Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54696.1
JCVISYN3A_0283

Double-stranded RNA binding RNase HI.
M. mycoides homolog: Q6MTR8.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 17
Unique PROST Go: 3
Unique BLAST Go: 0
Unique Foldseek Go: 4

Total Homologs: 340
Unique PROST Homologs: 0
Unique BLAST Homologs: 4
Unique Foldseek Homologs: 248

Literature

Danchin and Fang [1]: Rnase H-like |removal of ribonucleotide in DNA
Yang and Tsui [2]: Ribonuclease H-related protein A
Antczak et al. [3]: Ribonuclease HI
Zhang et al. [4]: GO:0043137|DNA replication, removal of RNA primer
Bianchi et al. [5]: Ribonuclease H(I)-like

Structures and Sequence Alignment

The best structural homolog that predicted by 3. BF was B7VB62 (Ribonuclease H) with a FATCAT P-Value: 7.8e-12 and RMSD of 2.58 angstrom. The sequence alignment identity is 19.6%.
Structural alignment shown in left. Query protein AVX54696.1 colored as red in alignment, homolog B7VB62 colored as blue. Query protein AVX54696.1 is also shown in right top, homolog B7VB62 showed in right bottom. They are colored based on secondary structures.

  AVX54696.1 MSKKYYAIKKGLKPGIYTTWDEAKKQVENYSNAVYKSFSTLKEAEDFLNDSNKQSDNLNSDKNSCIAYTDGSY--NTLDNTFSYGVVVFWKNREFHL-SQ 97
      B7VB62 ----------------------------------------------------------MTDKEQVVIYTDGACKGN--PGRGGWGALLLYKGAERELWGG 40

  AVX54696.1 RFDNQNISSLRNVAG-EVL-AVKQTIMFCVANKIKKVLICH-DY--QGVSKWALDQWKANLDF-T--KE-YK--EFFNKYKNQV---EVEFKWIKSHTNN 183
      B7VB62 EPDTTN-NRMELMAAIQALAALKRS---C---PIR--LITDSEYVMRGITEW-LPNWKKR-GWKTASKQPVKNADLWQALDEQVARHQVEWQWVRGHTGD 129

  AVX54696.1 KYNDLADKLAKNASLEFVLKEV-- 205
      B7VB62 PGNERADQLA-NRGVA----ELPR 148

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0004523 RNA-DNA hybrid ribonuclease activity
1. PBF GO:0043137 DNA replication, removal of RNA primer
1. PBF GO:0006401 RNA catabolic process
1. PBF GO:0003676 nucleic acid binding
1. PBF GO:0000287 magnesium ion binding
1. PBF GO:0090502 RNA phosphodiester bond hydrolysis, endonucleolytic
2. PF GO:0005634 nucleus
3. BF GO:0005737 cytoplasm
4. PB GO:0006264 mitochondrial DNA replication
4. PB GO:1990505 mitotic DNA replication maintenance of fidelity
5. P GO:0004527 exonuclease activity
5. P GO:0004540 ribonuclease activity
5. P GO:0042802 identical protein binding
6. F GO:0005576 extracellular region
6. F GO:0003677 DNA binding
6. F GO:0046872 metal ion binding
6. F GO:0003964 RNA-directed DNA polymerase activity

