like tyrosine-protein kinase kin-15 | 1.46e-07 | NA | 8.13e-07 | NA |
| 7. B | Q8LKZ1 | Nodulation receptor kinase | 3.96e-03 | NA | 3.54e-06 | NA |
| 7. B | P23647 | Serine/threonine-protein kinase fused | 7.92e-07 | NA | 4.34e-15 | NA |
| 7. B | Q9LDN1 | Putative cysteine-rich receptor-like protein kinase 33 | 2.55e-04 | NA | 2.99e-08 | NA |
| 7. B | Q90999 | TGF-beta receptor type-2 | 1.16e-09 | NA | 4.72e-08 | NA |
| 7. B | Q9FIF0 | Putative L-type lectin-domain containing receptor kinase II.2 | 9.85e-05 | NA | 0.002 | NA |
| 7. B | Q62312 | TGF-beta receptor type-2 | 1.04e-06 | NA | 1.41e-07 | NA |
| 7. B | P24723 | Protein kinase C eta type | 1.05e-05 | NA | 5.05e-12 | NA |
| 7. B | Q5AAG6 | Mitogen-activated protein kinase MKC1 | 3.59e-08 | NA | 1.55e-15 | NA |
| 7. B | Q9LK43 | Receptor-like kinase TMK4 | 2.49e-03 | NA | 7.87e-08 | NA |
| 7. B | Q54JC7 | Probable serine/threonine-protein kinase DDB_G0288147 | 6.07e-04 | NA | 1.53e-08 | NA |
| 7. B | Q9FK63 | Calmodulin-binding receptor kinase CaMRLK | 1.22e-04 | NA | 7.40e-04 | NA |
| 7. B | Q9N2L7 | Serine/threonine-protein kinase plk-2 | 2.26e-07 | NA | 5.44e-12 | NA |
| 7. B | Q9LZW4 | CBL-interacting serine/threonine-protein kinase 14 | 1.61e-08 | NA | 1.30e-12 | NA |
| 7. B | Q9V6K3 | Tyrosine-protein kinase transmembrane receptor Ror2 | 3.92e-09 | NA | 8.53e-09 | NA |
| 7. B | Q9H3Y6 | Tyrosine-protein kinase Srms | 5.39e-09 | NA | 1.62e-10 | NA |
| 7. B | P9WI79 | Serine/threonine-protein kinase PknD | 3.37e-08 | NA | 5.11e-20 | NA |
| 7. B | Q04736 | Tyrosine-protein kinase Yes | 4.03e-11 | NA | 2.92e-06 | NA |
| 7. B | Q96RR4 | Calcium/calmodulin-dependent protein kinase kinase 2 | 9.64e-07 | NA | 1.07e-12 | NA |
| 7. B | Q95ZQ4 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 1.81e-07 | NA | 3.75e-17 | NA |
| 7. B | Q54U31 | Dual specificity protein kinase shkD | 4.25e-07 | NA | 1.87e-12 | NA |
| 7. B | Q8CIN4 | Serine/threonine-protein kinase PAK 2 | 1.95e-07 | NA | 2.84e-11 | NA |
| 7. B | Q28DZ1 | Inhibitor of nuclear factor kappa-B kinase subunit alpha | 1.83e-04 | NA | 6.32e-09 | NA |
| 7. B | Q38SD2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 3.56e-02 | NA | 4.99e-06 | NA |
| 7. B | P19525 | Interferon-induced, double-stranded RNA-activated protein kinase | 1.10e-05 | NA | 2.85e-12 | NA |
| 7. B | Q8I7I5 | Protein roller-3 | 3.60e-02 | NA | 2.93e-04 | NA |
| 7. B | Q5MPA9 | Serine/threonine-protein kinase DCLK2 | 1.07e-05 | NA | 3.83e-11 | NA |
| 7. B | Q09792 | Serine/threonine-protein kinase ppk8 | 2.20e-06 | NA | 0.024 | NA |
| 7. B | Q4JIM5 | Tyrosine-protein kinase ABL2 | 4.63e-04 | NA | 1.39e-08 | NA |
| 7. B | Q8BSK8 | Ribosomal protein S6 kinase beta-1 | 1.13e-07 | NA | 5.01e-12 | NA |
| 7. B | D4A7V9 | eIF-2-alpha kinase GCN2 | 1.05e-02 | NA | 8.10e-09 | NA |
| 7. B | Q9LMM5 | Mitogen-activated protein kinase 11 | 4.27e-08 | NA | 4.33e-11 | NA |
| 7. B | Q869T7 | Serine/threonine-protein kinase pakF | 8.34e-06 | NA | 3.28e-14 | NA |
| 7. B | O64776 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61440 | 3.39e-04 | NA | 7.87e-06 | NA |
| 7. B | Q9FN93 | Probable LRR receptor-like serine/threonine-protein kinase At5g59680 | 9.16e-04 | NA | 3.25e-08 | NA |
| 7. B | Q21307 | Dual specificity mitogen-activated protein kinase kinase mek-1 | 1.02e-08 | NA | 5.18e-08 | NA |
| 7. B | Q54XY6 | Probable serine/threonine-protein kinase DDB_G0278521 | 9.26e-06 | NA | 4.55e-09 | NA |
| 7. B | O65440 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 | 1.88e-06 | NA | 4.94e-10 | NA |
| 7. B | Q9FX99 | Probable receptor-like protein kinase At1g49730 | 1.22e-08 | NA | 2.70e-08 | NA |
| 7. B | F4J6F6 | Probable serine/threonine protein kinase IREH1 | 3.40e-04 | NA | 1.78e-12 | NA |
| 7. B | Q9ZSA4 | Calcium-dependent protein kinase 27 | 1.54e-08 | NA | 1.70e-11 | NA |
| 7. B | P9WI77 | Serine/threonine-protein kinase PknE | 1.07e-10 | NA | 1.48e-18 | NA |
| 7. B | Q757X8 | Probable serine/threonine-protein kinase HAL5-like | 3.05e-05 | NA | 2.48e-10 | NA |
| 7. B | F4I114 | Probable serine/threonine-protein kinase At1g09600 | 2.35e-06 | NA | 7.04e-04 | NA |
| 7. B | Q5A3P6 | Serine/threonine-protein kinase PKH2 | 7.36e-06 | NA | 4.46e-10 | NA |
| 7. B | Q9FXF2 | Probable LRR receptor-like serine/threonine-protein kinase RFK1 | 1.80e-03 | NA | 3.48e-09 | NA |
| 7. B | Q3V129 | Serine/threonine-protein kinase ULK4 | 7.87e-04 | NA | 2.33e-04 | NA |
| 7. B | O61661 | Serine/threonine-protein kinase grp | 9.46e-06 | NA | 2.69e-11 | NA |
| 7. B | O04534 | Putative L-type lectin-domain containing receptor kinase V.1 | 9.24e-05 | NA | 3.43e-11 | NA |
| 7. B | Q2V419 | Cyclin-dependent kinase B1-2 | 1.14e-14 | NA | 1.56e-07 | NA |
| 7. B | Q8N5S9 | Calcium/calmodulin-dependent protein kinase kinase 1 | 2.66e-07 | NA | 1.67e-11 | NA |
| 7. B | Q9LSE1 | Serine/threonine-protein kinase CDG1 | 3.90e-06 | NA | 1.72e-08 | NA |
| 7. B | Q6AWJ9 | Tyrosine-protein kinase-like otk | 3.51e-03 | NA | 0.002 | NA |
| 7. B | Q4WVG0 | Protein kinase C | 1.18e-04 | NA | 2.98e-08 | NA |
| 7. B | P35918 | Vascular endothelial growth factor receptor 2 | 2.08e-05 | NA | 4.34e-07 | NA |
| 7. B | O64780 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61400 | 9.92e-04 | NA | 7.87e-06 | NA |
| 7. B | Q1PFB9 | Serine/threonine-protein kinase AGC1-7 | 1.28e-06 | NA | 9.08e-05 | NA |
| 7. B | Q04859 | Serine/threonine-protein kinase MAK | 5.36e-08 | NA | 7.10e-09 | NA |
| 7. B | P18265 | Glycogen synthase kinase-3 alpha | 6.54e-07 | NA | 1.91e-06 | NA |
| 7. B | Q5SN53 | Mitogen-activated protein kinase 8 | 4.64e-06 | NA | 4.14e-12 | NA |
| 7. B | Q54C71 | Kinase and exchange factor for Rac B | 9.87e-07 | NA | 1.01e-07 | NA |
| 7. B | O02466 | Insulin-like peptide receptor | 4.03e-04 | NA | 2.39e-07 | NA |
| 7. B | Q63651 | Rhodopsin kinase GRK1 | 3.78e-07 | NA | 1.03e-17 | NA |
| 7. B | P51817 | cAMP-dependent protein kinase catalytic subunit PRKX | 2.84e-10 | NA | 2.00e-09 | NA |
| 7. B | Q13470 | Non-receptor tyrosine-protein kinase TNK1 | 2.62e-06 | NA | 5.88e-09 | NA |
| 7. B | Q54E34 | Probable protein kinase DDB_G0291842 | 5.67e-09 | NA | 6.84e-14 | NA |
| 7. B | P25390 | Serine/threonine-protein kinase SSK22 | 1.26e-06 | NA | 1.50e-10 | NA |
| 7. B | Q9USX7 | Serine/threonine-protein kinase ppk22 | 2.12e-08 | NA | 5.95e-11 | NA |
| 7. B | Q9JI10 | Serine/threonine-protein kinase 3 | 4.47e-08 | NA | 9.93e-10 | NA |
| 7. B | O04086 | Probable receptor-like protein kinase At1g11050 | 5.17e-05 | NA | 1.03e-07 | NA |
| 7. B | Q96Q04 | Serine/threonine-protein kinase LMTK3 | 2.44e-03 | NA | 1.53e-05 | NA |
| 7. B | P26618 | Platelet-derived growth factor receptor alpha | 1.54e-03 | NA | 3.56e-05 | NA |
| 7. B | Q55BA0 | Probable serine/threonine-protein kinase DDB_G0271402 | 6.11e-07 | NA | 0.009 | NA |
| 7. B | O15075 | Serine/threonine-protein kinase DCLK1 | 9.07e-06 | NA | 1.83e-13 | NA |
| 7. B | O08815 | STE20-like serine/threonine-protein kinase | 1.06e-04 | NA | 2.29e-17 | NA |
| 7. B | Q05652 | Serine/threonine-protein kinase pelle | 1.93e-05 | NA | 1.47e-07 | NA |
| 7. B | Q9M101 | Calcium-dependent protein kinase 23 | 4.46e-08 | NA | 2.45e-11 | NA |
| 7. B | O65472 | Putative cysteine-rich receptor-like protein kinase 12 | 4.84e-05 | NA | 4.32e-09 | NA |
| 7. B | Q9FIL7 | Calmodulin-binding receptor-like cytoplasmic kinase 1 | 8.50e-05 | NA | 9.15e-13 | NA |
| 7. B | P22987 | Protein kinase kin1 | 3.73e-05 | NA | 3.46e-08 | NA |
| 7. B | Q15835 | Rhodopsin kinase GRK1 | 3.76e-07 | NA | 3.39e-16 | NA |
| 7. B | P32944 | Mitosis inhibitor protein kinase SWE1 | 3.17e-07 | NA | 8.86e-07 | NA |
| 7. B | P0C1S8 | Wee1-like protein kinase 2 | 4.42e-08 | NA | 0.040 | NA |
| 7. B | Q54TA1 | Probable serine/threonine-protein kinase drkC | 1.16e-06 | NA | 2.79e-13 | NA |
| 7. B | P46892 | Cyclin-dependent kinase 11B | 3.51e-07 | NA | 2.81e-13 | NA |
| 7. B | Q55GC2 | Serine/threonine-protein kinase dst2 | 3.41e-06 | NA | 1.69e-15 | NA |
| 7. B | Q39191 | Wall-associated receptor kinase 1 | 1.52e-03 | NA | 3.31e-06 | NA |
| 7. B | Q9LMN6 | Wall-associated receptor kinase 4 | 2.94e-04 | NA | 2.97e-08 | NA |
| 7. B | P97523 | Hepatocyte growth factor receptor | 6.86e-04 | NA | 9.66e-06 | NA |
| 7. B | Q54RP7 | Probable serine/threonine-protein kinase DDB_G0283065 | 5.84e-04 | NA | 5.56e-05 | NA |
| 7. B | Q9FID8 | Putative receptor-like protein kinase At5g39000 | 5.23e-03 | NA | 4.68e-08 | NA |
| 7. B | P35968 | Vascular endothelial growth factor receptor 2 | 2.36e-05 | NA | 1.35e-06 | NA |
| 7. B | Q9SCZ4 | Receptor-like protein kinase FERONIA | 3.70e-04 | NA | 6.42e-10 | NA |
| 7. B | Q76NV1 | Probable serine/threonine-protein kinase dyrk1 | 8.36e-06 | NA | 1.44e-08 | NA |
| 7. B | A1A5Q6 | Sperm motility kinase | 2.84e-06 | NA | 1.89e-12 | NA |
| 7. B | P06803 | Serine/threonine-protein kinase pim-1 | 7.55e-09 | NA | 7.27e-10 | NA |
| 7. B | O15146 | Muscle, skeletal receptor tyrosine-protein kinase | 1.11e-05 | NA | 2.73e-05 | NA |
| 7. B | Q03497 | Serine/threonine-protein kinase STE20 | 1.29e-06 | NA | 2.23e-11 | NA |
| 7. B | P29321 | Ephrin type-A receptor 8 (Fragment) | 8.26e-09 | NA | 6.97e-14 | NA |
| 7. B | P24348 | Receptor tyrosine-protein kinase let-23 | 8.15e-05 | NA | 2.58e-10 | NA |
| 7. B | Q9H1R3 | Myosin light chain kinase 2, skeletal/cardiac muscle | 6.19e-09 | NA | 1.22e-10 | NA |
| 7. B | Q62407 | Striated muscle-specific serine/threonine-protein kinase | NA | NA | 1.26e-06 | NA |
| 7. B | D3ZML2 | Serine/threonine-protein kinase BRSK2 | 2.23e-06 | NA | 7.71e-17 | NA |
| 7. B | P49761 | Dual specificity protein kinase CLK3 | 3.07e-07 | NA | 5.64e-10 | NA |
| 7. B | P48025 | Tyrosine-protein kinase SYK | 1.97e-10 | NA | 1.45e-09 | NA |
| 7. B | Q86YV6 | Myosin light chain kinase family member 4 | 4.25e-09 | NA | 2.05e-15 | NA |
| 7. B | P50527 | Serine/threonine-protein kinase shk1/pak1 | 3.26e-06 | NA | 1.91e-14 | NA |
| 7. B | Q9Y616 | Interleukin-1 receptor-associated kinase 3 | 1.21e-04 | NA | 0.015 | NA |
| 7. B | P08941 | Proto-oncogene tyrosine-protein kinase ROS | 1.35e-02 | NA | 1.98e-07 | NA |
| 7. B | Q1JPZ3 | Proto-oncogene tyrosine-protein kinase Src | 9.81e-11 | NA | 2.48e-07 | NA |
| 7. B | Q9WVL4 | Rhodopsin kinase GRK1 | 3.73e-07 | NA | 9.72e-18 | NA |
| 7. B | Q5SUV5 | Myosin light chain kinase family member 4 | 8.23e-09 | NA | 1.37e-13 | NA |
| 7. B | Q9ZSA3 | Calcium-dependent protein kinase 22 | 2.00e-09 | NA | 1.00e-08 | NA |
| 7. B | P53974 | Actin-regulating kinase 1 | 5.22e-07 | NA | 4.20e-08 | NA |
| 7. B | Q9QZR5 | Homeodomain-interacting protein kinase 2 | 6.54e-05 | NA | 9.70e-07 | NA |
| 7. B | Q2UGZ7 | Serine/threonine-protein kinase atg1 | 3.76e-06 | NA | 3.10e-08 | NA |
| 7. B | Q69IM9 | Calcium-dependent protein kinase 22 | 5.26e-08 | NA | 2.22e-12 | NA |
| 7. B | Q9ZNQ8 | Proline-rich receptor-like protein kinase PERK4 | 4.04e-05 | NA | 3.68e-07 | NA |
| 7. B | Q558U1 | Probable serine/threonine-protein kinase ifkA | 4.33e-01 | NA | 8.60e-08 | NA |
| 7. B | Q9FZB8 | Probable LRR receptor-like serine/threonine-protein kinase At1g51810 | 9.44e-04 | NA | 8.75e-08 | NA |
| 7. B | P42818 | Serine/threonine-protein kinase AtPK1/AtPK6 | 1.47e-09 | NA | 3.13e-12 | NA |
| 7. B | Q1HKZ5 | Mitogen-activated protein kinase kinase kinase 13 | 1.34e-05 | NA | 1.27e-13 | NA |
| 7. B | O65924 | Putative leucine-rich repeat receptor-like protein kinase At2g19210 | 4.50e-04 | NA | 4.03e-10 | NA |
| 7. B | Q9SYQ8 | Receptor protein kinase CLAVATA1 | 1.36e-03 | NA | 8.35e-05 | NA |
| 7. B | Q21360 | MAP kinase-activated protein kinase mak-1 | 3.74e-05 | NA | 3.41e-08 | NA |
| 7. B | Q9QZ05 | eIF-2-alpha kinase GCN2 | 1.49e-02 | NA | 9.93e-09 | NA |
| 7. B | Q8K4K3 | Tribbles homolog 2 | 3.62e-09 | NA | 0.008 | NA |
| 7. B | Q8W4I7 | Calcium-dependent protein kinase 13 | 5.32e-08 | NA | 9.00e-17 | NA |
| 7. B | Q55A09 | Probable serine/threonine-protein kinase DDB_G0272254 | 4.37e-06 | NA | 8.64e-11 | NA |
| 7. B | P00534 | Tyrosine-protein kinase transforming protein erbB | NA | NA | 4.39e-12 | NA |
| 7. B | P32361 | Serine/threonine-protein kinase/endoribonuclease IRE1 | 3.01e-03 | NA | 0.007 | NA |
