Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54692.1
JCVISYN3A_0270
tRNA (N6-adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase.
M. mycoides homolog: Q6MTT4.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 23
Unique PROST Go: 2
Unique BLAST Go: 17
Unique Foldseek Go: 0
Total Homologs: 23
Unique PROST Homologs: 0
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 0
Literature
Danchin and Fang [1]: subunit of N(6)-threonylcarbamoyladenosine (t(6)A) modification at position 37 of ANN-decoding tRNAs|acts together with TsaD and YeaZ(TsaB) "equivalog"; short-lived L-threonylcarbamoyladenylate (TCA) is synthesized by TsaC and TsaBDE cooperate to transfer the L-threonylcarbamoyl-moiety from TCA onto adenosine at position 37 of substrate tRNA
Yang and Tsui [2]: NA
Antczak et al. [3]: ATPase, YjeE family
Zhang et al. [4]: GO:0002949|tRNA threonylcarbamoyladenosine modification
Bianchi et al. [5]: NA
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q1RGZ7
(tRNA threonylcarbamoyladenosine biosynthesis protein TsaE) with a FATCAT P-Value: 1.11e-16 and RMSD of 1.67 angstrom. The sequence alignment identity is 34.9%.
Structural alignment shown in left. Query protein AVX54692.1 colored as red in alignment, homolog Q1RGZ7 colored as blue.
Query protein AVX54692.1 is also shown in right top, homolog Q1RGZ7 showed in right bottom. They are colored based on secondary structures.
AVX54692.1 MKVKVNN---L---EQTYKIAKKIKKIIQNQKIPFYILLKGDLGAGKTTFTKALLEQFNIKDN--ITSPSFVIMNQYFIDDLKINHMDAYRLNNDSEI-E 91 Q1RGZ7 MQM-LNSQTILNSEEETKNFAKAFAATLKPNNI---VLLNGDLGVGKTFFCREIIKYF-CGENTSIISPTFNLLQTYKTPHFTIYHCDLYRLKSPEEIYE 95 AVX54692.1 MYLDEFLDG-LNIIEWYENL-DLDLNAINKLI-IEIKIIDENQRLFFI-GE- 138 Q1RGZ7 LGLEEALSGNLTLIEWSEIIKHL-LP--TPLIEVNLKLLDDDKRLCNITNEY 144
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0002949 | tRNA threonylcarbamoyladenosine modification |
| 1. PBF | GO:0046872 | metal ion binding |
| 5. P | GO:0046777 | protein autophosphorylation |
| 5. P | GO:0043531 | ADP binding |
| 7. B | GO:0005875 | microtubule associated complex |
| 7. B | GO:0008569 | minus-end-directed microtubule motor activity |
| 7. B | GO:0005868 | cytoplasmic dynein complex |
| 7. B | GO:0030286 | dynein complex |
| 7. B | GO:0072382 | minus-end-directed vesicle transport along microtubule |
| 7. B | GO:0007097 | nuclear migration |
| 7. B | GO:0051293 | establishment of spindle localization |
| 7. B | GO:0005881 | cytoplasmic microtubule |
| 7. B | GO:0003777 | microtubule motor activity |
| 7. B | GO:0031122 | cytoplasmic microtubule organization |
| 7. B | GO:0044206 | UMP salvage |
| 7. B | GO:0007018 | microtubule-based movement |
| 7. B | GO:0016773 | phosphotransferase activity, alcohol group as acceptor |
| 7. B | GO:0051959 | dynein light intermediate chain binding |
| 7. B | GO:0004849 | uridine kinase activity |
| 7. B | GO:0045505 | dynein intermediate chain binding |
| 7. B | GO:0044211 | CTP salvage |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0005737 | cytoplasm |
| GO:0002949 | tRNA threonylcarbamoyladenosine modification |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | O51204 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 2.15e-14 | 4.31e-48 | 2.48e-07 | 0.8107 |
| 1. PBF | Q92JQ4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 5.11e-15 | 1.14e-08 | 8.77e-13 | 0.833 |
| 1. PBF | O86788 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 3.85e-12 | 1.59e-12 | 1.28e-13 | 0.7541 |
| 1. PBF | Q68XZ1 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.78e-15 | 1.18e-42 | 7.31e-13 | 0.8343 |
| 1. PBF | Q1RGZ7 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.11e-16 | 1.88e-48 | 7.80e-13 | 0.8423 |
| 1. PBF | Q9ZED0 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 4.44e-16 | 1.53e-42 | 1.59e-12 | 0.8155 |
| 1. PBF | P74415 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.62e-13 | 1.64e-38 | 7.79e-13 | 0.8103 |
| 1. PBF | P44492 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 6.66e-16 | 3.65e-36 | 9.54e-12 | 0.8387 |
| 1. PBF | O83845 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 2.66e-15 | 5.10e-47 | 6.71e-13 | 0.8012 |
| 1. PBF | O67011 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.44e-15 | 2.19e-47 | 2.39e-18 | 0.8389 |
| 1. PBF | P0AF69 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.78e-15 | 2.06e-36 | 9.99e-15 | 0.7707 |
| 1. PBF | P0AF68 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.11e-15 | 2.06e-36 | 9.99e-15 | 0.8157 |
| 1. PBF | O52749 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.99e-13 | 3.84e-34 | 6.19e-13 | 0.8256 |
| 1. PBF | O05515 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 7.35e-14 | 7.90e-32 | 1.69e-16 | 0.8569 |
| 1. PBF | Q49864 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 3.84e-12 | 1.79e-40 | 1.80e-04 | 0.7842 |
| 1. PBF | Q4UNJ0 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 2.44e-15 | 1.26e-11 | 4.83e-16 | 0.8345 |
| 1. PBF | P9WFS6 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 3.16e-12 | 1.46e-28 | 6.14e-05 | 0.7902 |
| 1. PBF | P67172 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 7.36e-12 | 1.46e-28 | 6.14e-05 | 0.7996 |
| 4. PB | P0AF67 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 1.78e-15 | 2.06e-36 | 9.99e-15 | NA |
| 4. PB | P9WFS7 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE | 7.68e-12 | 1.46e-28 | 6.14e-05 | NA |
| 7. B | B1AIX1 | Uridine kinase | 3.61e-03 | NA | 0.048 | NA |
| 7. B | Q8IBG1 | Dynein heavy chain-like protein | NA | NA | 0.022 | NA |
| 7. B | Q9PQF9 | Uridine kinase | 3.33e-03 | NA | 0.048 | NA |