Uniprot GO Annotations

GO Description
GO:0090305 nucleic acid phosphodiester bond hydrolysis
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0005737 cytoplasm
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0003676 nucleic acid binding
GO:0016787 hydrolase activity
GO:0090502 RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0046872 metal ion binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9KEI9 Ribonuclease H 2.73e-07 4.70e-27 2.83e-05 0.4119
1. PBF Q2LWY9 Ribonuclease H 1.18e-10 9.54e-03 0.006 0.6677
2. PF P54164 Uncharacterized protein YpeP 3.35e-06 1.47e-08 NA 0.5223
2. PF Q9HSF6 Ribonuclease HI 1.32e-07 2.38e-08 NA 0.7832
3. BF Q88FF5 Ribonuclease HI 9.97e-11 NA 0.019 0.6812
3. BF B1XD78 Ribonuclease H 5.39e-09 NA 0.010 0.66
3. BF A6V705 Ribonuclease H 1.06e-11 NA 2.92e-04 0.7044
3. BF Q73I74 Ribonuclease H 2.68e-10 NA 2.26e-04 0.7228
3. BF Q8GF77 Ribonuclease H 3.97e-10 NA 0.011 0.7174
3. BF A7MI34 Ribonuclease H 4.82e-09 NA 5.43e-04 0.6431
3. BF A5W169 Ribonuclease H 9.56e-11 NA 0.019 0.6813
3. BF Q9KPX8 Ribonuclease HI 2.37e-10 NA 1.23e-04 0.6835
3. BF Q32JP9 Ribonuclease H 5.35e-09 NA 0.010 0.6764
3. BF C0R2X2 Ribonuclease H 2.63e-10 NA 5.09e-04 0.7223
3. BF C6DC65 Ribonuclease H 3.07e-10 NA 0.033 0.7243
3. BF B7MQ23 Ribonuclease H 5.55e-09 NA 0.010 0.6761
3. BF Q5E3G5 Ribonuclease H 8.90e-10 NA 8.91e-05 0.6729
3. BF B7LW89 Ribonuclease H 5.51e-09 NA 0.010 0.6762
3. BF B1LHM3 Ribonuclease H 5.40e-09 NA 0.010 0.6762
3. BF Q14IN1 Ribonuclease H 1.10e-11 NA 2.71e-05 0.6845
3. BF P0A7Y7 Ribonuclease HI 5.22e-09 NA 0.010 0.6763
3. BF A4IYE6 Ribonuclease H 1.72e-11 NA 2.71e-05 0.6841
3. BF B1JBN1 Ribonuclease H 1.49e-10 NA 0.002 0.7109
3. BF B4EUG3 Ribonuclease H 6.21e-10 NA 0.003 0.7339
3. BF B2SFV9 Ribonuclease H 2.25e-11 NA 2.71e-05 0.692
3. BF P0A7Y6 Ribonuclease HI 5.17e-09 NA 0.010 0.6762
3. BF A5F633 Ribonuclease H 2.40e-10 NA 1.23e-04 0.7107
3. BF Q65S82 Ribonuclease H 1.28e-09 NA 5.49e-04 0.6995
3. BF B7LHC0 Ribonuclease H 5.34e-09 NA 0.007 0.6765
3. BF Q3IIS1 Ribonuclease H 5.95e-11 NA 3.60e-05 0.722
3. BF B0TZ91 Ribonuclease H 2.22e-11 NA 5.91e-04 0.6899
3. BF A7HQX4 Ribonuclease H 2.74e-10 NA 0.005 0.6566
3. BF Q87MG2 Ribonuclease HI 1.74e-10 NA 0.002 0.7237
3. BF B7VB62 Ribonuclease H 7.80e-12 NA 3.58e-04 0.7043
3. BF B7VIP1 Ribonuclease H 2.32e-10 NA 0.005 0.6813
3. BF B5Z0I8 Ribonuclease H 5.71e-09 NA 0.010 0.6761
3. BF Q9I2S9 Ribonuclease HI 1.10e-11 NA 3.58e-04 0.7042
3. BF A7MY21 Ribonuclease H 1.89e-10 NA 0.013 0.7179
3. BF B6HZS7 Ribonuclease H 5.42e-09 NA 0.010 0.6598
3. BF A6T512 Ribonuclease H 5.03e-09 NA 0.021 0.6761
3. BF Q5FG88 Ribonuclease H 2.67e-10 NA 0.009 0.7105