| 7. B | Q9UEW8 | STE20/SPS1-related proline-alanine-rich protein kinase | 6.49e-08 | NA | 3.91e-16 | NA |
| 7. B | O49839 | Probable serine/threonine-protein kinase PBL2 | 1.75e-05 | NA | 5.49e-09 | NA |
| 7. B | P0C1X8 | AP2-associated protein kinase 1 | 7.46e-06 | NA | 0.031 | NA |
| 7. B | Q8ICR0 | Calcium-dependent protein kinase 2 | 3.38e-08 | NA | 1.40e-14 | NA |
| 7. B | Q923T9 | Calcium/calmodulin-dependent protein kinase type II subunit gamma | 1.06e-09 | NA | 1.69e-14 | NA |
| 7. B | Q54JQ1 | Probable serine/threonine-protein kinase mkcC | 1.81e-05 | NA | 1.09e-11 | NA |
| 7. B | Q17IE8 | Cyclin-dependent kinase 8 | 4.24e-08 | NA | 1.11e-05 | NA |
| 7. B | Q8W4P1 | Cyclin-dependent kinase C-2 | 1.59e-07 | NA | 7.21e-07 | NA |
| 7. B | O64771 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480 | 3.81e-04 | NA | 1.60e-07 | NA |
| 7. B | P53355 | Death-associated protein kinase 1 | 5.51e-04 | NA | 1.89e-14 | NA |
| 7. B | O70146 | Dual specificity testis-specific protein kinase 1 | 4.92e-10 | NA | 6.42e-04 | NA |
| 7. B | P46549 | Serine/threonine-protein kinase SULU | 2.35e-04 | NA | 8.90e-07 | NA |
| 7. B | Q66HA1 | Mitogen-activated protein kinase kinase kinase 11 | 1.92e-07 | NA | 1.82e-10 | NA |
| 7. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 3.21e-06 | NA | 1.50e-08 | NA |
| 7. B | Q6P5Z2 | Serine/threonine-protein kinase N3 | 1.86e-05 | NA | 7.25e-08 | NA |
| 7. B | P27038 | Activin receptor type-2A | 1.36e-06 | NA | 1.39e-08 | NA |
| 7. B | Q8MYF1 | Probable serine/threonine-protein kinase DDB_G0277449 | 1.42e-09 | NA | 1.25e-12 | NA |
| 7. B | O35493 | Dual specificity protein kinase CLK4 | 3.34e-12 | NA | 1.58e-08 | NA |
| 7. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 1.58e-02 | NA | 0.005 | NA |
| 7. B | O61460 | Ephrin receptor 1 | 5.34e-04 | NA | 0.013 | NA |
| 7. B | G5EFV5 | Cyclin-dependent kinase 7 | 3.33e-11 | NA | 3.75e-12 | NA |
| 7. B | P22694 | cAMP-dependent protein kinase catalytic subunit beta | 1.48e-14 | NA | 5.36e-08 | NA |
| 7. B | Q03141 | MAP/microtubule affinity-regulating kinase 3 | 3.21e-06 | NA | 8.23e-15 | NA |
| 7. B | O09110 | Dual specificity mitogen-activated protein kinase kinase 3 | 5.18e-10 | NA | 2.35e-12 | NA |
| 7. B | Q12310 | Serine/threonine-protein kinase PRR2 | 2.39e-06 | NA | 8.40e-04 | NA |
| 7. B | Q3UU96 | Serine/threonine-protein kinase MRCK alpha | 3.73e-04 | NA | 2.23e-15 | NA |
| 7. B | Q7TT50 | Serine/threonine-protein kinase MRCK beta | 1.69e-03 | NA | 1.35e-14 | NA |
| 7. B | Q55G97 | TBC domain-containing protein kinase-like protein | 1.17e-02 | NA | 0.007 | NA |
| 7. B | Q91ZR4 | Serine/threonine-protein kinase Nek8 | 5.27e-09 | NA | 2.43e-11 | NA |
| 7. B | Q55EI8 | Probable serine/threonine-protein kinase DDB_G0268876 | 1.91e-04 | NA | 5.60e-14 | NA |
| 7. B | P47196 | RAC-alpha serine/threonine-protein kinase | 8.80e-08 | NA | 1.50e-12 | NA |
| 7. B | A1Z9X0 | Atypical protein kinase C | 2.93e-07 | NA | 9.11e-16 | NA |
| 7. B | Q08345 | Epithelial discoidin domain-containing receptor 1 | 4.51e-05 | NA | 9.95e-08 | NA |
| 7. B | P80201 | Activin receptor type-1 | 1.51e-07 | NA | 1.94e-05 | NA |
| 7. B | O22932 | CBL-interacting serine/threonine-protein kinase 11 | 9.68e-10 | NA | 1.51e-22 | NA |
| 7. B | Q54WX4 | Aurora kinase | 7.69e-14 | NA | 2.26e-12 | NA |
| 7. B | Q9XID3 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300 | 1.08e-03 | NA | 5.93e-10 | NA |
| 7. B | Q39030 | Serine/threonine-protein kinase AtPK2/AtPK19 | 2.27e-09 | NA | 2.09e-13 | NA |
| 7. B | Q96WV9 | Probable cyclin-dependent kinase 9 | 2.84e-08 | NA | 1.36e-07 | NA |
| 7. B | F4HQ20 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5 | 8.16e-04 | NA | 5.39e-08 | NA |
| 7. B | P11681 | Tyrosine-protein kinase ABL (Fragment) | 7.60e-03 | NA | 6.76e-04 | NA |
| 7. B | G5ECQ3 | Serine/threonine-protein kinase sel-5 | 2.20e-05 | NA | 0.011 | NA |
| 7. B | O75962 | Triple functional domain protein | NA | NA | 1.43e-05 | NA |
| 7. B | Q9LS95 | Putative proline-rich receptor-like protein kinase PERK6 | 7.79e-05 | NA | 1.31e-06 | NA |
| 7. B | F4KA51 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.3 | 8.03e-05 | NA | 8.98e-07 | NA |
| 7. B | P38691 | Serine/threonine-protein kinase KSP1 | 1.74e-03 | NA | 2.50e-08 | NA |
| 7. B | F1SPM8 | AP2-associated protein kinase 1 | 7.12e-06 | NA | 0.016 | NA |
| 7. B | O94537 | Sensor for unfolded proteins in the ER ire1 | 5.06e-04 | NA | 1.88e-07 | NA |
| 7. B | Q6PGN3 | Serine/threonine-protein kinase DCLK2 | 6.11e-05 | NA | 2.15e-10 | NA |
| 7. B | P00528 | Tyrosine-protein kinase Src64B | 5.28e-10 | NA | 1.62e-08 | NA |
| 7. B | Q8SSS9 | Probable serine/threonine-protein kinase qkgA | 8.49e-04 | NA | 0.010 | NA |
| 7. B | P36888 | Receptor-type tyrosine-protein kinase FLT3 | 1.89e-06 | NA | 1.46e-07 | NA |
| 7. B | P53351 | Serine/threonine-protein kinase PLK2 | 2.81e-06 | NA | 1.09e-16 | NA |
| 7. B | Q9M0T3 | Mitogen-activated protein kinase kinase kinase 3 | 2.68e-12 | NA | 4.44e-12 | NA |
| 7. B | Q93Y06 | Probable inactive receptor kinase At5g67200 | 1.54e-05 | NA | 3.68e-04 | NA |
| 7. B | Q54N73 | Seven transmembrane domain-containing tyrosine-protein kinase 1 | 5.94e-09 | NA | 3.59e-10 | NA |
| 7. B | Q54HD2 | Probable serine/threonine-protein kinase ndrD | 5.78e-03 | NA | 0.042 | NA |
| 7. B | Q94C40 | CBL-interacting serine/threonine-protein kinase 17 | 6.66e-09 | NA | 3.01e-17 | NA |
| 7. B | Q0KHQ5 | Serine/threonine-protein kinase Tao | 3.48e-05 | NA | 7.16e-08 | NA |
| 7. B | P51839 | Guanylate cyclase 2D | 2.72e-05 | NA | 0.026 | NA |
| 7. B | Q6R2K2 | Protein STRUBBELIG-RECEPTOR FAMILY 4 | 6.41e-05 | NA | 4.29e-06 | NA |
| 7. B | Q924I2 | Mitogen-activated protein kinase kinase kinase kinase 3 | 8.47e-05 | NA | 1.86e-13 | NA |
| 7. B | Q54JG7 | Serine/threonine-protein kinase dst4 | 3.08e-10 | NA | 7.40e-13 | NA |
| 7. B | Q05030 | Platelet-derived growth factor receptor beta | 7.39e-03 | NA | 1.57e-06 | NA |
| 7. B | Q54TM7 | Probable serine/threonine-protein kinase drkD | 9.41e-05 | NA | 1.83e-06 | NA |
| 7. B | A2AAJ9 | Obscurin | NA | NA | 9.47e-09 | NA |
| 7. B | P53669 | LIM domain kinase 1 | 1.37e-07 | NA | 1.33e-04 | NA |
| 7. B | Q9V3D5 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 | 4.25e-10 | NA | 6.94e-08 | NA |
| 7. B | Q54QI2 | Serine/threonine-protein kinase DDB_G0283821 | 7.35e-06 | NA | 1.57e-19 | NA |
| 7. B | Q0DCT8 | Protein kinase G11A | 3.63e-10 | NA | 6.05e-05 | NA |
| 7. B | Q3UHJ0 | AP2-associated protein kinase 1 | 5.56e-06 | NA | 0.028 | NA |
| 7. B | Q8TDC3 | Serine/threonine-protein kinase BRSK1 | 4.34e-06 | NA | 5.76e-15 | NA |
| 7. B | C4YLK8 | Serine/threonine-protein kinase STE7 homolog | 3.75e-07 | NA | 3.63e-08 | NA |
| 7. B | Q9LGV5 | CBL-interacting protein kinase 1 | 2.99e-08 | NA | 7.68e-18 | NA |
| 7. B | Q7Z8E9 | Serine/threonine-protein kinase MST20 | 1.65e-05 | NA | 1.73e-09 | NA |
| 7. B | O94324 | Serine/threonine-protein kinase ppk31 | 1.51e-03 | NA | 1.30e-10 | NA |
| 7. B | Q92519 | Tribbles homolog 2 | 2.97e-09 | NA | 0.009 | NA |
| 7. B | Q3U3Q1 | Serine/threonine-protein kinase ULK3 | 1.11e-08 | NA | 1.88e-18 | NA |
| 7. B | P51136 | Glycogen synthase kinase-3 | 1.12e-08 | NA | 4.98e-08 | NA |
| 7. B | Q90XV7 | Serine/threonine-protein kinase mos (Fragment) | 3.75e-08 | NA | 4.37e-10 | NA |
| 7. B | Q54Q69 | Hybrid signal transduction histidine kinase G | NA | NA | 0.002 | NA |
| 7. B | Q90XC2 | Serine/threonine-protein kinase Nek8 | 3.49e-07 | NA | 1.82e-11 | NA |
| 7. B | Q90XV9 | Serine/threonine-protein kinase mos (Fragment) | 2.28e-08 | NA | 7.03e-09 | NA |
| 7. B | Q55GG4 | Probable serine/threonine-protein kinase DDB_G0267686 | 7.27e-04 | NA | 2.24e-07 | NA |
| 7. B | Q9SHI2 | Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 | 3.83e-03 | NA | 4.85e-07 | NA |
| 7. B | Q10292 | Meiosis-specific serine/threonine-protein kinase mek1 | 2.75e-09 | NA | 2.97e-15 | NA |
| 7. B | P28867 | Protein kinase C delta type | 3.19e-06 | NA | 1.16e-12 | NA |
| 7. B | Q55GE6 | Probable serine/threonine-protein kinase roco7 | 1.36e-02 | NA | 4.10e-09 | NA |
| 7. B | P80203 | Serine/threonine-protein kinase receptor R3 | 1.31e-10 | NA | 2.72e-05 | NA |
| 7. B | Q54MY9 | Probable serine/threonine-protein kinase mkcA | 8.31e-06 | NA | 1.03e-06 | NA |
| 7. B | P27039 | Activin receptor type-2A | 1.59e-05 | NA | 7.39e-08 | NA |
| 7. B | F1MH24 | AP2-associated protein kinase 1 | 6.08e-06 | NA | 0.005 | NA |
| 7. B | Q9VP22 | Cyclin-dependent kinase 12 | 3.19e-04 | NA | 3.90e-07 | NA |
| 7. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 3.35e-02 | NA | 0.006 | NA |
| 7. B | Q13627 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A | 2.09e-06 | NA | 5.16e-06 | NA |
| 7. B | Q09013 | Myotonin-protein kinase | 1.41e-08 | NA | 1.81e-11 | NA |
| 7. B | Q4R8E0 | Eukaryotic translation initiation factor 2-alpha kinase 1 | 1.82e-02 | NA | 5.62e-07 | NA |
| 7. B | A7KAL2 | Serine/threonine-protein kinase atg1 | 2.97e-06 | NA | 1.03e-07 | NA |
| 7. B | Q9FLJ8 | Probable receptor-like protein kinase At5g61350 | 1.72e-03 | NA | 1.37e-07 | NA |
| 7. B | C0LGL4 | Probable LRR receptor-like serine/threonine-protein kinase At2g28960 | 9.20e-04 | NA | 2.99e-08 | NA |
| 7. B | Q6J9G1 | Tyrosine-protein kinase STYK1 | 3.55e-09 | NA | 4.84e-06 | NA |
| 7. B | Q6YY75 | Serine/threonine-protein kinase Nek6 | 1.79e-08 | NA | 3.55e-18 | NA |
| 7. B | P20786 | Platelet-derived growth factor receptor alpha | 1.71e-03 | NA | 2.38e-05 | NA |
| 7. B | P34103 | Protein kinase 4 (Fragment) | 5.59e-05 | NA | 9.38e-18 | NA |
| 7. B | U4PR86 | Maternal embryonic leucine zipper kinase | 2.50e-06 | NA | 1.38e-16 | NA |
| 7. B | Q869N2 | Serine/threonine-protein kinase pakB | 9.66e-07 | NA | 3.98e-10 | NA |
| 7. B | Q2QX45 | Calcium-dependent protein kinase 28 | 1.18e-07 | NA | 3.09e-11 | NA |
| 7. B | P29620 | Cyclin-dependent kinase D-1 | 2.26e-10 | NA | 4.29e-13 | NA |
| 7. B | Q86I06 | Probable serine/threonine-protein kinase nek3 | 7.85e-06 | NA | 1.67e-12 | NA |
| 7. B | Q66KH9 | Cyclin-dependent kinase 8 | 2.38e-05 | NA | 0.002 | NA |
| 7. B | H2KZU7 | Tyrosine-protein kinase receptor svh-2 | 9.46e-04 | NA | 1.59e-09 | NA |
| 7. B | O22833 | L-type lectin-domain containing receptor kinase V.4 | 5.36e-05 | NA | 1.17e-09 | NA |
| 7. B | Q9C7S5 | Tyrosine-sulfated glycopeptide receptor 1 | 1.09e-03 | NA | 7.32e-08 | NA |
| 7. B | P43403 | Tyrosine-protein kinase ZAP-70 | 1.51e-07 | NA | 3.31e-10 | NA |
| 7. B | Q7TPS0 | Ribosomal protein S6 kinase alpha-6 | 1.50e-05 | NA | 1.91e-13 | NA |
| 7. B | F4ICB6 | Protein IMPAIRED IN BABA-INDUCED STERILITY 1 | 1.92e-07 | NA | 3.02e-06 | NA |
| 7. B | Q9LT35 | Serine/threonine-protein kinase Nek6 | 4.60e-08 | NA | 3.95e-18 | NA |
| 7. B | Q9URY1 | Serine/threonine-protein kinase ppk16 | 2.13e-07 | NA | 5.80e-08 | NA |
| 7. B | P09208 | Insulin-like receptor | 3.78e-03 | NA | 1.53e-07 | NA |
| 7. B | P34112 | Cyclin-dependent kinase 1 | 1.44e-15 | NA | 2.62e-13 | NA |
| 7. B | O94921 | Cyclin-dependent kinase 14 | 5.83e-12 | NA | 4.96e-12 | NA |
| 7. B | Q8NG66 | Serine/threonine-protein kinase Nek11 | 3.53e-10 | NA | 3.22e-17 | NA |
| 7. B | Q9LJM4 | Receptor-like protein kinase HAIKU2 | 1.15e-03 | NA | 1.89e-09 | NA |
| 7. B | P03949 | Tyrosine-protein kinase abl-1 | 3.92e-05 | NA | 6.12e-06 | NA |
| 7. B | G5ECH7 | Cyclin-dependent-like kinase 5 | 2.11e-15 | NA | 1.43e-10 | NA |
| 7. B | Q03043 | cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B | 3.37e-05 | NA | 1.16e-10 | NA |
| 7. B | Q9SY89 | Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 | 2.85e-04 | NA | 1.30e-09 | NA |
| 7. B | P42158 | Casein kinase 1-like protein 1 | 4.38e-08 | NA | 1.27e-09 | NA |
| 7. B | P12370 | cAMP-dependent protein kinase catalytic subunit 1 | 1.73e-14 | NA | 1.48e-07 | NA |
| 7. B | P51137 | Glycogen synthase kinase-3 homolog MsK-1 | 1.64e-09 | NA | 2.57e-07 | NA |
| 7. B | Q9U6D2 | Stress-activated protein kinase JNK-1 | 1.16e-07 | NA | 9.33e-14 | NA |
| 7. B | Q1EG27 | Myosin-IIIb | 1.74e-03 | NA | 3.93e-11 | NA |
| 7. B | Q8CBF3 | Ephrin type-B receptor 1 | 1.56e-04 | NA | 1.44e-13 | NA |
| 7. B | Q9FNE1 | Cysteine-rich receptor-like protein kinase 42 | 1.50e-04 | NA | 8.10e-07 | NA |
| 7. B | Q9FM85 | Probable serine/threonine-protein kinase PBL16 | 4.18e-05 | NA | 3.10e-09 | NA |
| 7. B | P47735 | Receptor-like protein kinase 5 | 4.97e-03 | NA | 4.18e-10 | NA |
| 7. B | P40233 | Casein kinase I homolog 1 | 1.72e-09 | NA | 4.54e-04 | NA |
| 7. B | O88764 | Death-associated protein kinase 3 | 2.44e-09 | NA | 1.65e-15 | NA |
| 7. B | P54763 | Ephrin type-B receptor 2 | 1.73e-04 | NA | 5.35e-14 | NA |
| 7. B | P15790 | Casein kinase II subunit alpha | 5.81e-12 | NA | 4.83e-06 | NA |
| 7. B | Q5Z754 | Cyclin-dependent kinase F-1 | 4.67e-07 | NA | 6.99e-08 | NA |
| 7. B | P30530 | Tyrosine-protein kinase receptor UFO | 1.38e-05 | NA | 4.77e-06 | NA |
| 7. B | Q5UNT1 | Putative serine/threonine-protein kinase L673 | NA | NA | 2.72e-07 | NA |
| 7. B | Q80ZW0 | Serine/threonine-protein kinase 35 | 1.99e-10 | NA | 3.12e-12 | NA |
| 7. B | P23561 | Serine/threonine-protein kinase STE11 | 2.64e-10 | NA | 3.69e-09 | NA |
| 7. B | Q1RLU9 | Cyclin-dependent kinase 15 | 8.50e-13 | NA | 1.14e-12 | NA |
| 7. B | Q7T2E3 | Casein kinase I isoform delta-A | 2.06e-08 | NA | 4.27e-13 | NA |
| 7. B | O73792 | Tyrosine-protein kinase receptor Tie-1 (Fragment) | 4.55e-06 | NA | 1.21e-05 | NA |
| 7. B | Q8TDR2 | Serine/threonine-protein kinase 35 | 1.87e-10 | NA | 1.03e-12 | NA |
| 7. B | Q5PP29 | Probable serine/threonine-protein kinase PBL4 | 1.07e-05 | NA | 9.69e-09 | NA |
| 7. B | Q96S53 | Dual specificity testis-specific protein kinase 2 | 9.11e-06 | NA | 0.008 | NA |
| 7. B | O15530 | 3-phosphoinositide-dependent protein kinase 1 | 2.11e-06 | NA | 2.19e-11 | NA |
| 7. B | Q9C8M9 | Protein STRUBBELIG-RECEPTOR FAMILY 6 | 5.64e-05 | NA | 3.93e-04 | NA |
| 7. B | Q9S972 | Receptor-like serine/threonine-protein kinase SD1-6 | 2.60e-04 | NA | 4.03e-08 | NA |
| 7. B | Q9Y572 | Receptor-interacting serine/threonine-protein kinase 3 | 2.17e-08 | NA | 7.16e-10 | NA |
| 7. B | P43290 | Cell division control protein 2 homolog (Fragment) | 2.00e-05 | NA | 0.023 | NA |
| 7. B | Q62799 | Receptor tyrosine-protein kinase erbB-3 | 5.10e-04 | NA | 1.48e-05 | NA |
| 7. B | Q62844 | Tyrosine-protein kinase Fyn | 5.76e-11 | NA | 1.50e-09 | NA |
| 7. B | P22518 | Dual specificity protein kinase CLK1 | 4.07e-12 | NA | 5.58e-08 | NA |
| 7. B | Q90327 | Mitogen-activated protein kinase 8A | 6.62e-06 | NA | 2.93e-13 | NA |
| 7. B | Q9Z1Z1 | Eukaryotic translation initiation factor 2-alpha kinase 3 | 1.03e-01 | NA | 4.78e-10 | NA |
| 7. B | O81832 | G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 | 7.04e-04 | NA | 1.31e-07 | NA |
| 7. B | Q5JJY4 | Protein kinase and PP2C-like domain-containing protein | 3.50e-07 | NA | 2.31e-10 | NA |
| 7. B | P54265 | Myotonin-protein kinase | 3.98e-08 | NA | 1.57e-11 | NA |
| 7. B | F1M7Y5 | Protein kinase C iota type | 2.80e-07 | NA | 6.19e-15 | NA |
| 7. B | Q6XAT2 | LRR receptor-like serine/threonine-protein kinase ERL2 | 4.67e-03 | NA | 6.24e-07 | NA |
| 7. B | Q54Y90 | Probable serine/threonine-protein kinase DDB_G0278665 | 5.82e-04 | NA | 3.26e-09 | NA |
| 7. B | Q9FHG4 | Probable L-type lectin-domain containing receptor kinase S.7 | 1.06e-04 | NA | 4.82e-05 | NA |
| 7. B | P80192 | Mitogen-activated protein kinase kinase kinase 9 | 2.52e-05 | NA | 1.33e-10 | NA |
| 7. B | Q3UTQ8 | Cyclin-dependent kinase-like 5 | 4.95e-08 | NA | 4.37e-10 | NA |
| 7. B | P54756 | Ephrin type-A receptor 5 | 1.06e-04 | NA | 4.48e-11 | NA |
| 7. B | Q64434 | Protein-tyrosine kinase 6 | 7.16e-12 | NA | 1.95e-15 | NA |
| 7. B | B2GUY1 | Serine/threonine-protein kinase PLK4 | 2.49e-08 | NA | 2.74e-15 | NA |
| 7. B | O80673 | CDPK-related kinase 1 | 6.51e-08 | NA | 3.84e-14 | NA |
| 7. B | P29619 | Cyclin-dependent kinase A-2 | 1.11e-16 | NA | 7.44e-09 | NA |
| 7. B | Q6I587 | Calcium-dependent protein kinase 15 | 9.05e-08 | NA | 9.27e-13 | NA |
| 7. B | Q96NX5 | Calcium/calmodulin-dependent protein kinase type 1G | 3.42e-09 | NA | 7.78e-16 | NA |
| 7. B | Q55GS4 | Probable cyclin-dependent kinase 10 | 6.78e-10 | NA | 1.46e-06 | NA |
| 7. B | C0LGG6 | Probable LRR receptor-like protein kinase At1g51890 | 2.58e-03 | NA | 2.23e-13 | NA |
| 7. B | P38080 | Serine/threonine-protein kinase AKL1 | 5.20e-06 | NA | 0.002 | NA |
| 7. B | P34102 | Protein kinase 3 | 2.54e-05 | NA | 3.28e-16 | NA |
| 7. B | P83099 | Putative protein kinase C delta type homolog | 4.21e-06 | NA | 7.77e-12 | NA |
| 7. B | P23572 | Cyclin-dependent kinase 1 | 6.44e-15 | NA | 2.67e-10 | NA |
| 7. B | Q7XV05 | LRR receptor kinase SERK2 | 6.22e-04 | NA | 3.22e-08 | NA |
| 7. B | O46680 | TGF-beta receptor type-1 | 2.11e-10 | NA | 0.001 | NA |
| 7. B | P23049 | Tyrosine-protein kinase transforming protein SEA | NA | NA | 4.74e-08 | NA |
| 7. B | Q90ZK6 | Activin receptor type-1 | 2.09e-10 | NA | 2.34e-05 | NA |
| 7. B | P50545 | Tyrosine-protein kinase HCK | 2.93e-11 | NA | 7.43e-11 | NA |
| 7. B | C0LGU5 | Probable LRR receptor-like serine/threonine-protein kinase At5g45780 | 8.90e-05 | NA | 1.41e-07 | NA |
| 7. B | Q54XZ5 | Probable serine/threonine-protein kinase DDB_G0278509 | 2.51e-06 | NA | 0.017 | NA |
| 7. B | Q62862 | Dual specificity mitogen-activated protein kinase kinase 5 | 8.25e-08 | NA | 7.07e-09 | NA |
| 7. B | Q9STJ8 | Receptor-like serine/threonine-protein kinase At4g25390 | 2.50e-02 | NA | 0.005 | NA |
| 7. B | Q1PE89 | Probable serine/threonine-protein kinase PBL24 | 1.14e-06 | NA | 6.21e-08 | NA |
| 7. B | Q9P7J8 | Serine/threonine-protein kinase gad8 | 4.96e-07 | NA | 7.73e-11 | NA |
| 7. B | Q07494 | Ephrin type-B receptor 1 (Fragment) | NA | NA | 1.06e-12 | NA |
| 7. B | Q9Z2W1 | Serine/threonine-protein kinase 25 | 1.29e-08 | NA | 4.42e-08 | NA |
| 7. B | Q39008 | Mitogen-activated protein kinase kinase kinase 1 | 4.62e-08 | NA | 1.36e-16 | NA |
| 7. B | Q84SL0 | Calcium-dependent protein kinase 20 | 2.44e-08 | NA | 1.81e-13 | NA |
| 7. B | Q8TEA7 | TBC domain-containing protein kinase-like protein | 1.21e-04 | NA | 7.70e-05 | NA |
| 7. B | Q8WZ42 | Titin | NA | NA | 5.28e-12 | NA |
| 7. B | P15208 | Insulin receptor | 8.46e-04 | NA | 4.24e-09 | NA |
| 7. B | P34100 | Developmentally-regulated protein kinase 1 | 1.25e-08 | NA | 5.74e-08 | NA |
| 7. B | Q6VNS1 | NT-3 growth factor receptor | 2.34e-08 | NA | 4.92e-07 | NA |
| 7. B | Q9ASS4 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380 | 5.39e-05 | NA | 4.09e-06 | NA |
| 7. B | Q8RWW0 | Receptor-like serine/threonine-protein kinase ALE2 | 5.07e-04 | NA | 4.40e-11 | NA |
| 7. B | Q9LSV3 | Putative wall-associated receptor kinase-like 16 | 1.42e-06 | NA | 1.59e-08 | NA |
| 7. B | Q6XUX3 | Dual serine/threonine and tyrosine protein kinase | 1.28e-07 | NA | 5.21e-06 | NA |
| 7. B | Q8TFG6 | Serine/threonine-protein kinase ppk18 | 4.75e-03 | NA | 5.68e-09 | NA |
| 7. B | Q62689 | Tyrosine-protein kinase JAK2 | 1.28e-03 | NA | 4.38e-11 | NA |
| 7. B | P18461 | Fibroblast growth factor receptor 2 | 5.50e-05 | NA | 7.34e-08 | NA |
| 7. B | O49339 | PTI1-like tyrosine-protein kinase 2 | 1.65e-04 | NA | 2.78e-06 | NA |
| 7. B | Q9V3I5 | Chromosomal serine/threonine-protein kinase JIL-1 | 3.51e-04 | NA | 3.30e-14 | NA |
| 7. B | O08678 | Serine/threonine-protein kinase MARK1 | 7.29e-06 | NA | 1.60e-14 | NA |
| 7. B | P10506 | Protein kinase byr1 | 2.31e-10 | NA | 1.88e-07 | NA |
| 7. B | Q8VZD5 | Shaggy-related protein kinase epsilon | 1.87e-09 | NA | 1.31e-07 | NA |
| 7. B | Q5MD89 | Vascular endothelial growth factor receptor 3 | 8.18e-04 | NA | 8.19e-08 | NA |
| 7. B | Q6XUX1 | Dual serine/threonine and tyrosine protein kinase | 1.38e-07 | NA | 4.85e-06 | NA |
| 7. B | Q39027 | Mitogen-activated protein kinase 7 | 2.35e-08 | NA | 5.17e-12 | NA |
| 7. B | Q9CAH1 | Putative receptor-like protein kinase At1g72540 | 4.67e-06 | NA | 1.56e-11 | NA |
| 7. B | D0Z5N4 | Eukaryotic translation initiation factor 2-alpha kinase gcn-2 | 1.60e-01 | NA | 7.96e-11 | NA |
| 7. B | P32491 | MAP kinase kinase MKK2/SSP33 | 2.22e-08 | NA | 1.76e-07 | NA |
| 7. B | P36506 | Dual specificity mitogen-activated protein kinase kinase 2 | 2.09e-10 | NA | 5.11e-08 | NA |
| 7. B | P0DKI6 | Probable receptor-like protein kinase At1g33260 | 1.12e-06 | NA | 0.002 | NA |
| 7. B | Q9SZ67 | Probable WRKY transcription factor 19 | 4.81e-05 | NA | 2.44e-13 | NA |
| 7. B | O88664 | Serine/threonine-protein kinase TAO1 | 1.79e-06 | NA | 8.93e-08 | NA |
| 7. B | Q38869 | Calcium-dependent protein kinase 4 | 1.22e-07 | NA | 2.05e-13 | NA |
| 7. B | Q0WRY5 | Probable serine/threonine-protein kinase PBL7 | 1.68e-06 | NA | 4.48e-09 | NA |
| 7. B | Q9CAL2 | Cysteine-rich receptor-like protein kinase 3 | 4.41e-05 | NA | 5.16e-09 | NA |
| 7. B | Q8L7G3 | Cysteine-rich receptor-like protein kinase 7 | 4.37e-04 | NA | 9.61e-08 | NA |
| 7. B | A0A0P0XII1 | Chitin elicitor receptor kinase 1 | 1.31e-03 | NA | 6.30e-08 | NA |
| 7. B | Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon | 1.64e-07 | NA | 6.15e-14 | NA |
| 7. B | P28567 | Cell division control protein 2 homolog 2 (Fragment) | 4.66e-04 | NA | 4.17e-05 | NA |
| 7. B | Q8QHF0 | Serine/threonine-protein kinase mos (Fragment) | 1.20e-07 | NA | 1.87e-07 | NA |
| 7. B | Q01887 | Tyrosine-protein kinase RYK | 2.86e-09 | NA | 7.11e-06 | NA |
| 7. B | P53670 | LIM domain kinase 2 | 1.16e-07 | NA | 9.75e-05 | NA |
| 7. B | P32485 | Mitogen-activated protein kinase HOG1 | 1.21e-08 | NA | 2.14e-18 | NA |
| 7. B | P53009 | Protein kinase-like protein SCY1 | 3.93e-04 | NA | 0.017 | NA |
| 7. B | Q9Y2H9 | Microtubule-associated serine/threonine-protein kinase 1 | 1.53e-03 | NA | 2.23e-16 | NA |
| 7. B | Q63484 | RAC-gamma serine/threonine-protein kinase | 7.20e-08 | NA | 8.07e-13 | NA |
| 7. B | Q1PDV6 | Serine/threonine-protein kinase PBL27 | 6.32e-05 | NA | 9.89e-09 | NA |
| 7. B | Q12851 | Mitogen-activated protein kinase kinase kinase kinase 2 | 1.54e-04 | NA | 1.19e-16 | NA |
| 7. B | Q9CAI5 | Casein kinase 1-like protein 2 | 5.44e-09 | NA | 6.03e-11 | NA |
| 7. B | Q6I5Q6 | Receptor-like cytoplasmic kinase 185 | 4.02e-05 | NA | 4.35e-07 | NA |
| 7. B | Q9Y4K4 | Mitogen-activated protein kinase kinase kinase kinase 5 | 4.81e-06 | NA | 2.73e-13 | NA |
| 7. B | Q3UFB7 | High affinity nerve growth factor receptor | 1.03e-08 | NA | 6.99e-07 | NA |
| 7. B | Q61214 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A | 6.78e-09 | NA | 5.29e-06 | NA |
| 7. B | Q9FIJ6 | Serine/threonine-protein kinase-like protein CCR4 | 9.52e-04 | NA | 5.97e-10 | NA |
| 7. B | Q8IWQ3 | Serine/threonine-protein kinase BRSK2 | 2.41e-06 | NA | 2.96e-17 | NA |
| 7. B | P11837 | G2-specific protein kinase nimA | 1.41e-08 | NA | 1.26e-08 | NA |
| 7. B | P17948 | Vascular endothelial growth factor receptor 1 | 3.64e-05 | NA | 5.17e-08 | NA |
| 7. B | P34892 | Receptor-like tyrosine-protein kinase kin-16 | 1.17e-08 | NA | 8.77e-08 | NA |
| 7. B | Q86AT8 | Stress-activated protein kinase alpha | 1.09e-09 | NA | 1.71e-06 | NA |
| 7. B | Q9FMP5 | Calcium-dependent protein kinase 17 | 1.22e-07 | NA | 2.30e-11 | NA |
| 7. B | O14757 | Serine/threonine-protein kinase Chk1 | 5.33e-06 | NA | 1.00e-09 | NA |
| 7. B | P34722 | Protein kinase C-like 1 | 5.12e-06 | NA | 2.36e-13 | NA |
| 7. B | Q24592 | Tyrosine-protein kinase hopscotch | 4.58e-06 | NA | 1.33e-06 | NA |
| 7. B | O64682 | Protein kinase PINOID | 1.89e-08 | NA | 1.24e-08 | NA |
| 7. B | C0LGP4 | Probable LRR receptor-like serine/threonine-protein kinase At3g47570 | 1.67e-03 | NA | 9.28e-07 | NA |
| 7. B | Q54DK3 | Probable serine/threonine-protein kinase cdc7 | 4.40e-03 | NA | 1.48e-07 | NA |
| 7. B | Q9NJU9 | Calcium-dependent protein kinase 3 | 9.75e-08 | NA | 4.29e-12 | NA |
| 7. B | Q6Z4U4 | LRR receptor kinase BAK1 | 6.48e-04 | NA | 4.46e-08 | NA |
| 7. B | Q9SV05 | Serine/threonine-protein kinase-like protein At3g51990 | 2.34e-06 | NA | 8.23e-05 | NA |
| 7. B | P18910 | Atrial natriuretic peptide receptor 1 | 4.67e-04 | NA | 0.033 | NA |
| 7. B | Q9SKG5 | Somatic embryogenesis receptor kinase 4 | 7.05e-04 | NA | 7.77e-08 | NA |