3. BF P0A7Y5 Ribonuclease HI 5.39e-09 NA 0.010 0.6762
3. BF Q0BMB7 Ribonuclease H 1.45e-11 NA 2.71e-05 0.6841
3. BF A4XU11 Ribonuclease H 1.26e-10 NA 0.014 0.7022
3. BF B0KN00 Ribonuclease H 9.15e-11 NA 0.019 0.6808
3. BF Q7NYL8 Ribonuclease H 7.73e-11 NA 1.55e-05 0.7334
3. BF B1IPU4 Ribonuclease H 5.49e-09 NA 0.010 0.6758
3. BF A0Q6W0 Ribonuclease H 1.92e-11 NA 2.71e-05 0.692
3. BF A1S6T0 Ribonuclease H 1.52e-10 NA 0.011 0.639
3. BF Q02KV8 Ribonuclease H 9.65e-12 NA 3.58e-04 0.7045
3. BF Q3Z5E9 Ribonuclease H 5.30e-09 NA 0.010 0.6763
3. BF O69014 Ribonuclease H 9.86e-10 NA 0.044 0.6536
3. BF A7ZHV1 Ribonuclease H 5.51e-09 NA 0.010 0.6762
3. BF Q5F7K9 Ribonuclease H 5.17e-11 NA 0.023 0.7459
3. BF Q325T2 Ribonuclease H 5.52e-09 NA 0.010 0.6759
3. BF Q55801 Ribonuclease HI 2.22e-09 NA 0.003 0.688
3. BF Q7MII6 Ribonuclease H 3.12e-10 NA 0.002 0.6879
3. BF Q0BQX7 Ribonuclease H 1.02e-10 NA 0.004 0.7014
3. BF Q5PBQ8 Ribonuclease H 1.78e-09 NA 0.002 0.6314
3. BF B7NKW4 Ribonuclease H 5.44e-09 NA 0.010 0.6599
3. BF Q115G0 Ribonuclease H 7.54e-11 NA 0.007 0.7118
3. BF A7GAG3 Ribonuclease H 2.22e-11 NA 0.002 0.6887
3. BF C4ZRV1 Ribonuclease H 5.64e-09 NA 0.010 0.676
3. BF Q07762 Ribonuclease H 1.05e-06 NA 4.73e-09 0.5084
3. BF C4LC60 Ribonuclease H 5.62e-11 NA 0.007 0.7102
3. BF Q5QZL3 Ribonuclease H 1.59e-10 NA 1.32e-06 0.6854
3. BF Q12MM4 Ribonuclease H 1.99e-10 NA 2.29e-04 0.6554
3. BF C3LPN8 Ribonuclease H 2.59e-10 NA 1.23e-04 0.7103
3. BF Q2A3X6 Ribonuclease H 2.55e-11 NA 2.71e-05 0.6939
3. BF A7FR34 Ribonuclease H 3.00e-11 NA 0.002 0.6878
3. BF B7JVG1 Ribonuclease H 1.82e-10 NA 1.72e-06 0.7018
3. BF A4J7B3 Ribonuclease H 6.86e-11 NA 0.012 0.6824
3. BF B2U352 Ribonuclease H 5.32e-09 NA 0.010 0.6601
3. BF B7M213 Ribonuclease H 5.06e-09 NA 0.010 0.6762
3. BF Q8DBD5 Ribonuclease HI 3.29e-10 NA 0.002 0.6882
3. BF B7N876 Ribonuclease H 5.48e-09 NA 0.010 0.6601
3. BF B6EJV2 Ribonuclease H 9.41e-10 NA 1.77e-04 0.6436
3. BF A7ZWF6 Ribonuclease H 5.38e-09 NA 0.007 0.6758
3. BF B7MBJ0 Ribonuclease H 5.50e-09 NA 0.010 0.6763
3. BF Q15TA7 Ribonuclease H 8.23e-11 NA 0.014 0.7158
3. BF Q7N807 Ribonuclease H 5.55e-10 NA 0.018 0.6978
3. BF A7NBM9 Ribonuclease H 2.24e-11 NA 2.71e-05 0.6841
3. BF B0TRM1 Ribonuclease H 4.25e-10 NA 0.005 0.6754
4. PB Q9UST8 Ribonuclease H 3.67e-07 1.17e-14 5.10e-06 NA
4. PB Q5BK46 Ribonuclease H1 1.91e-07 3.26e-15 1.24e-05 NA
4. PB O60930 Ribonuclease H1 6.09e-09 1.68e-12 9.98e-05 NA
4. PB O70338 Ribonuclease H1 1.85e-07 9.05e-12 3.74e-07 NA
4. PB Q04740 Ribonuclease H 7.14e-07 3.02e-06 2.73e-08 NA
6. F A6QCI9 Ribonuclease H 2.17e-10 NA NA 0.6764
6. F B5EMD8 Ribonuclease H 3.86e-10 NA NA 0.6915
6. F A3MZE1 Ribonuclease H 4.64e-10 NA NA 0.7298