| 7. B | A2CG49 | Kalirin | NA | NA | 1.04e-09 | NA |
| 7. B | P06244 | cAMP-dependent protein kinase type 1 | 5.32e-10 | NA | 2.38e-10 | NA |
| 7. B | Q9LMN7 | Wall-associated receptor kinase 5 | 3.35e-04 | NA | 1.94e-07 | NA |
| 7. B | P15054 | Tyrosine-protein kinase transforming protein Src | NA | NA | 2.90e-08 | NA |
| 7. B | Q9S9M3 | Wall-associated receptor kinase-like 3 | 4.00e-05 | NA | 1.10e-11 | NA |
| 7. B | Q93VJ2 | Serine/threonine-protein kinase/endoribonuclease IRE1b | 5.45e-04 | NA | 2.12e-06 | NA |
| 7. B | P87050 | Mitosis inducer protein kinase cdr2 | 1.89e-05 | NA | 1.49e-11 | NA |
| 7. B | P53349 | Mitogen-activated protein kinase kinase kinase 1 | 7.27e-06 | NA | 8.79e-09 | NA |
| 7. B | Q9C9U2 | Cyclin-dependent kinase D-1 | 4.30e-11 | NA | 3.30e-12 | NA |
| 7. B | Q62915 | Peripheral plasma membrane protein CASK | 1.53e-05 | NA | 3.38e-15 | NA |
| 7. B | P28028 | Serine/threonine-protein kinase B-raf | 7.09e-07 | NA | 1.57e-15 | NA |
| 7. B | Q94A06 | Mitogen-activated protein kinase kinase 1 | 3.81e-10 | NA | 7.59e-13 | NA |
| 7. B | Q84V18 | Serine/threonine-protein kinase stt7, chloroplastic | 4.14e-06 | NA | 5.40e-04 | NA |
| 7. B | Q1ZXR2 | Probable serine/threonine-protein kinase DDB_G0267566 | 6.18e-07 | NA | 2.43e-09 | NA |
| 7. B | P32577 | Tyrosine-protein kinase CSK | 1.25e-11 | NA | 4.37e-10 | NA |
| 7. B | Q8BLF2 | Cyclin-dependent kinase-like 3 | 4.28e-08 | NA | 9.66e-16 | NA |
| 7. B | Q91YA2 | Serine/threonine-protein kinase H1 | 5.31e-08 | NA | 4.49e-14 | NA |
| 7. B | Q5VST9 | Obscurin | NA | NA | 1.23e-08 | NA |
| 7. B | Q4P9T2 | Serine/threonine-protein kinase SSN3 | 1.87e-05 | NA | 2.76e-07 | NA |
| 7. B | Q61097 | Kinase suppressor of Ras 1 | 2.87e-06 | NA | 0.002 | NA |
| 7. B | Q6NSM8 | Serine/threonine-protein kinase SIK3 homolog | 1.16e-04 | NA | 1.05e-10 | NA |
| 7. B | Q54IF2 | Probable serine/threonine-protein kinase DDB_G0288795 | 1.32e-06 | NA | 2.38e-10 | NA |
| 7. B | Q23357 | Cyclin-dependent kinase 11.2 | 8.07e-08 | NA | 1.89e-07 | NA |
| 7. B | P09581 | Macrophage colony-stimulating factor 1 receptor | 4.86e-04 | NA | 2.38e-07 | NA |
| 7. B | Q43531 | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase | 4.99e-10 | NA | 1.16e-13 | NA |
| 7. B | O81472 | Mitogen-activated protein kinase kinase kinase 9 | 5.42e-07 | NA | 1.86e-11 | NA |
| 7. B | Q04589 | Fibroblast growth factor receptor 1 | 5.48e-05 | NA | 7.79e-10 | NA |
| 7. B | P70336 | Rho-associated protein kinase 2 | 8.25e-05 | NA | 8.56e-13 | NA |
| 7. B | Q9NWZ3 | Interleukin-1 receptor-associated kinase 4 | 8.36e-06 | NA | 1.59e-09 | NA |
| 7. B | Q94F62 | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 | 5.61e-04 | NA | 3.77e-07 | NA |
| 7. B | Q9SLI2 | Serine/threonine-protein kinase Nek1 | 2.05e-07 | NA | 5.04e-17 | NA |
| 7. B | Q63474 | Epithelial discoidin domain-containing receptor 1 | 4.46e-05 | NA | 5.39e-07 | NA |
| 7. B | C0LGW2 | Probable LRR receptor-like serine/threonine-protein kinase PAM74 | 9.63e-04 | NA | 2.47e-09 | NA |
| 7. B | Q9Y6E0 | Serine/threonine-protein kinase 24 | 1.35e-08 | NA | 6.18e-09 | NA |
| 7. B | P22204 | Cell cycle protein kinase DBF2 | 1.67e-06 | NA | 3.19e-04 | NA |
| 7. B | Q9LVP0 | Probable leucine-rich repeat receptor-like protein kinase At5g63930 | 1.64e-03 | NA | 7.02e-07 | NA |
| 7. B | O80888 | Mitogen-activated protein kinase kinase kinase 17 | 7.32e-09 | NA | 6.34e-12 | NA |
| 7. B | Q9UQM7 | Calcium/calmodulin-dependent protein kinase type II subunit alpha | 2.18e-08 | NA | 3.87e-13 | NA |
| 7. B | P25389 | Probable serine/threonine-protein kinase KCC4 | 1.23e-05 | NA | 6.12e-14 | NA |
| 7. B | P40376 | cAMP-dependent protein kinase catalytic subunit | 6.21e-09 | NA | 8.67e-07 | NA |
| 7. B | Q13976 | cGMP-dependent protein kinase 1 | 5.69e-10 | NA | 2.63e-09 | NA |
| 7. B | Q0D541 | Probable serine/threonine-protein kinase WNK5 | 2.36e-09 | NA | 5.30e-08 | NA |
| 7. B | P16879 | Tyrosine-protein kinase Fes/Fps | 2.14e-08 | NA | 1.17e-12 | NA |
| 7. B | Q9P289 | Serine/threonine-protein kinase 26 | 1.23e-07 | NA | 1.12e-07 | NA |
| 7. B | O64483 | Senescence-induced receptor-like serine/threonine-protein kinase | 1.85e-03 | NA | 1.00e-09 | NA |
| 7. B | Q6ERS0 | Putative CBL-interacting protein kinase 27 | 2.26e-09 | NA | 2.31e-19 | NA |
| 7. B | P27037 | Activin receptor type-2A | 1.34e-06 | NA | 1.38e-08 | NA |
| 7. B | O22042 | Mitogen-activated protein kinase kinase kinase 3 | 3.08e-08 | NA | 2.35e-19 | NA |
| 7. B | Q8L899 | Systemin receptor SR160 | 3.90e-03 | NA | 2.19e-10 | NA |
| 7. B | Q63644 | Rho-associated protein kinase 1 | 4.90e-04 | NA | 1.15e-12 | NA |
| 7. B | P09769 | Tyrosine-protein kinase Fgr | 5.04e-11 | NA | 1.46e-10 | NA |
| 7. B | Q9N3Z3 | Serine/threonine-protein kinase chk-1 | 1.10e-06 | NA | 8.88e-18 | NA |
| 7. B | O75676 | Ribosomal protein S6 kinase alpha-4 | 7.05e-06 | NA | 3.27e-12 | NA |
| 7. B | Q0PKV7 | Mitogen-activated protein kinase kinase 5 | 1.97e-07 | NA | 2.87e-12 | NA |
| 7. B | Q811L6 | Microtubule-associated serine/threonine-protein kinase 4 | 3.72e-02 | NA | 7.54e-16 | NA |
| 7. B | Q8INB9 | RAC serine/threonine-protein kinase | 9.79e-07 | NA | 9.39e-12 | NA |
| 7. B | P53683 | Calcium-dependent protein kinase 19 | 3.05e-07 | NA | 1.27e-09 | NA |
| 7. B | C0LGP2 | Probable LRR receptor-like serine/threonine-protein kinase MEE39 | 9.61e-04 | NA | 2.23e-10 | NA |
| 7. B | P25333 | Serine/threonine-protein kinase HAL4/SAT4 | 1.69e-05 | NA | 9.74e-15 | NA |
| 7. B | Q39019 | Shaggy-related protein kinase kappa | 5.10e-07 | NA | 9.55e-07 | NA |
| 7. B | Q0D715 | Calcium-dependent protein kinase 18 | 4.01e-06 | NA | 2.60e-19 | NA |
| 7. B | Q9FJI4 | Putative L-type lectin-domain containing receptor kinase I.11 | 3.79e-04 | NA | 1.56e-05 | NA |
| 7. B | O23236 | Mitogen-activated protein kinase 14 | 1.30e-08 | NA | 1.14e-13 | NA |
| 7. B | D3ZSZ3 | Serine/threonine-protein kinase NLK | 5.63e-06 | NA | 1.27e-11 | NA |
| 7. B | Q9LX30 | eIF-2-alpha kinase GCN2 | 1.66e-02 | NA | 6.52e-09 | NA |
| 7. B | P32490 | MAP kinase kinase MKK1/SSP32 | 2.90e-08 | NA | 2.99e-08 | NA |
| 7. B | Q9R012 | Serine/threonine-protein kinase PLK2 | 2.87e-06 | NA | 2.38e-16 | NA |
| 7. B | Q8GWJ7 | Cysteine-rich receptor-like protein kinase 19 | 6.46e-05 | NA | 9.03e-08 | NA |
| 7. B | Q04771 | Activin receptor type-1 | 2.27e-10 | NA | 3.81e-05 | NA |
| 7. B | O23082 | Putative receptor-like protein kinase At4g00960 | 1.57e-06 | NA | 2.06e-07 | NA |
| 7. B | B2DD29 | Serine/threonine-protein kinase BRSK1 | 4.31e-06 | NA | 3.03e-15 | NA |
| 7. B | Q940A2 | Protein kinase and PP2C-like domain-containing protein | 5.34e-07 | NA | 6.14e-14 | NA |
| 7. B | O49318 | Probable leucine-rich repeat receptor-like protein kinase At2g33170 | 1.69e-03 | NA | 1.12e-06 | NA |
| 7. B | Q38870 | Calcium-dependent protein kinase 2 | 2.62e-08 | NA | 4.60e-12 | NA |
| 7. B | Q9FE20 | Serine/threonine-protein kinase PBS1 | 2.69e-06 | NA | 4.44e-07 | NA |
| 7. B | Q42438 | Calcium-dependent protein kinase 8 | 6.95e-07 | NA | 2.25e-14 | NA |
| 7. B | Q5VN19 | Mitogen-activated protein kinase 11 | 2.26e-05 | NA | 1.57e-13 | NA |
| 7. B | Q9SUQ3 | Probable inactive receptor kinase At4g23740 | 2.99e-04 | NA | 6.07e-05 | NA |
| 7. B | Q0KL02 | Triple functional domain protein | NA | NA | 2.14e-05 | NA |
| 7. B | Q9Y7T4 | Serine/threonine-protein kinase atg1 | 3.07e-05 | NA | 1.06e-04 | NA |
| 7. B | Q8IVT5 | Kinase suppressor of Ras 1 | 7.60e-06 | NA | 6.40e-04 | NA |
| 7. B | Q55DK2 | Probable serine/threonine-protein kinase DDB_G0269628 | 1.47e-02 | NA | 5.66e-08 | NA |
| 7. B | P10421 | Serine/threonine-protein kinase-transforming protein mos | NA | NA | 2.14e-13 | NA |
| 7. B | Q23356 | Serine/threonine-protein kinase mig-15 | 9.73e-07 | NA | 2.14e-13 | NA |
| 7. B | Q63470 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A | 2.60e-06 | NA | 5.78e-06 | NA |
| 7. B | Q0JI49 | CBL-interacting protein kinase 11 | 2.76e-08 | NA | 3.33e-19 | NA |
| 7. B | Q9UTH3 | Serine/threonine-protein kinase ppk6 | 4.94e-06 | NA | 4.38e-07 | NA |
| 7. B | Q21041 | Tyrosine-protein kinase receptor ver-4 | 5.16e-05 | NA | 3.52e-06 | NA |
| 7. B | Q39238 | Serine/threonine-protein kinase TOUSLED | 3.88e-10 | NA | 1.97e-13 | NA |
| 7. B | G5EDF7 | Dual specificity mitogen-activated protein kinase kinase sek-1 | 1.97e-11 | NA | 2.03e-12 | NA |
| 7. B | Q7TT49 | Serine/threonine-protein kinase MRCK beta | 1.85e-03 | NA | 2.18e-14 | NA |
| 7. B | Q9P0L2 | Serine/threonine-protein kinase MARK1 | 6.86e-06 | NA | 1.18e-14 | NA |
| 7. B | Q62190 | Macrophage-stimulating protein receptor | 3.04e-03 | NA | 1.63e-04 | NA |
| 7. B | Q9S7U9 | Mitogen-activated protein kinase kinase 2 | 1.17e-11 | NA | 2.73e-14 | NA |
| 7. B | O35491 | Dual specificity protein kinase CLK2 | 7.34e-12 | NA | 4.46e-13 | NA |
| 7. B | Q9JJX8 | Serine/threonine-protein kinase 32B | 8.99e-08 | NA | 1.08e-10 | NA |
| 7. B | Q8GYA4 | Cysteine-rich receptor-like protein kinase 10 | 2.19e-04 | NA | 3.33e-07 | NA |
| 7. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 1.15e-03 | NA | 6.44e-10 | NA |
| 7. B | Q03963 | Interferon-induced, double-stranded RNA-activated protein kinase | 4.50e-06 | NA | 1.06e-08 | NA |
| 7. B | Q08217 | Serine/threonine-protein kinase PSK2 | 9.21e-07 | NA | 3.28e-06 | NA |
| 7. B | Q9LRP3 | Probable receptor-like protein kinase At3g17420 | 7.03e-06 | NA | 7.63e-08 | NA |
| 7. B | O54967 | Activated CDC42 kinase 1 | 1.91e-07 | NA | 2.14e-07 | NA |
| 7. B | P53599 | MAP kinase kinase kinase SSK2 | 1.46e-05 | NA | 1.49e-12 | NA |
| 7. B | P10398 | Serine/threonine-protein kinase A-Raf | 3.12e-10 | NA | 1.91e-14 | NA |
| 7. B | Q9ZQQ7 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 | 2.40e-03 | NA | 4.93e-06 | NA |
| 7. B | Q9Z2B9 | Ribosomal protein S6 kinase alpha-4 | 3.86e-05 | NA | 2.44e-10 | NA |
| 7. B | Q96285 | L-type lectin-domain containing receptor kinase V.5 | 1.65e-04 | NA | 5.69e-10 | NA |
| 7. B | P70218 | Mitogen-activated protein kinase kinase kinase kinase 1 | 3.48e-06 | NA | 7.00e-17 | NA |
| 7. B | P93050 | Probable LRR receptor-like serine/threonine-protein kinase RKF3 | 8.52e-04 | NA | 1.33e-06 | NA |
| 7. B | P48730 | Casein kinase I isoform delta | 2.13e-10 | NA | 5.37e-13 | NA |
| 7. B | P13368 | Protein sevenless | 3.05e-03 | NA | 1.58e-08 | NA |
| 7. B | O64781 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390 | 1.76e-03 | NA | 1.09e-05 | NA |
| 7. B | Q9C5H5 | Mitogen-activated protein kinase kinase kinase 5 | 6.40e-08 | NA | 2.66e-09 | NA |
| 7. B | Q13882 | Protein-tyrosine kinase 6 | 1.84e-11 | NA | 3.59e-12 | NA |
| 7. B | Q2QRN7 | Probable kinase CHARK | 6.93e-04 | NA | 2.42e-10 | NA |
| 7. B | P47809 | Dual specificity mitogen-activated protein kinase kinase 4 | 2.58e-09 | NA | 2.34e-11 | NA |
| 7. B | Q54WE5 | Serine/threonine-protein kinase prpf4B | 2.02e-08 | NA | 2.97e-10 | NA |
| 7. B | P05129 | Protein kinase C gamma type | 5.57e-06 | NA | 5.25e-09 | NA |
| 7. B | Q54BF0 | Probable serine/threonine-protein kinase fhkA | 1.95e-07 | NA | 1.34e-10 | NA |
| 7. B | Q03002 | Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 | 8.89e-06 | NA | 1.71e-12 | NA |
| 7. B | P83102 | Putative dual specificity tyrosine-phosphorylation-regulated kinase 3 homolog | 3.13e-05 | NA | 9.37e-09 | NA |
| 7. B | Q9P286 | Serine/threonine-protein kinase PAK 5 | 3.53e-05 | NA | 8.41e-12 | NA |
| 7. B | Q9M0G7 | MDIS1-interacting receptor like kinase 1 | 1.46e-03 | NA | 8.00e-07 | NA |
| 7. B | P55146 | Tyrosine-protein kinase receptor TYRO3 | 8.21e-08 | NA | 6.12e-06 | NA |
| 7. B | Q99759 | Mitogen-activated protein kinase kinase kinase 3 | 4.84e-11 | NA | 3.74e-12 | NA |
| 7. B | Q94C95 | Serine/threonine-protein kinase ATG1a | 1.02e-10 | NA | 1.66e-11 | NA |
| 7. B | C0LGT5 | Probable LRR receptor-like serine/threonine-protein kinase At5g16900 | 3.76e-03 | NA | 2.43e-10 | NA |
| 7. B | P53104 | Serine/threonine-protein kinase ATG1 | 1.80e-06 | NA | 1.14e-08 | NA |
| 7. B | Q8RXT4 | Serine/threonine-protein kinase Nek4 | 2.01e-07 | NA | 5.02e-15 | NA |
| 7. B | Q9HFF4 | Serine/threonine-protein kinase ppk1 | 1.93e-04 | NA | 8.77e-12 | NA |
| 7. B | Q55D99 | Serine/threonine-protein kinase pakA | 6.99e-05 | NA | 1.64e-14 | NA |
| 7. B | Q9WVS8 | Mitogen-activated protein kinase 7 | 6.23e-06 | NA | 8.61e-12 | NA |
| 7. B | O64842 | Probable serine/threonine-protein kinase PBL12 | 1.76e-05 | NA | 9.28e-12 | NA |
| 7. B | Q9LDQ3 | Putative cysteine-rich receptor-like protein kinase 35 | 1.98e-04 | NA | 1.14e-07 | NA |
| 7. B | Q61136 | Serine/threonine-protein kinase PRP4 homolog | 1.52e-07 | NA | 4.01e-08 | NA |
| 7. B | Q9D2Y4 | Mixed lineage kinase domain-like protein | 3.97e-10 | NA | 6.06e-05 | NA |
| 7. B | Q00094 | Protein kinase ORF73 | NA | NA | 0.005 | NA |
| 7. B | G5ED65 | Protein ver-1 | 8.79e-07 | NA | 0.001 | NA |
| 7. B | Q1XHL7 | Rhodopsin kinase grk7-b | 4.20e-07 | NA | 4.13e-11 | NA |
| 7. B | Q9SA72 | Probable receptor-like protein kinase At1g30570 | 3.42e-04 | NA | 4.69e-09 | NA |
| 7. B | Q5JLQ9 | CBL-interacting protein kinase 30 | 8.57e-08 | NA | 3.17e-20 | NA |
| 7. B | Q5JLD8 | CBL-interacting protein kinase 8 | 8.66e-09 | NA | 2.72e-15 | NA |
| 7. B | P20806 | Protein sevenless | 2.05e-02 | NA | 1.82e-08 | NA |
| 7. B | Q8S8Y8 | Probable serine/threonine-protein kinase WNK6 | 2.24e-06 | NA | 3.00e-08 | NA |
| 7. B | P52583 | Vascular endothelial growth factor receptor 2 | 7.95e-04 | NA | 1.32e-06 | NA |
| 7. B | Q9LXA5 | L-type lectin-domain containing receptor kinase IX.1 | 5.80e-05 | NA | 5.01e-08 | NA |
| 7. B | Q9Y243 | RAC-gamma serine/threonine-protein kinase | 1.60e-09 | NA | 7.05e-13 | NA |
| 7. B | P43289 | Shaggy-related protein kinase gamma | 1.48e-09 | NA | 3.15e-07 | NA |
| 7. B | Q9WUT3 | Ribosomal protein S6 kinase alpha-2 | 6.93e-06 | NA | 2.12e-16 | NA |
| 7. B | Q6P0Q8 | Microtubule-associated serine/threonine-protein kinase 2 | 2.80e-03 | NA | 2.12e-16 | NA |
| 7. B | P34925 | Tyrosine-protein kinase RYK | 2.29e-05 | NA | 2.35e-05 | NA |
| 7. B | Q28560 | Activin receptor type-2A | 3.95e-05 | NA | 1.26e-08 | NA |
| 7. B | Q92398 | Mitogen-activated protein kinase spm1 | 2.34e-08 | NA | 1.63e-18 | NA |
| 7. B | Q5XJV6 | Serine/threonine-protein kinase LMTK3 | 2.27e-03 | NA | 1.24e-05 | NA |
| 7. B | A0A5K1K8H0 | Calcium-dependent protein kinase 5 | 2.06e-07 | NA | 2.00e-14 | NA |
| 7. B | O61122 | Serine/threonine-protein kinase svkA | 2.56e-08 | NA | 1.85e-09 | NA |
| 7. B | Q0D5R3 | Cysteine-rich receptor-like protein kinase 6 | 1.10e-04 | NA | 4.37e-13 | NA |
| 7. B | Q49HM9 | Rhodopsin kinase grk7a | 3.40e-07 | NA | 5.41e-11 | NA |
| 7. B | Q3U1V8 | Mitogen-activated protein kinase kinase kinase 9 | 1.18e-05 | NA | 1.65e-10 | NA |
| 7. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 2.36e-05 | NA | 1.31e-06 | NA |
| 7. B | O18209 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 | 9.26e-08 | NA | 8.90e-08 | NA |
| 7. B | P12688 | Serine/threonine-protein kinase YPK1 | 2.39e-06 | NA | 2.03e-10 | NA |
| 7. B | Q6F3A6 | Calcium-dependent protein kinase 10 | 8.01e-08 | NA | 6.32e-11 | NA |
| 7. B | Q8CIP4 | MAP/microtubule affinity-regulating kinase 4 | 3.96e-06 | NA | 1.61e-14 | NA |
| 7. B | P09251 | Serine/threonine-protein kinase US3 homolog | NA | NA | 7.14e-07 | NA |
| 7. B | Q60750 | Ephrin type-A receptor 1 | 9.66e-04 | NA | 4.81e-11 | NA |
| 7. B | Q7RTN6 | STE20-related kinase adapter protein alpha | 1.24e-07 | NA | 0.004 | NA |
| 7. B | Q54H46 | Probable serine/threonine-protein kinase drkA | 2.95e-07 | NA | 8.18e-08 | NA |
| 7. B | Q9H422 | Homeodomain-interacting protein kinase 3 | 5.15e-05 | NA | 4.16e-06 | NA |
| 7. B | Q9FLZ3 | SNF1-related protein kinase catalytic subunit alpha KIN12 | 3.22e-08 | NA | 3.43e-18 | NA |
| 7. B | Q8AX02 | Serine/threonine-protein kinase mos (Fragment) | 4.47e-06 | NA | 0.007 | NA |
| 7. B | Q7TSJ6 | Serine/threonine-protein kinase LATS2 | 1.35e-03 | NA | 2.58e-08 | NA |
| 7. B | O49445 | Probable L-type lectin-domain containing receptor kinase VII.2 | 2.95e-04 | NA | 1.80e-11 | NA |
| 7. B | Q61851 | Fibroblast growth factor receptor 3 | 3.79e-04 | NA | 7.60e-08 | NA |
| 7. B | B3WFY8 | Serine/threonine-protein kinase dyf-5 | 1.37e-08 | NA | 2.97e-08 | NA |
| 7. B | Q9UQ88 | Cyclin-dependent kinase 11A | 1.05e-06 | NA | 2.98e-11 | NA |
| 7. B | Q54RV3 | Serine/threonine-protein kinase pakG | 3.89e-05 | NA | 1.70e-10 | NA |
| 7. B | F1LP90 | Misshapen-like kinase 1 | 9.11e-05 | NA | 2.14e-12 | NA |
| 7. B | Q86SG6 | Serine/threonine-protein kinase Nek8 | 9.92e-12 | NA | 6.30e-11 | NA |
| 7. B | O65405 | Cysteine-rich receptor-like protein kinase 28 | 8.56e-05 | NA | 3.03e-09 | NA |
| 7. B | Q8WXR4 | Myosin-IIIb | 1.97e-03 | NA | 1.26e-12 | NA |
| 7. B | O65476 | Putative cysteine-rich receptor-like protein kinase 16 | 9.23e-05 | NA | 6.66e-07 | NA |
| 7. B | P28523 | Casein kinase II subunit alpha | 1.02e-12 | NA | 3.17e-05 | NA |
| 7. B | P24604 | Tyrosine-protein kinase Tec | 1.53e-10 | NA | 7.13e-10 | NA |
| 7. B | Q8BWQ5 | Serine/threonine-protein kinase DCLK3 | 6.90e-10 | NA | 3.04e-14 | NA |
| 7. B | Q64702 | Serine/threonine-protein kinase PLK4 | 5.24e-08 | NA | 8.64e-16 | NA |
| 7. B | A6ZQG7 | Serine/threonine-protein kinase HAL5 | 1.44e-04 | NA | 1.46e-09 | NA |
| 7. B | Q6ZLP5 | CBL-interacting protein kinase 23 | 4.58e-09 | NA | 3.23e-22 | NA |
| 7. B | Q54PK9 | 3-phosphoinositide-dependent protein kinase B | 2.88e-06 | NA | 9.63e-10 | NA |
| 7. B | Q922Y0 | Dual specificity tyrosine-phosphorylation-regulated kinase 3 | 1.00e-07 | NA | 1.64e-09 | NA |
| 7. B | Q9LSR9 | L-type lectin-domain containing receptor kinase I.8 | 1.03e-04 | NA | 0.001 | NA |
| 7. B | Q99640 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase | 1.86e-09 | NA | 1.48e-10 | NA |
| 7. B | Q75GK4 | CBL-interacting protein kinase 7 | 7.41e-09 | NA | 9.62e-23 | NA |
| 7. B | Q15746 | Myosin light chain kinase, smooth muscle | 4.65e-03 | NA | 4.38e-19 | NA |
| 7. B | P45984 | Mitogen-activated protein kinase 9 | 7.21e-06 | NA | 6.40e-16 | NA |
| 7. B | Q3V016 | Homeodomain-interacting protein kinase 4 | 5.21e-05 | NA | 5.64e-05 | NA |
| 7. B | Q9TVL3 | Probable cyclin-dependent kinase 9 | 4.07e-08 | NA | 9.39e-05 | NA |
| 7. B | Q9UBS0 | Ribosomal protein S6 kinase beta-2 | 4.23e-08 | NA | 3.69e-15 | NA |
| 7. B | Q4V3C8 | 3-phosphoinositide-dependent protein kinase 2 | 4.58e-09 | NA | 7.10e-12 | NA |
| 7. B | P04551 | Cyclin-dependent kinase 1 | 4.33e-15 | NA | 7.80e-10 | NA |
| 7. B | P61075 | Cell division control protein 2 homolog | 5.11e-15 | NA | 2.44e-16 | NA |
| 7. B | Q6I5Y0 | Cyclin-dependent kinase C-1 | 2.09e-07 | NA | 1.77e-06 | NA |
| 7. B | Q8C0N0 | Sperm motility kinase Z | 9.12e-07 | NA | 5.21e-08 | NA |
| 7. B | O43781 | Dual specificity tyrosine-phosphorylation-regulated kinase 3 | 1.05e-07 | NA | 1.16e-09 | NA |
| 7. B | Q9XTG7 | Serine/threonine-protein kinase akt-2 | 1.47e-07 | NA | 1.40e-12 | NA |
| 7. B | Q9BZL6 | Serine/threonine-protein kinase D2 | 1.95e-04 | NA | 2.36e-12 | NA |
| 7. B | P13677 | Protein kinase C, eye isozyme | 2.07e-05 | NA | 7.60e-13 | NA |
| 7. B | Q15772 | Striated muscle preferentially expressed protein kinase | NA | NA | 1.55e-06 | NA |
| 7. B | Q9UQB9 | Aurora kinase C | 4.77e-15 | NA | 3.24e-09 | NA |
| 7. B | Q04899 | Cyclin-dependent kinase 18 | 3.00e-12 | NA | 3.78e-13 | NA |
| 7. B | C0LGF5 | LRR receptor-like serine/threonine-protein kinase RGI5 | 2.87e-03 | NA | 3.98e-05 | NA |
| 7. B | Q60806 | Serine/threonine-protein kinase PLK3 | 2.72e-06 | NA | 9.32e-17 | NA |
| 7. B | Q38868 | Calcium-dependent protein kinase 9 | 7.16e-08 | NA | 4.68e-09 | NA |
| 7. B | Q9Z2E3 | Serine/threonine-protein kinase/endoribonuclease IRE2 | 8.55e-04 | NA | 2.60e-08 | NA |
| 7. B | Q9UM73 | ALK tyrosine kinase receptor | 1.43e-03 | NA | 5.76e-07 | NA |
| 7. B | Q75JK0 | Dual specificity protein kinase zakA | 2.71e-08 | NA | 4.28e-07 | NA |
| 7. B | Q9FID5 | Probable receptor-like protein kinase At5g39030 | 7.23e-05 | NA | 7.44e-06 | NA |
| 7. B | O73875 | Ephrin type-B receptor 4a | 5.82e-04 | NA | 2.01e-09 | NA |
| 7. B | Q336M2 | Cyclin-dependent kinase E-1 | 3.19e-10 | NA | 8.01e-08 | NA |
| 7. B | P10676 | Neither inactivation nor afterpotential protein C | 1.77e-04 | NA | 1.53e-11 | NA |
| 7. B | Q9JI11 | Serine/threonine-protein kinase 4 | 4.32e-08 | NA | 2.83e-09 | NA |
| 7. B | O14965 | Aurora kinase A | 5.01e-10 | NA | 1.20e-07 | NA |
| 7. B | O00444 | Serine/threonine-protein kinase PLK4 | 5.18e-08 | NA | 9.38e-15 | NA |
| 7. B | O13945 | Protein kinase domain-containing protein ppk9 | 3.80e-07 | NA | 9.54e-10 | NA |
| 7. B | Q9FN94 | Receptor-like protein kinase At5g59670 | 4.60e-04 | NA | 1.06e-08 | NA |
| 7. B | Q8I719 | cGMP-dependent protein kinase | 1.13e-06 | NA | 4.34e-13 | NA |
| 7. B | Q9Z2A0 | 3-phosphoinositide-dependent protein kinase 1 | 2.41e-07 | NA | 2.14e-11 | NA |
| 7. B | Q54F40 | Probable protein kinase DDB_G0291133 | 2.21e-07 | NA | 6.61e-09 | NA |
| 7. B | P57993 | Serine/threonine-protein kinase PknG | 1.31e-05 | NA | 6.71e-07 | NA |
| 7. B | Q96C45 | Serine/threonine-protein kinase ULK4 | 5.75e-04 | NA | 7.61e-07 | NA |
| 7. B | P17252 | Protein kinase C alpha type | 1.95e-07 | NA | 7.11e-11 | NA |
| 7. B | Q9LFV3 | Calcium/calmodulin-regulated receptor-like kinase 2 | 3.38e-06 | NA | 7.14e-10 | NA |
| 7. B | O95835 | Serine/threonine-protein kinase LATS1 | 8.04e-05 | NA | 9.76e-07 | NA |
| 7. B | Q6R2K3 | Protein STRUBBELIG-RECEPTOR FAMILY 3 | 7.95e-05 | NA | 6.40e-07 | NA |
| 7. B | Q8W4S5 | Probable LRR receptor-like serine/threonine-protein kinase At5g63710 | 7.17e-05 | NA | 3.69e-06 | NA |
| 7. B | Q2PJ68 | Serine/threonine-protein kinase sgk-1 | 1.71e-09 | NA | 1.10e-08 | NA |
| 7. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 2.54e-03 | NA | 8.72e-04 | NA |
| 7. B | P04048 | Tyrosine-protein kinase transforming protein kit | NA | NA | 7.16e-08 | NA |
| 7. B | Q9SYM9 | Receptor-like serine/threonine-protein kinase At1g78530 | 5.85e-07 | NA | 8.93e-12 | NA |
| 7. B | Q9FHK7 | Probable leucine-rich repeat receptor-like protein kinase At5g05160 | 1.78e-04 | NA | 1.33e-04 | NA |
| 7. B | Q54L00 | Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 | 3.53e-10 | NA | 3.73e-07 | NA |
| 7. B | Q8IWU2 | Serine/threonine-protein kinase LMTK2 | 4.98e-03 | NA | 7.99e-05 | NA |
| 7. B | Q09137 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 | 2.80e-09 | NA | 1.03e-14 | NA |
| 7. B | Q9QYZ4 | Sperm motility kinase 1 | 4.22e-07 | NA | 1.05e-08 | NA |
| 7. B | P42681 | Tyrosine-protein kinase TXK | 7.78e-11 | NA | 5.16e-10 | NA |
| 7. B | Q13554 | Calcium/calmodulin-dependent protein kinase type II subunit beta | 2.63e-08 | NA | 6.47e-13 | NA |
| 7. B | G9LZD7 | Probable inactive leucine-rich repeat receptor kinase XIAO | 1.08e-02 | NA | 0.001 | NA |
| 7. B | Q10LQ2 | CBL-interacting protein kinase 10 | 1.77e-08 | NA | 7.35e-18 | NA |
| 7. B | Q0D5R2 | Cysteine-rich receptor-like protein kinase 10 | 6.25e-04 | NA | 5.02e-13 | NA |
| 7. B | P83510 | Traf2 and NCK-interacting protein kinase | 3.96e-04 | NA | 3.73e-14 | NA |
| 7. B | Q00772 | Mitogen-activated protein kinase SLT2/MPK1 | 1.41e-10 | NA | 6.10e-16 | NA |
| 7. B | P42525 | Extracellular signal-regulated kinase 1 | 1.67e-07 | NA | 8.46e-17 | NA |
| 7. B | Q8RWH3 | Dual specificity protein kinase YAK1 homolog | 5.52e-04 | NA | 4.96e-04 | NA |
| 7. B | Q2RBR1 | Phototropin-1B | 3.28e-06 | NA | 3.51e-07 | NA |
| 7. B | P83741 | Serine/threonine-protein kinase WNK1 | 9.91e-03 | NA | 1.84e-09 | NA |
| 7. B | P33981 | Dual specificity protein kinase TTK | 3.48e-05 | NA | 6.03e-09 | NA |
| 7. B | Q9QYZ6 | Sperm motility kinase 2A | 8.89e-08 | NA | 2.18e-08 | NA |
| 7. B | P70618 | Mitogen-activated protein kinase 14 | 4.93e-08 | NA | 1.93e-17 | NA |
| 7. B | P53682 | Calcium-dependent protein kinase 23 | 3.92e-08 | NA | 2.24e-12 | NA |
| 7. B | C0LGW6 | LRR receptor-like serine/threonine-protein kinase ERL1 | 3.86e-03 | NA | 1.40e-06 | NA |
| 7. B | Q5RAN0 | Serine/threonine-protein kinase receptor R3 | 3.01e-10 | NA | 1.03e-04 | NA |