6. F Q57SZ6 Ribonuclease H 4.89e-09 NA NA 0.6813
6. F A8LLC1 Ribonuclease H 4.31e-09 NA NA 0.6211
6. F Q82XV8 Ribonuclease H 1.73e-09 NA NA 0.6722
6. F A5IBM5 Ribonuclease H 1.95e-11 NA NA 0.726
6. F P36921 Putative hydrolase EbsB 4.14e-09 NA NA 0.7995
6. F Q01RW8 Ribonuclease H 1.99e-10 NA NA 0.7106
6. F Q2YMI3 Ribonuclease H 1.50e-10 NA NA 0.6283
6. F Q31H49 Ribonuclease H 1.15e-10 NA NA 0.6774
6. F A9R0G0 Ribonuclease H 4.46e-09 NA NA 0.6857
6. F Q8D3D3 Ribonuclease H 6.89e-10 NA NA 0.6051
6. F A4Z216 Ribonuclease H 5.45e-10 NA NA 0.685
6. F Q1CTK9 Ribonuclease H 5.44e-10 NA NA 0.7413
6. F B5FJ58 Ribonuclease H 5.34e-09 NA NA 0.6814
6. F B8E599 Ribonuclease H 1.39e-10 NA NA 0.6889
6. F A3D440 Ribonuclease H 1.40e-10 NA NA 0.6922
6. F Q2W9A9 Ribonuclease H 5.81e-11 NA NA 0.7131
6. F Q3SP51 Ribonuclease H 2.29e-10 NA NA 0.682
6. F Q12B88 Ribonuclease H 1.05e-09 NA NA 0.6434
6. F Q5H426 Ribonuclease H 1.78e-10 NA NA 0.6767
6. F A7FFK7 Ribonuclease H 4.22e-10 NA NA 0.7164
6. F Q2GHJ9 Ribonuclease H 4.87e-10 NA NA 0.6892
6. F Q9PBI6 Ribonuclease HI 1.56e-10 NA NA 0.7022
6. F Q87C76 Ribonuclease HI 1.74e-10 NA NA 0.6727
6. F Q5X5I2 Ribonuclease H 2.08e-11 NA NA 0.726
6. F Q2G9E3 Ribonuclease H 6.20e-11 NA NA 0.7462
6. F Q74BH0 Ribonuclease H 4.64e-11 NA NA 0.6975
6. F Q3SIB2 Ribonuclease H 1.01e-10 NA NA 0.7248
6. F A8GA77 Ribonuclease H 4.58e-09 NA NA 0.6826
6. F Q8RA67 Ribonuclease H 2.46e-10 NA NA 0.6846
6. F Q2ND39 Ribonuclease H 5.38e-11 NA NA 0.6962
6. F Q4KBI1 Ribonuclease H 2.05e-09 NA NA 0.7118
6. F P66674 Ribonuclease HI 1.47e-10 NA NA 0.636
6. F A9NB52 Ribonuclease H 5.31e-11 NA NA 0.6948
6. F A1B840 Ribonuclease H 3.18e-09 NA NA 0.6271
6. F A4SXM6 Ribonuclease H 1.19e-10 NA NA 0.7261
6. F A1W1N8 Ribonuclease H 4.92e-10 NA NA 0.6676
6. F A5VP47 Ribonuclease H 1.56e-10 NA NA 0.6329
6. F B0T025 Ribonuclease H 8.37e-11 NA NA 0.7341
6. F A8FNU8 Ribonuclease H 4.79e-10 NA NA 0.668
6. F Q2NVF9 Ribonuclease H 6.89e-10 NA NA 0.7058
6. F Q2RKU0 Ribonuclease H 1.05e-10 NA NA 0.7159
6. F B4TK85 Ribonuclease H 4.84e-09 NA NA 0.6812
6. F Q2RPU6 Ribonuclease H 6.13e-10 NA NA 0.648
6. F Q5WWW5 Ribonuclease H 2.02e-11 NA NA 0.7265
6. F Q83EK3 Ribonuclease H 6.03e-11 NA NA 0.702
6. F Q2SJ45 Ribonuclease H 1.34e-09 NA NA 0.714
6. F A1URX4 Ribonuclease H 1.28e-09 NA NA 0.675
6. F Q1RJL7 Ribonuclease H 3.70e-10 NA NA 0.6468
6. F A1RK75 Ribonuclease H 2.89e-10 NA NA 0.6902
6. F P59434 Ribonuclease H 4.54e-10 NA NA 0.7114
6. F Q4ZVL1 Ribonuclease H 1.68e-09 NA NA 0.6997
6. F Q0VQ76 Ribonuclease H 1.10e-10 NA NA 0.6736
6. F B7J4E2 Ribonuclease H 3.33e-10 NA NA 0.6681
6. F A6U6V5 Ribonuclease H 3.13e-10 NA NA 0.655
6. F Q9A341 Ribonuclease HI 3.57e-10 NA NA 0.725