| 7. B | Q8C050 | Ribosomal protein S6 kinase alpha-5 | 6.41e-05 | NA | 2.12e-14 | NA |
| 7. B | Q13464 | Rho-associated protein kinase 1 | 5.48e-04 | NA | 1.15e-12 | NA |
| 7. B | Q39086 | Receptor-like serine/threonine-protein kinase SD1-7 | 2.54e-04 | NA | 1.17e-07 | NA |
| 7. B | Q9NLA1 | Serine/threonine-protein kinase flr-4 | 3.21e-07 | NA | 1.71e-04 | NA |
| 7. B | Q9LWM4 | CBL-interacting protein kinase 5 | 1.82e-08 | NA | 2.26e-21 | NA |
| 7. B | Q8LPS5 | Somatic embryogenesis receptor kinase 5 | 1.03e-03 | NA | 3.47e-07 | NA |
| 7. B | Q38871 | Calcium-dependent protein kinase 5 | 6.48e-08 | NA | 2.25e-09 | NA |
| 7. B | Q9LUL4 | Protein STRUBBELIG-RECEPTOR FAMILY 7 | 5.54e-05 | NA | 5.05e-06 | NA |
| 7. B | P49762 | Serine/threonine-protein kinase Doa | 7.98e-05 | NA | 8.96e-14 | NA |
| 7. B | Q9LUC3 | Mitogen-activated protein kinase 19 | 7.58e-06 | NA | 7.93e-15 | NA |
| 7. B | F4HQ22 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4 | 6.28e-05 | NA | 3.20e-08 | NA |
| 7. B | Q2QVG8 | Calcium-dependent protein kinase 29 | 1.76e-07 | NA | 5.86e-13 | NA |
| 7. B | C0HKC8 | Sperm motility kinase 3A | 9.92e-08 | NA | 3.49e-10 | NA |
| 7. B | Q55BN8 | Probable serine/threonine-protein kinase nek2 | 7.44e-12 | NA | 4.58e-17 | NA |
| 7. B | O49840 | Probable serine/threonine-protein kinase PBL3 | 3.46e-06 | NA | 1.02e-09 | NA |
| 7. B | P13678 | Protein kinase C | 3.18e-06 | NA | 7.30e-11 | NA |
| 7. B | Q8AXB3 | Vascular endothelial growth factor receptor kdr-like | 1.50e-02 | NA | 1.84e-07 | NA |
| 7. B | Q27324 | Tyrosine-protein kinase Drl | 1.40e-05 | NA | 5.72e-05 | NA |
| 7. B | Q8LIG4 | CBL-interacting protein kinase 3 | 8.86e-09 | NA | 1.14e-17 | NA |
| 7. B | F1M0Z1 | Triple functional domain protein | NA | NA | 1.30e-05 | NA |
| 7. B | Q5XF79 | Probable serine/threonine-protein kinase PBL18 | 1.47e-06 | NA | 5.67e-09 | NA |
| 7. B | P0C8M8 | Probable serine/threonine-protein kinase CCRP1 | 4.57e-08 | NA | 1.29e-16 | NA |
| 7. B | Q16513 | Serine/threonine-protein kinase N2 | 4.48e-05 | NA | 1.19e-07 | NA |
| 7. B | Q942F3 | Brassinosteroid LRR receptor kinase BRI1 | 1.71e-03 | NA | 6.58e-12 | NA |
| 7. B | P12931 | Proto-oncogene tyrosine-protein kinase Src | 1.30e-10 | NA | 8.98e-08 | NA |
| 7. B | O35832 | Cyclin-dependent kinase 18 | 1.01e-12 | NA | 3.42e-13 | NA |
| 7. B | P45894 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | 6.63e-07 | NA | 1.54e-17 | NA |
| 7. B | O88506 | STE20/SPS1-related proline-alanine-rich protein kinase | 6.31e-08 | NA | 3.65e-16 | NA |
| 7. B | P21802 | Fibroblast growth factor receptor 2 | 5.42e-05 | NA | 1.09e-07 | NA |
| 7. B | O80719 | Probable receptor-like protein kinase At2g47060 | 4.31e-05 | NA | 1.40e-06 | NA |
| 7. B | A6RYB8 | Serine/threonine-protein kinase atg1 | 3.90e-06 | NA | 1.04e-05 | NA |
| 7. B | Q7YQL3 | Serine/threonine-protein kinase PAK 3 | 3.76e-07 | NA | 5.65e-12 | NA |
| 7. B | O35280 | Serine/threonine-protein kinase Chk1 | 3.86e-06 | NA | 2.33e-09 | NA |
| 7. B | Q550L8 | Probable serine/threonine-protein kinase ifkB | 2.94e-01 | NA | 6.87e-08 | NA |
| 7. B | Q9FIU5 | Calcium/calmodulin-regulated receptor-like kinase 1 | 4.14e-06 | NA | 2.17e-11 | NA |
| 7. B | Q9VEZ5 | Inhibitor of nuclear factor kappa-B kinase subunit beta | 8.96e-06 | NA | 2.51e-08 | NA |
| 7. B | Q8VZJ9 | Calmodulin-binding receptor-like cytoplasmic kinase 2 | 8.59e-07 | NA | 8.08e-09 | NA |
| 7. B | Q95QC4 | Serine/threonine-protein kinase zyg-8 | 5.52e-05 | NA | 6.39e-12 | NA |
| 7. B | Q9PUF6 | Platelet-derived growth factor receptor alpha | 3.61e-04 | NA | 3.16e-06 | NA |
| 7. B | Q63802 | Wee1-like protein kinase | 5.72e-08 | NA | 3.00e-04 | NA |
| 7. B | Q9SJT0 | Probable receptor-like protein kinase At2g21480 | 4.92e-03 | NA | 6.96e-08 | NA |
| 7. B | Q8AXY6 | Muscle, skeletal receptor tyrosine protein kinase | 2.08e-05 | NA | 2.05e-04 | NA |
| 7. B | Q60592 | Microtubule-associated serine/threonine-protein kinase 2 | 1.91e-03 | NA | 2.03e-16 | NA |
| 7. B | Q84MA9 | Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 | 1.67e-05 | NA | 0.006 | NA |
| 7. B | O64778 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61420 | 3.79e-04 | NA | 2.42e-06 | NA |
| 7. B | Q4WPF2 | Serine/threonine-protein kinase atg1 | 4.74e-08 | NA | 9.34e-08 | NA |
| 7. B | Q9LV37 | Mitogen-activated protein kinase 9 | 3.09e-06 | NA | 7.19e-16 | NA |
| 7. B | Q9FKG5 | U-box domain-containing protein 51 | 2.14e-04 | NA | 3.46e-06 | NA |
| 7. B | P17613 | Serine/threonine-protein kinase | NA | NA | 1.28e-05 | NA |
| 7. B | Q9R0A5 | Serine/threonine-protein kinase Nek3 | 2.17e-09 | NA | 6.94e-19 | NA |
| 7. B | F4HPN2 | Probable serine/threonine protein kinase IRE4 | 7.69e-05 | NA | 6.69e-15 | NA |
| 7. B | P23292 | Casein kinase I homolog 2 | 1.43e-07 | NA | 5.23e-05 | NA |
| 7. B | Q683C9 | Serine/threonine-protein kinase Aurora-2 | 1.78e-15 | NA | 4.85e-13 | NA |
| 7. B | Q7XSQ5 | Calcium-dependent protein kinase 12 | 7.70e-08 | NA | 7.04e-09 | NA |
| 7. B | Q1ZXC8 | Probable serine/threonine-protein kinase pXi | 3.30e-07 | NA | 2.57e-09 | NA |
| 7. B | O74456 | Serine/threonine-protein kinase pef1 | 1.19e-14 | NA | 1.08e-16 | NA |
| 7. B | Q9CAD5 | Mitogen-activated protein kinase kinase kinase YODA | 2.94e-06 | NA | 3.56e-11 | NA |
| 7. B | Q8RY17 | Wall-associated receptor kinase-like 22 | 1.76e-04 | NA | 5.27e-10 | NA |
| 7. B | Q54XL6 | Serine/threonine-protein kinase fray1 | 1.84e-07 | NA | 1.55e-09 | NA |
| 7. B | P37023 | Serine/threonine-protein kinase receptor R3 | 2.84e-10 | NA | 1.04e-04 | NA |
| 7. B | Q55DU7 | Probable serine/threonine-protein kinase gdt4 | 3.84e-03 | NA | 3.21e-12 | NA |
| 7. B | Q9ZT07 | G-type lectin S-receptor-like serine/threonine-protein kinase RKS1 | 6.92e-04 | NA | 8.33e-08 | NA |
| 7. B | Q9CAU7 | Serine/threonine-protein kinase Nek2 | 4.11e-07 | NA | 1.76e-16 | NA |
| 7. B | P36898 | Bone morphogenetic protein receptor type-1B | 1.97e-10 | NA | 4.41e-04 | NA |
| 7. B | P06493 | Cyclin-dependent kinase 1 | 1.89e-15 | NA | 1.06e-09 | NA |
| 7. B | P20689 | Myosin light chain kinase 2, skeletal/cardiac muscle | 1.04e-08 | NA | 1.47e-10 | NA |
| 7. B | P39009 | DNA damage response protein kinase DUN1 | 5.49e-09 | NA | 2.15e-14 | NA |
| 7. B | Q7KZI7 | Serine/threonine-protein kinase MARK2 | 5.83e-06 | NA | 6.12e-15 | NA |
| 7. B | Q6UDG0 | Protein kinase US3 homolog | NA | NA | 1.17e-04 | NA |
| 7. B | Q09488 | Serine/threonine-protein kinase receptor sma-6 | 5.70e-04 | NA | 1.75e-04 | NA |
| 7. B | O96017 | Serine/threonine-protein kinase Chk2 | 1.00e-06 | NA | 4.79e-19 | NA |
| 7. B | P53667 | LIM domain kinase 1 | 1.46e-07 | NA | 1.43e-04 | NA |
| 7. B | Q8BTH8 | Casein kinase I isoform gamma-1 | 6.17e-12 | NA | 5.30e-06 | NA |
| 7. B | O74526 | Probable serine/threonine-protein kinase C70.05c | 3.37e-04 | NA | 3.49e-08 | NA |
| 7. B | Q56UN5 | Mitogen-activated protein kinase kinase kinase 19 | 9.19e-05 | NA | 3.65e-10 | NA |
| 7. B | Q5SYL1 | Ribosomal protein S6 kinase-related protein | 7.35e-09 | NA | 0.001 | NA |
| 7. B | Q0GXS4 | Serine/threonine receptor-like kinase NFP | 9.96e-04 | NA | 0.045 | NA |
| 7. B | Q84VQ3 | CBL-interacting serine/threonine-protein kinase 26 | 7.58e-09 | NA | 6.97e-19 | NA |
| 7. B | Q07832 | Serine/threonine-protein kinase PLK1 | 3.12e-07 | NA | 2.94e-19 | NA |
| 7. B | Q3UVR3 | Tau-tubulin kinase 2 | 2.81e-06 | NA | 1.36e-04 | NA |
| 7. B | Q9U1Y5 | Serine/threonine-protein kinase chk-2 | 3.81e-09 | NA | 1.21e-08 | NA |
| 7. B | Q7XJR9 | Calcium-dependent protein kinase 16 | 8.33e-07 | NA | 3.65e-17 | NA |
| 7. B | P40234 | Casein kinase I homolog 2 | 2.33e-09 | NA | 3.19e-05 | NA |
| 7. B | P11309 | Serine/threonine-protein kinase pim-1 | 1.18e-08 | NA | 7.76e-11 | NA |
| 7. B | Q2RBF0 | CBL-interacting protein kinase 15 | 5.85e-09 | NA | 1.10e-20 | NA |
| 7. B | P00538 | Serine/threonine-protein kinase-transforming protein mos | NA | NA | 2.00e-10 | NA |
| 7. B | Q9Y7J6 | Serine/threonine-protein kinase ppk21 | 5.83e-08 | NA | 1.75e-08 | NA |
| 7. B | Q9SJG2 | Probable receptor-like protein kinase At2g42960 | 1.51e-05 | NA | 6.14e-11 | NA |
| 7. B | Q55C57 | Probable serine/threonine-protein kinase glkA | 9.12e-07 | NA | 9.34e-11 | NA |
| 7. B | Q15303 | Receptor tyrosine-protein kinase erbB-4 | 1.11e-03 | NA | 2.19e-08 | NA |
| 7. B | Q8QHL3 | Vascular endothelial growth factor receptor 1 | 2.37e-05 | NA | 5.30e-06 | NA |
| 7. B | Q19469 | Serine/threonine kinase SAD-1 | 1.51e-05 | NA | 6.33e-15 | NA |
| 7. B | Q61288 | Serine/threonine-protein kinase receptor R3 | 1.61e-10 | NA | 5.73e-05 | NA |
| 7. B | O81905 | Receptor-like serine/threonine-protein kinase SD1-8 | 3.19e-04 | NA | 4.75e-07 | NA |
| 7. B | O13310 | Serine/threonine-protein kinase orb6 | 4.27e-07 | NA | 3.42e-11 | NA |
| 7. B | O48837 | Receptor like protein kinase S.2 | 2.41e-04 | NA | 1.50e-07 | NA |
| 7. B | P08181 | Casein kinase II subunit alpha | 8.07e-13 | NA | 4.67e-06 | NA |
| 7. B | Q54WW7 | Probable serine/threonine-protein kinase DDB_G0279405 | 3.54e-06 | NA | 1.57e-12 | NA |
| 7. B | Q61083 | Mitogen-activated protein kinase kinase kinase 2 | 3.15e-11 | NA | 1.71e-12 | NA |
| 7. B | Q8LST2 | Probable serine/threonine-protein kinase WNK7 | 1.48e-05 | NA | 1.03e-08 | NA |
| 7. B | O55047 | Serine/threonine-protein kinase tousled-like 2 | 4.98e-10 | NA | 9.12e-15 | NA |
| 7. B | Q62956 | Receptor tyrosine-protein kinase erbB-4 | 1.07e-03 | NA | 2.73e-08 | NA |
| 7. B | Q8CFH6 | Serine/threonine-protein kinase SIK2 | 1.13e-05 | NA | 8.16e-08 | NA |
| 7. B | O23145 | Shaggy-related protein kinase beta | 2.23e-09 | NA | 7.76e-08 | NA |
| 7. B | Q8VEB1 | G protein-coupled receptor kinase 5 | 5.98e-07 | NA | 1.89e-12 | NA |
| 7. B | P28583 | Calcium-dependent protein kinase SK5 | 2.77e-08 | NA | 6.06e-13 | NA |
| 7. B | Q0DR28 | U-box domain-containing protein 57 | 1.76e-05 | NA | 0.004 | NA |
| 7. B | Q6NLQ6 | Calcium-dependent protein kinase 32 | 1.56e-08 | NA | 3.21e-15 | NA |
| 7. B | Q551H4 | Serine/threonine-protein kinase fray2 | 1.44e-06 | NA | 8.08e-08 | NA |
| 7. B | P53739 | Flippase kinase 1 | 2.09e-05 | NA | 4.68e-05 | NA |
| 7. B | O35346 | Focal adhesion kinase 1 | 1.73e-04 | NA | 7.89e-11 | NA |
| 7. B | O74536 | SNF1-like protein kinase ssp2 | 3.94e-08 | NA | 1.89e-12 | NA |
| 7. B | Q2QYY8 | Phototropin-1A | 3.46e-06 | NA | 3.97e-07 | NA |
| 7. B | Q9NI63 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase | 3.34e-09 | NA | 1.85e-11 | NA |
| 7. B | Q9M9E0 | L-type lectin-domain containing receptor kinase S.1 | 2.86e-04 | NA | 4.55e-09 | NA |
| 7. B | Q9LZU4 | Cysteine-rich receptor-like protein kinase 4 | 9.15e-05 | NA | 8.44e-09 | NA |
| 7. B | Q658G7 | LRR receptor-like serine/threonine-protein kinase SIK1 | 3.13e-03 | NA | 5.89e-07 | NA |
| 7. B | P10447 | Tyrosine-protein kinase transforming protein Abl | NA | NA | 4.55e-10 | NA |
| 7. B | O54784 | Death-associated protein kinase 3 | 3.22e-09 | NA | 1.75e-15 | NA |
| 7. B | P09216 | Protein kinase C epsilon type | 2.23e-07 | NA | 5.94e-12 | NA |
| 7. B | Q9M9C5 | Probable leucine-rich repeat receptor-like protein kinase At1g68400 | 6.75e-05 | NA | 9.24e-05 | NA |
| 7. B | P08413 | Calcium/calmodulin-dependent protein kinase type II subunit beta | 1.25e-09 | NA | 1.59e-13 | NA |
| 7. B | P51451 | Tyrosine-protein kinase Blk | 2.36e-08 | NA | 3.89e-10 | NA |
| 7. B | P32581 | Meiosis induction protein kinase IME2/SME1 | 2.71e-06 | NA | 2.20e-05 | NA |
| 7. B | Q0WPH8 | Serine/threonine-protein kinase Nek5 | 2.89e-08 | NA | 2.86e-16 | NA |
| 7. B | Q55FS2 | Serine/threonine-protein kinase 4 homolog B | 3.95e-06 | NA | 1.17e-13 | NA |
| 7. B | O97799 | Mast/stem cell growth factor receptor Kit | 7.64e-03 | NA | 2.26e-07 | NA |
| 7. B | O88351 | Inhibitor of nuclear factor kappa-B kinase subunit beta | 1.85e-05 | NA | 1.19e-10 | NA |
| 7. B | Q9SFT7 | Probable serine/threonine-protein kinase PBL26 | 7.16e-06 | NA | 2.38e-09 | NA |
| 7. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 2.30e-05 | NA | 2.53e-06 | NA |
| 7. B | O80396 | Mitogen-activated protein kinase kinase 3 | 1.12e-10 | NA | 7.15e-13 | NA |
| 7. B | P32865 | G protein-coupled receptor kinase 1 | 1.29e-06 | NA | 9.28e-16 | NA |
| 7. B | Q03957 | CTD kinase subunit alpha | 3.63e-08 | NA | 3.32e-08 | NA |
| 7. B | A7F0W2 | Serine/threonine-protein kinase ATG1 | 3.09e-06 | NA | 4.72e-06 | NA |
| 7. B | Q8WTQ7 | Rhodopsin kinase GRK7 | 2.79e-07 | NA | 8.68e-13 | NA |
| 7. B | Q00535 | Cyclin-dependent-like kinase 5 | 1.67e-15 | NA | 4.64e-12 | NA |
| 7. B | Q9LDS6 | Putative cysteine-rich receptor-like protein kinase 32 | 2.76e-04 | NA | 5.56e-07 | NA |
| 7. B | Q8QFP9 | Tyrosine-protein kinase receptor TYRO3 | 7.54e-05 | NA | 4.31e-06 | NA |
| 7. B | Q6DEH3 | Calcium/calmodulin-dependent protein kinase type II delta 1 chain | 3.52e-08 | NA | 8.05e-13 | NA |
| 7. B | Q13131 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | 1.18e-07 | NA | 4.04e-16 | NA |
| 7. B | O35831 | Cyclin-dependent kinase 17 | 7.32e-12 | NA | 2.27e-11 | NA |
| 7. B | P54764 | Ephrin type-A receptor 4 | 4.84e-06 | NA | 1.58e-11 | NA |
| 7. B | Q5U4C9 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 | 1.08e-07 | NA | 5.93e-09 | NA |
| 7. B | Q9SUA3 | Serine/threonine-protein kinase D6PKL1 | 4.50e-08 | NA | 1.88e-06 | NA |
| 7. B | Q6K5F8 | Cyclin-dependent kinase G-1 | 3.05e-06 | NA | 9.47e-13 | NA |
| 7. B | Q96BR1 | Serine/threonine-protein kinase Sgk3 | 1.52e-07 | NA | 1.21e-10 | NA |
| 7. B | Q9SF86 | Serine/threonine-protein kinase PCRK1 | 1.94e-06 | NA | 8.54e-07 | NA |
| 7. B | P54762 | Ephrin type-B receptor 1 | 6.49e-05 | NA | 1.65e-13 | NA |
| 7. B | Q9XF67 | 3-phosphoinositide-dependent protein kinase 1 | 8.12e-08 | NA | 6.26e-12 | NA |
| 7. B | Q54C77 | Probable inactive serine/threonine-protein kinase DDB_G0293184 | 3.43e-04 | NA | 1.07e-08 | NA |
| 7. B | Q54P47 | Probable serine/threonine-protein kinase ndrC | 1.17e-03 | NA | 2.71e-09 | NA |
| 7. B | P08922 | Proto-oncogene tyrosine-protein kinase ROS | 4.08e-02 | NA | 5.84e-09 | NA |
| 7. B | Q9W1B0 | Serine/threonine-protein kinase Genghis Khan | 5.08e-03 | NA | 5.39e-13 | NA |
| 7. B | F4KA50 | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.2 | 1.18e-04 | NA | 7.61e-07 | NA |
| 7. B | Q39202 | G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 | 3.01e-04 | NA | 1.04e-06 | NA |
| 7. B | Q54V83 | Probable serine/threonine-protein kinase kinase DDB_G0280557 | 1.80e-06 | NA | 4.70e-04 | NA |
| 7. B | P63319 | Protein kinase C gamma type | 2.75e-07 | NA | 3.08e-09 | NA |
| 7. B | Q7T6X2 | Putative serine/threonine-protein kinase/receptor R826 | NA | NA | 2.47e-15 | NA |
| 7. B | Q96PY6 | Serine/threonine-protein kinase Nek1 | 1.20e-04 | NA | 5.74e-19 | NA |
| 7. B | Q9WTQ0 | Protein kinase C theta type | 1.76e-07 | NA | 1.39e-11 | NA |
| 7. B | Q08156 | Mast/stem cell growth factor receptor Kit | 2.43e-03 | NA | 2.88e-08 | NA |
| 7. B | Q9ZVM9 | Probable serine/threonine-protein kinase At1g54610 | 4.52e-07 | NA | 5.82e-08 | NA |
| 7. B | P25098 | Beta-adrenergic receptor kinase 1 | 1.02e-06 | NA | 1.03e-14 | NA |
| 7. B | Q80YS9 | Serine/threonine kinase-like domain-containing protein STKLD1 | 1.04e-04 | NA | 7.73e-05 | NA |
| 7. B | P52564 | Dual specificity mitogen-activated protein kinase kinase 6 | 3.86e-10 | NA | 1.89e-12 | NA |
| 7. B | Q54LR6 | Probable serine/threonine-protein kinase DDB_G0286481 | 2.61e-09 | NA | 7.55e-05 | NA |
| 7. B | Q9UPZ9 | Serine/threonine-protein kinase ICK | 3.67e-10 | NA | 1.16e-09 | NA |
| 7. B | Q9LMT0 | Cyclin-dependent kinase D-3 | 4.02e-09 | NA | 3.99e-12 | NA |
| 7. B | Q9SJQ1 | Leucine-rich repeat receptor-like protein kinase PXC1 | 4.40e-05 | NA | 1.42e-06 | NA |
| 7. B | G5EGK5 | Tyrosine-protein kinase receptor cam-1 | 1.43e-04 | NA | 2.41e-07 | NA |
| 7. B | Q9FKG6 | U-box domain-containing protein 52 | 4.36e-03 | NA | 0.002 | NA |
| 7. B | O14578 | Citron Rho-interacting kinase | 5.51e-03 | NA | 1.38e-12 | NA |
| 7. B | Q9NRM7 | Serine/threonine-protein kinase LATS2 | 1.70e-03 | NA | 2.05e-08 | NA |
| 7. B | I1Z695 | LRR receptor-like serine/threonine-protein kinase ER2 | 4.25e-03 | NA | 2.40e-06 | NA |
| 7. B | Q9ZSA2 | Calcium-dependent protein kinase 21 | 6.34e-10 | NA | 1.41e-12 | NA |
| 7. B | Q2QMI0 | CBL-interacting protein kinase 4 | 1.55e-08 | NA | 7.22e-26 | NA |
| 7. B | O81292 | L-type lectin-domain containing receptor kinase IV.3 | 4.74e-04 | NA | 8.16e-06 | NA |
| 7. B | Q7TSE6 | Serine/threonine-protein kinase 38-like | 5.12e-07 | NA | 5.01e-10 | NA |
| 7. B | Q55CE0 | Probable serine/threonine-protein kinase mkcF | 2.39e-07 | NA | 6.02e-12 | NA |
| 7. B | Q39203 | G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2 | 2.05e-04 | NA | 9.25e-09 | NA |
| 7. B | Q6DT37 | Serine/threonine-protein kinase MRCK gamma | 9.70e-04 | NA | 2.64e-12 | NA |
| 7. B | Q25AG3 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3 | 2.42e-04 | NA | 4.09e-10 | NA |
| 7. B | Q8IBS5 | Calcium-dependent protein kinase 4 | 5.83e-07 | NA | 3.01e-14 | NA |
| 7. B | Q9LFS4 | Protein NSP-INTERACTING KINASE 1 | 5.71e-04 | NA | 4.18e-09 | NA |
| 7. B | C0LGD8 | Probable LRR receptor-like serine/threonine-protein kinase At1g07550 | 7.72e-04 | NA | 4.27e-08 | NA |
| 7. B | Q9LYX1 | L-type lectin-domain containing receptor kinase VIII.2 | 3.17e-04 | NA | 2.46e-07 | NA |
| 7. B | P92958 | SNF1-related protein kinase catalytic subunit alpha KIN11 | 5.66e-08 | NA | 4.12e-18 | NA |
| 7. B | Q54DF7 | Probable serine/threonine-protein kinase DDB_G0292354 | 1.57e-08 | NA | 4.69e-09 | NA |
| 7. B | Q93Z18 | Casein kinase 1-like protein 3 | 4.92e-10 | NA | 2.34e-09 | NA |
| 7. B | Q9ZUF4 | Serine/threonine-protein kinase RIPK | 5.78e-06 | NA | 1.09e-13 | NA |
| 7. B | P21860 | Receptor tyrosine-protein kinase erbB-3 | 1.68e-04 | NA | 6.17e-05 | NA |
| 7. B | Q8RWZ1 | Protein STRUBBELIG | 1.27e-04 | NA | 0.005 | NA |
| 7. B | Q9ES70 | Serine/threonine-protein kinase Nek6 | 0.00e+00 | NA | 8.01e-20 | NA |
| 7. B | Q9C5S8 | Cysteine-rich receptor-like protein kinase 5 | 4.44e-05 | NA | 3.85e-09 | NA |
| 7. B | Q09437 | Cyclin-dependent kinase 11.1 | 6.10e-06 | NA | 5.46e-09 | NA |
| 7. B | Q4J9K4 | Serine/threonine-protein kinase ArnS | 3.39e-10 | NA | 5.28e-05 | NA |
| 7. B | Q9S9M5 | Wall-associated receptor kinase-like 1 | 3.47e-05 | NA | 2.24e-13 | NA |
| 7. B | Q924X7 | Serine/threonine-protein kinase 33 | 4.15e-09 | NA | 1.92e-12 | NA |
| 7. B | Q95KV0 | Inhibitor of nuclear factor kappa-B kinase subunit beta | 2.65e-05 | NA | 2.19e-10 | NA |
| 7. B | P47197 | RAC-beta serine/threonine-protein kinase | 3.68e-08 | NA | 2.46e-15 | NA |
| 7. B | P31748 | AKT kinase-transforming protein | NA | NA | 1.66e-12 | NA |
| 7. B | Q8H199 | Cysteine-rich receptor-like protein kinase 14 | 3.21e-04 | NA | 7.43e-09 | NA |
| 7. B | Q54MH0 | Probable serine/threonine-protein kinase fhkD | 1.52e-06 | NA | 9.53e-19 | NA |
| 7. B | Q55DD4 | Serine/threonine-protein kinase pakD | 4.07e-03 | NA | 3.39e-08 | NA |
| 7. B | Q5IS82 | NT-3 growth factor receptor | NA | NA | 2.37e-06 | NA |
| 7. B | Q9BQI3 | Eukaryotic translation initiation factor 2-alpha kinase 1 | 9.86e-03 | NA | 6.08e-07 | NA |
| 7. B | Q9LW62 | Casein kinase 1-like protein 10 | 2.54e-08 | NA | 1.75e-08 | NA |
| 7. B | P50488 | Cell surface receptor daf-4 | 1.49e-05 | NA | 5.46e-12 | NA |
| 7. B | Q5XF24 | Casein kinase 1-like protein 13 | 3.55e-08 | NA | 8.31e-09 | NA |
| 7. B | P42684 | Tyrosine-protein kinase ABL2 | 4.99e-04 | NA | 3.27e-09 | NA |
| 7. B | O75582 | Ribosomal protein S6 kinase alpha-5 | 2.16e-05 | NA | 6.06e-18 | NA |
| 7. B | Q91909 | Mast/stem cell growth factor receptor-related protein Kit | 6.07e-05 | NA | 4.99e-07 | NA |
| 7. B | Q9M342 | Wall-associated receptor kinase-like 15 | 4.09e-05 | NA | 3.19e-10 | NA |
| 7. B | Q94A51 | U-box domain-containing protein 32 | 1.19e-03 | NA | 1.14e-05 | NA |
| 7. B | Q02750 | Dual specificity mitogen-activated protein kinase kinase 1 | 1.23e-13 | NA | 4.18e-09 | NA |
| 7. B | Q8K1R7 | Serine/threonine-protein kinase Nek9 | 2.88e-05 | NA | 4.53e-09 | NA |
| 7. B | Q9SEZ7 | CBL-interacting serine/threonine-protein kinase 16 | 1.26e-08 | NA | 4.39e-15 | NA |
| 7. B | O54748 | Serine/threonine-protein kinase 3 | 3.64e-08 | NA | 1.41e-09 | NA |
| 7. B | O14920 | Inhibitor of nuclear factor kappa-B kinase subunit beta | 2.29e-05 | NA | 1.24e-10 | NA |
| 7. B | P13186 | Serine/threonine-protein kinase KIN2 | 4.75e-06 | NA | 2.86e-07 | NA |
| 7. B | Q9Y5S2 | Serine/threonine-protein kinase MRCK beta | 4.41e-03 | NA | 1.23e-13 | NA |
| 7. B | Q5PU49 | Protein kinase C delta type | NA | NA | 5.95e-12 | NA |
| 7. B | C0LGN2 | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 | 1.73e-03 | NA | 2.38e-09 | NA |
| 7. B | P51957 | Serine/threonine-protein kinase Nek4 | 5.81e-07 | NA | 2.91e-15 | NA |
| 7. B | Q9Z2A6 | Mitogen-activated protein kinase 15 | 5.69e-09 | NA | 3.69e-14 | NA |
| 7. B | Q54XI9 | Probable inactive serine/threonine-protein kinase DDB_G0278909 | 2.27e-03 | NA | 0.013 | NA |
| 7. B | Q24488 | Tyrosine-protein kinase transmembrane receptor Ror | 2.25e-09 | NA | 3.08e-09 | NA |
| 7. B | C0LGS3 | Probable LRR receptor-like serine/threonine-protein kinase At4g37250 | 2.64e-08 | NA | 4.14e-04 | NA |
| 7. B | Q19266 | Protein kinase C-like 3 | 1.58e-07 | NA | 2.18e-13 | NA |
| 7. B | Q8RWL2 | Calcium-dependent protein kinase 29 | 1.39e-09 | NA | 2.20e-13 | NA |
| 7. B | P18106 | Tyrosine-protein kinase Fer | 4.31e-06 | NA | 9.44e-15 | NA |
| 7. B | Q9M8T0 | Probable inactive receptor kinase At3g02880 | 2.41e-05 | NA | 1.79e-04 | NA |
| 7. B | Q54WD7 | Probable serine/threonine-protein kinase DDB_G0279719 | 8.72e-02 | NA | 2.28e-09 | NA |
| 7. B | Q556J6 | Putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007 | 4.26e-05 | NA | 2.18e-12 | NA |
| 7. B | Q2R2D5 | Receptor kinase-like protein Xa21 | 8.61e-03 | NA | 3.69e-05 | NA |
| 7. B | Q9SSF8 | Calcium-dependent protein kinase 30 | 2.08e-08 | NA | 8.57e-12 | NA |
| 7. B | P17157 | Cyclin-dependent protein kinase PHO85 | 8.72e-14 | NA | 4.65e-16 | NA |
| 7. B | Q60EY8 | CBL-interacting protein kinase 20 | 1.88e-08 | NA | 3.25e-20 | NA |
| 7. B | Q92772 | Cyclin-dependent kinase-like 2 | 1.91e-10 | NA | 2.19e-12 | NA |
| 7. B | Q9LFH9 | L-type lectin-domain containing receptor kinase VIII.1 | 2.26e-04 | NA | 4.70e-07 | NA |
| 7. B | Q38997 | SNF1-related protein kinase catalytic subunit alpha KIN10 | 4.61e-08 | NA | 4.56e-18 | NA |
| 7. B | Q04912 | Macrophage-stimulating protein receptor | 2.80e-03 | NA | 1.47e-05 | NA |
| 7. B | X5M8U1 | Receptor-type guanylate cyclase gcy-17 | 6.41e-05 | NA | 0.010 | NA |
| 7. B | D3ZG83 | Mitogen-activated protein kinase kinase kinase 10 | 2.33e-07 | NA | 2.90e-10 | NA |
| 7. B | Q1PFH8 | Calcium-dependent protein kinase 19 | 3.73e-08 | NA | 5.80e-12 | NA |
| 7. B | P00526 | Tyrosine-protein kinase transforming protein Src | NA | NA | 8.05e-09 | NA |
| 7. B | O22971 | CBL-interacting serine/threonine-protein kinase 13 | 2.86e-07 | NA | 2.87e-14 | NA |
| 7. B | Q7TSC3 | Serine/threonine-protein kinase Nek5 | 1.12e-07 | NA | 2.30e-18 | NA |
| 7. B | O95819 | Mitogen-activated protein kinase kinase kinase kinase 4 | 6.12e-05 | NA | 2.98e-12 | NA |
| 7. B | Q54LH8 | Probable serine/threonine-protein kinase DDB_G0286627 | 1.44e-05 | NA | 3.78e-05 | NA |
| 7. B | Q6PDN3 | Myosin light chain kinase, smooth muscle | 8.94e-04 | NA | 2.48e-18 | NA |
| 7. B | O44514 | Mitogen-activated protein kinase pmk-3 | 7.34e-07 | NA | 9.09e-12 | NA |
| 7. B | Q9H2X6 | Homeodomain-interacting protein kinase 2 | 4.95e-05 | NA | 9.70e-07 | NA |
| 7. B | Q13546 | Receptor-interacting serine/threonine-protein kinase 1 | 9.52e-08 | NA | 2.26e-11 | NA |
| 7. B | Q54IE8 | Probable serine/threonine-protein kinase irlE | 7.54e-03 | NA | 1.86e-04 | NA |
| 7. B | Q54WJ0 | Serine/threonine-protein kinase stk11 homolog | 9.09e-07 | NA | 1.08e-15 | NA |
| 7. B | P53894 | Serine/threonine-protein kinase CBK1 | 1.79e-05 | NA | 4.83e-07 | NA |
| 7. B | Q64303 | Serine/threonine-protein kinase PAK 2 | 1.83e-07 | NA | 2.62e-11 | NA |
| 7. B | Q9JMK2 | Casein kinase I isoform epsilon | 7.65e-09 | NA | 4.26e-12 | NA |
| 7. B | Q9SZM3 | Calcium-dependent protein kinase 26 | 1.29e-08 | NA | 1.48e-09 | NA |
| 7. B | Q6K968 | Calcium-dependent protein kinase 6 | 9.98e-10 | NA | 8.82e-07 | NA |
| 7. B | Q5S006 | Leucine-rich repeat serine/threonine-protein kinase 2 | 4.15e-02 | NA | 1.15e-04 | NA |
| 7. B | P35546 | Proto-oncogene tyrosine-protein kinase receptor Ret | 2.25e-03 | NA | 3.37e-09 | NA |
| 7. B | P54757 | Ephrin type-A receptor 5 | 1.52e-04 | NA | 5.80e-11 | NA |
| 7. B | O64816 | Casein kinase II subunit alpha-4, chloroplastic | 1.39e-11 | NA | 8.26e-05 | NA |
| 7. B | Q9M1G4 | Probable L-type lectin-domain containing receptor kinase I.5 | 1.34e-04 | NA | 5.14e-04 | NA |
| 7. B | P33886 | Protein kinase wis1 | 3.27e-07 | NA | 1.97e-11 | NA |
| 7. B | Q9ES74 | Serine/threonine-protein kinase Nek7 | 0.00e+00 | NA | 1.28e-18 | NA |
| 7. B | Q75J39 | Serine/threonine-protein kinase-like protein CR4 | 9.89e-04 | NA | 2.78e-08 | NA |
| 7. B | Q9UKI8 | Serine/threonine-protein kinase tousled-like 1 | 1.36e-09 | NA | 6.32e-12 | NA |
| 7. B | P32298 | G protein-coupled receptor kinase 4 | 1.68e-06 | NA | 3.25e-12 | NA |
| 7. B | Q54BC9 | Probable serine/threonine-protein kinase dyrk2 | 1.82e-08 | NA | 4.03e-07 | NA |
| 7. B | Q9JM52 | Misshapen-like kinase 1 | 5.37e-04 | NA | 2.11e-12 | NA |
| 7. B | Q9S9U1 | L-type lectin-domain containing receptor kinase VII.1 | 2.32e-04 | NA | 5.37e-07 | NA |
| 7. B | P08018 | MAP kinase kinase PBS2 | 2.26e-08 | NA | 5.47e-11 | NA |
| 7. B | C0LGD6 | Probable LRR receptor-like serine/threonine-protein kinase At1g05700 | 4.43e-04 | NA | 1.79e-10 | NA |
| 7. B | Q2M2I8 | AP2-associated protein kinase 1 | 5.54e-06 | NA | 0.017 | NA |
| 7. B | P38991 | Spindle assembly checkpoint kinase | 5.43e-14 | NA | 7.47e-13 | NA |
| 7. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 2.29e-08 | NA | 1.09e-08 | NA |
| 7. B | Q12852 | Mitogen-activated protein kinase kinase kinase 12 | 5.74e-07 | NA | 1.94e-13 | NA |
| 7. B | P51842 | Retinal guanylyl cyclase 2 | 1.14e-05 | NA | 0.049 | NA |
| 7. B | P59241 | Aurora kinase A | 5.05e-10 | NA | 3.14e-07 | NA |
| 7. B | Q9ZR79 | L-type lectin-domain containing receptor kinase V.7 | 1.26e-04 | NA | 1.94e-09 | NA |
| 7. B | Q8IYT8 | Serine/threonine-protein kinase ULK2 | 2.69e-07 | NA | 7.84e-16 | NA |
| 7. B | P58750 | Serine/threonine-protein kinase pim-3 | 1.66e-09 | NA | 1.48e-08 | NA |
| 7. B | P79750 | Macrophage colony-stimulating factor 1 receptor 1 | 2.31e-03 | NA | 6.99e-08 | NA |
| 7. B | Q552E9 | Probable serine/threonine-protein kinase pkgA | 3.07e-02 | NA | 2.63e-08 | NA |
| 7. B | Q9LJL9 | CDPK-related kinase 2 | 1.17e-06 | NA | 2.82e-15 | NA |
| 7. B | P34314 | Serine/threonine-protein kinase tousled-like 1 | 9.74e-06 | NA | 1.60e-15 | NA |
| 7. B | Q5JZY3 | Ephrin type-A receptor 10 | 1.08e-03 | NA | 5.00e-08 | NA |
| 7. B | A0A0R0HPY5 | Leucine-rich repeat receptor-like kinase protein CLV1a | 1.26e-03 | NA | 1.66e-04 | NA |
| 7. B | Q7XIM0 | Calcium-dependent protein kinase 17 | 3.33e-08 | NA | 2.80e-11 | NA |
| 7. B | Q4P0K0 | Serine/threonine-protein kinase ATG1 | 5.66e-06 | NA | 4.80e-06 | NA |
| 7. B | Q869W6 | Probable myosin light chain kinase DDB_G0275057 | 8.44e-12 | NA | 4.39e-17 | NA |
| 7. B | P16912 | cAMP-dependent protein kinase catalytic subunit 3 | 4.57e-08 | NA | 1.15e-08 | NA |
| 7. B | Q9FP13 | LRR receptor kinase SERL2 | 6.78e-04 | NA | 1.46e-08 | NA |
| 7. B | P27704 | Mitogen-activated protein kinase 6 | 6.62e-07 | NA | 1.45e-13 | NA |
| 7. B | O65479 | Putative cysteine-rich receptor-like protein kinase 20 | 2.73e-04 | NA | 1.49e-07 | NA |
| 7. B | P70539 | Activin receptor type-1C | 1.53e-10 | NA | 1.16e-05 | NA |
| 7. B | Q55GU0 | Probable serine/threonine-protein kinase DDB_G0267514 | 4.09e-06 | NA | 2.29e-13 | NA |
| 7. B | C0LGD7 | Probable LRR receptor-like serine/threonine-protein kinase At1g06840 | 7.29e-04 | NA | 9.02e-10 | NA |
| 7. B | Q78EA7 | Bone morphogenetic protein receptor type-1A | 5.26e-10 | NA | 8.88e-04 | NA |
| 7. B | P15791 | Calcium/calmodulin-dependent protein kinase type II subunit delta | 1.12e-09 | NA | 2.56e-15 | NA |
| 7. B | Q9WUA6 | RAC-gamma serine/threonine-protein kinase | 3.85e-08 | NA | 7.86e-13 | NA |
| 7. B | P29319 | Ephrin type-A receptor 3 | 5.61e-05 | NA | 6.85e-13 | NA |
| 7. B | Q6CRA9 | Serine/threonine-protein kinase BUR1 | 3.59e-05 | NA | 1.91e-06 | NA |
| 7. B | Q9UQ07 | MAPK/MAK/MRK overlapping kinase | 1.63e-08 | NA | 1.94e-11 | NA |
| 7. B | Q6AXJ9 | Cyclin-dependent kinase-like 1 | 2.45e-09 | NA | 3.08e-14 | NA |
| 7. B | Q39025 | Mitogen-activated protein kinase 5 | 4.25e-08 | NA | 1.34e-14 | NA |
| 7. B | Q2V452 | CBL-interacting serine/threonine-protein kinase 3 | 2.15e-09 | NA | 4.00e-18 | NA |
| 7. B | Q75L42 | CBL-interacting protein kinase 17 | 4.25e-08 | NA | 9.81e-19 | NA |
| 7. B | Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 | 1.84e-07 | NA | 2.03e-05 | NA |
| 7. B | O88445 | Aurora kinase C | 1.22e-15 | NA | 5.43e-12 | NA |
| 7. B | Q6H7U5 | CBL-interacting protein kinase 26 | 1.02e-07 | NA | 5.48e-19 | NA |
| 7. B | Q96RG2 | PAS domain-containing serine/threonine-protein kinase | 2.36e-03 | NA | 2.84e-10 | NA |
| 7. B | Q8I113 | MAP kinase-interacting serine/threonine-protein kinase mnk-1 | 3.43e-05 | NA | 1.10e-13 | NA |
| 7. B | Q9LX66 | Receptor-like protein kinase HERK 1 | 1.51e-03 | NA | 2.48e-09 | NA |
| 7. B | Q62074 | Protein kinase C iota type | 2.96e-07 | NA | 5.96e-15 | NA |
| 7. B | Q9JKV2 | Serine/threonine-protein kinase ICK | 1.66e-07 | NA | 1.68e-10 | NA |
| 7. B | Q63572 | Dual specificity testis-specific protein kinase 1 | 5.92e-10 | NA | 0.001 | NA |
| 7. B | Q04759 | Protein kinase C theta type | 1.80e-07 | NA | 3.34e-12 | NA |
| 7. B | O14299 | MAP kinase kinase kinase wis4 | 1.47e-04 | NA | 1.01e-16 | NA |
| 7. B | Q0WNY5 | Wall-associated receptor kinase-like 18 | 4.90e-04 | NA | 2.08e-10 | NA |
| 7. B | Q60DG4 | Serine/threonine-protein kinase Nek4 | 2.71e-05 | NA | 7.32e-17 | NA |
| 7. B | Q8QZV4 | Serine/threonine-protein kinase 32C | 2.17e-07 | NA | 1.19e-14 | NA |
| 7. B | Q8MYQ1 | Putative serine/threonine-protein kinase F31E3.2 | 1.57e-09 | NA | 0.003 | NA |
| 7. B | P51956 | Serine/threonine-protein kinase Nek3 | 3.03e-07 | NA | 4.40e-18 | NA |
| 7. B | Q01973 | Inactive tyrosine-protein kinase transmembrane receptor ROR1 | 1.13e-07 | NA | 2.95e-04 | NA |
| 7. B | P16591 | Tyrosine-protein kinase Fer | 1.88e-08 | NA | 6.47e-13 | NA |
| 7. B | Q9V422 | Tyrosine-protein kinase Dnt | 9.20e-07 | NA | 0.010 | NA |
| 7. B | Q01389 | Serine/threonine-protein kinase BCK1/SLK1/SSP31 | 1.24e-04 | NA | 1.46e-09 | NA |
| 7. B | Q9LK35 | Receptor-like protein kinase THESEUS 1 | 2.40e-03 | NA | 4.17e-10 | NA |
| 7. B | O14019 | Serine/threonine-protein kinase hal4 | 2.80e-05 | NA | 2.91e-12 | NA |
| 7. B | O60285 | NUAK family SNF1-like kinase 1 | 7.56e-06 | NA | 1.72e-12 | NA |
| 7. B | P33279 | Eukaryotic translation initiation factor 2-alpha kinase 1 | 7.63e-04 | NA | 1.48e-07 | NA |
| 7. B | Q01279 | Epidermal growth factor receptor | 8.84e-05 | NA | 1.90e-10 | NA |
| 7. B | O64770 | G-type lectin S-receptor-like serine/threonine-protein kinase At1g61490 | 3.16e-04 | NA | 1.45e-06 | NA |
| 7. B | Q9JLM8 | Serine/threonine-protein kinase DCLK1 | 8.95e-06 | NA | 2.52e-12 | NA |
| 7. B | Q63185 | Eukaryotic translation initiation factor 2-alpha kinase 1 | 1.10e-03 | NA | 1.56e-07 | NA |
| 7. B | Q09136 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) | NA | NA | 7.61e-15 | NA |
| 7. B | Q9NQU5 | Serine/threonine-protein kinase PAK 6 | 2.70e-07 | NA | 2.08e-09 | NA |
| 7. B | Q90669 | Activin receptor type-2A | 1.35e-06 | NA | 1.53e-08 | NA |
| 7. B | O22558 | Serine/threonine-protein kinase STY8 | 3.15e-11 | NA | 4.49e-13 | NA |
| 7. B | Q9SD62 | Putative receptor-like protein kinase At3g47110 | 1.78e-03 | NA | 6.07e-06 | NA |
| 7. B | Q8NB16 | Mixed lineage kinase domain-like protein | 2.50e-07 | NA | 7.87e-06 | NA |
| 7. B | Q7FAZ0 | G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4 | 1.68e-04 | NA | 6.67e-11 | NA |
| 7. B | Q91048 | Inactive tyrosine-protein kinase 7 | 8.09e-07 | NA | 1.03e-08 | NA |
| 7. B | Q8W1D5 | CBL-interacting serine/threonine-protein kinase 25 | 6.45e-08 | NA | 1.40e-20 | NA |
| 7. B | Q06418 | Tyrosine-protein kinase receptor TYRO3 | 1.40e-05 | NA | 1.80e-06 | NA |
| 7. B | Q9GN62 | Serine/threonine-protein kinase par-4 | 1.34e-05 | NA | 1.56e-09 | NA |
| 7. B | Q8BYC6 | Serine/threonine-protein kinase TAO3 | 7.50e-06 | NA | 1.16e-06 | NA |
| 7. B | P45983 | Mitogen-activated protein kinase 8 | 1.17e-05 | NA | 9.27e-15 | NA |
| 7. B | Q54B33 | Serine/threonine-protein kinase pakE | 3.16e-06 | NA | 2.10e-12 | NA |
| 7. B | F4IRW0 | Serine/threonine-protein kinase ATG1c | 5.00e-07 | NA | 6.65e-15 | NA |
| 7. B | Q9Z188 | Dual specificity tyrosine-phosphorylation-regulated kinase 1B | 5.34e-10 | NA | 2.07e-07 | NA |
| 7. B | O14936 | Peripheral plasma membrane protein CASK | 1.47e-05 | NA | 3.94e-15 | NA |
| 7. B | Q94AG2 | Somatic embryogenesis receptor kinase 1 | 6.08e-04 | NA | 9.50e-07 | NA |
| 7. B | P18431 | Protein kinase shaggy | 4.87e-08 | NA | 1.09e-06 | NA |
| 7. B | P9WI75 | Serine/threonine-protein kinase PknF | 5.74e-10 | NA | 7.16e-16 | NA |
| 7. B | Q6K4T4 | LRR receptor kinase SERK2 | 1.46e-04 | NA | 1.05e-08 | NA |
| 7. B | Q869X3 | Probable serine/threonine-protein kinase DDB_G0275165 | 2.31e-08 | NA | 3.70e-07 | NA |
| 7. B | F4K6B8 | Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4 | 2.94e-03 | NA | 1.30e-04 | NA |
| 7. B | Q9S7D9 | Serine/threonine-protein kinase-like protein CCR1 | 2.60e-04 | NA | 0.003 | NA |
| 7. B | P31751 | RAC-beta serine/threonine-protein kinase | 2.73e-08 | NA | 1.11e-14 | NA |
| 7. B | P0C605 | cGMP-dependent protein kinase 1 | 3.29e-07 | NA | 2.70e-09 | NA |
| 7. B | P10721 | Mast/stem cell growth factor receptor Kit | 2.03e-02 | NA | 2.07e-07 | NA |
| 7. B | Q9NGW9 | Probable serine/threonine-protein kinase mkcB | 2.32e-06 | NA | 2.85e-09 | NA |
| 7. B | Q90XV6 | Serine/threonine-protein kinase mos (Fragment) | 3.09e-08 | NA | 1.39e-10 | NA |
| 7. B | O64825 | LysM domain receptor-like kinase 4 | 3.92e-08 | NA | 3.29e-06 | NA |
| 7. B | C0LGT6 | LRR receptor-like serine/threonine-protein kinase EFR | 3.33e-03 | NA | 6.06e-11 | NA |
| 7. B | Q8R3L8 | Cyclin-dependent kinase 8 | 1.50e-05 | NA | 4.56e-05 | NA |
| 7. B | P51812 | Ribosomal protein S6 kinase alpha-3 | 1.70e-06 | NA | 5.42e-15 | NA |
| 7. B | Q9ZWC8 | Serine/threonine-protein kinase BRI1-like 1 | 7.02e-03 | NA | 9.08e-13 | NA |
| 7. B | Q54RR9 | Probable serine/threonine-protein kinase DDB_G0282963 | 8.85e-05 | NA | 2.91e-08 | NA |
| 7. B | Q9LP24 | Probable leucine-rich repeat receptor-like protein kinase At1g35710 | 1.41e-05 | NA | 1.28e-07 | NA |
| 7. B | P06494 | Receptor tyrosine-protein kinase erbB-2 | 5.75e-04 | NA | 3.24e-10 | NA |
| 7. B | Q61036 | Serine/threonine-protein kinase PAK 3 | 3.91e-07 | NA | 5.40e-12 | NA |
| 7. B | Q16566 | Calcium/calmodulin-dependent protein kinase type IV | 2.21e-10 | NA | 7.71e-16 | NA |
| 7. B | Q9WUD9 | Proto-oncogene tyrosine-protein kinase Src | 1.10e-10 | NA | 1.92e-07 | NA |
| 7. B | Q7XIW5 | CBL-interacting protein kinase 29 | 1.17e-08 | NA | 4.14e-16 | NA |
| 7. B | P46734 | Dual specificity mitogen-activated protein kinase kinase 3 | 4.26e-10 | NA | 8.65e-13 | NA |
| 7. B | Q62070 | Serine/threonine-protein kinase pim-2 | 8.53e-13 | NA | 1.12e-08 | NA |
| 7. B | Q5A6T5 | Serine/threonine-protein kinase STE7 homolog | 9.78e-08 | NA | 3.47e-08 | NA |
| 7. B | P35465 | Serine/threonine-protein kinase PAK 1 | 2.55e-07 | NA | 1.36e-12 | NA |
| 7. B | Q8S9D1 | Pentatricopeptide repeat-containing protein At5g21222 | 3.31e-06 | NA | 2.07e-14 | NA |
| 7. B | Q9ZPS9 | Serine/threonine-protein kinase BRI1-like 2 | 2.52e-02 | NA | 1.17e-12 | NA |
| 7. B | Q9C5S9 | Cysteine-rich receptor-like protein kinase 6 | 6.24e-05 | NA | 4.12e-08 | NA |
| 7. B | Q9STF0 | Receptor like protein kinase S.3 | 1.65e-07 | NA | 1.25e-05 | NA |
| 7. B | Q8K0D0 | Cyclin-dependent kinase 17 | 6.62e-12 | NA | 5.72e-12 | NA |