6. F B7UJB0 Ribonuclease H 4.80e-09 NA NA 0.6765
6. F Q5NYP6 Ribonuclease H 2.83e-10 NA NA 0.7302
6. F A9L0F2 Ribonuclease H 3.14e-10 NA NA 0.6886
6. F Q0A753 Ribonuclease H 4.11e-11 NA NA 0.6961
6. F Q0K8W6 Ribonuclease H 5.92e-11 NA NA 0.7211
6. F A6WMW8 Ribonuclease H 1.33e-10 NA NA 0.689
6. F Q9ZCK3 Ribonuclease HI 2.87e-10 NA NA 0.6697
6. F A8F2L0 Ribonuclease H 3.91e-10 NA NA 0.6768
6. F Q68W20 Ribonuclease H 4.32e-10 NA NA 0.675
6. F P43807 Ribonuclease HI 1.58e-10 NA NA 0.7109
6. F B3QM41 Ribonuclease H 3.05e-11 NA NA 0.7161
6. F Q16AK0 Ribonuclease H 1.81e-09 NA NA 0.6396
6. F Q2KBL2 Ribonuclease H 2.38e-10 NA NA 0.6396
6. F Q4UN27 Ribonuclease H 3.06e-10 NA NA 0.6776
6. F Q9PM39 Ribonuclease HI 4.90e-10 NA NA 0.6677
6. F A9MZ19 Ribonuclease H 4.71e-09 NA NA 0.6815
6. F A6VMP9 Ribonuclease H 5.54e-10 NA NA 0.6833
6. F Q0TLC3 Ribonuclease H 5.45e-09 NA NA 0.6758
6. F Q28V43 Ribonuclease H 1.26e-08 NA NA 0.6319
6. F B0CKG2 Ribonuclease H 2.45e-10 NA NA 0.6312
6. F Q7VM15 Ribonuclease HI 4.87e-10 NA NA 0.6997
6. F Q5FUH9 Ribonuclease H 1.26e-10 NA NA 0.6593
6. F Q67K93 Ribonuclease H 9.04e-11 NA NA 0.6979
6. F A0KXS6 Ribonuclease H 1.69e-10 NA NA 0.7141
6. F A9KGQ0 Ribonuclease H 4.85e-11 NA NA 0.7072
6. F Q0AE34 Ribonuclease H 2.90e-10 NA NA 0.6706
6. F A5FZ26 Ribonuclease H 6.98e-10 NA NA 0.6268
6. F A4SPI4 Ribonuclease H 7.68e-11 NA NA 0.7391
6. F Q11KC5 Ribonuclease H 1.59e-09 NA NA 0.6345
6. F Q0HUI2 Ribonuclease H 1.65e-10 NA NA 0.7164
6. F Q6G0C8 Ribonuclease H 3.99e-10 NA NA 0.7249
6. F A5G5F6 Ribonuclease H 1.44e-10 NA NA 0.7216
6. F A1TQI7 Ribonuclease H 3.14e-10 NA NA 0.6728
6. F Q39X47 Ribonuclease H 1.68e-11 NA NA 0.699
6. F B3EMT1 Ribonuclease H 6.23e-11 NA NA 0.7163
6. F Q2P6Y2 Ribonuclease H 1.76e-10 NA NA 0.6766
6. F B8DIU7 Ribonuclease H 6.43e-11 NA NA 0.69
6. F Q6G4C3 Ribonuclease H 3.04e-10 NA NA 0.661
6. F B5R5L3 Ribonuclease H 4.81e-09 NA NA 0.6817
6. F A5CEP5 Ribonuclease H 5.47e-10 NA NA 0.6753
6. F P64956 Uncharacterized protein Mb2253c 1.17e-06 NA NA 0.6899
6. F P0A2C0 Ribonuclease HI 4.84e-09 NA NA 0.6817
6. F A0KIK4 Ribonuclease H 8.21e-11 NA NA 0.7406
6. F Q0AV47 Ribonuclease H 2.94e-10 NA NA 0.6761
6. F Q3B2H0 Ribonuclease H 3.78e-11 NA NA 0.72
6. F Q73K21 Ribonuclease H 1.72e-09 NA NA 0.6307
6. F Q5HSF7 Ribonuclease H 4.86e-10 NA NA 0.6886
6. F Q7UF86 Ribonuclease H 4.29e-10 NA NA 0.6866
6. F B1JR46 Ribonuclease H 4.39e-10 NA NA 0.7163
6. F Q081L4 Ribonuclease H 1.97e-10 NA NA 0.6536
6. F A9MPF1 Ribonuclease H 4.71e-09 NA NA 0.6816
6. F Q17XJ7 Ribonuclease H 5.26e-10 NA NA 0.7508
6. F Q60AW8 Ribonuclease H 4.44e-11 NA NA 0.6762
6. F Q8I7P9 Retrovirus-related Pol polyprotein from transposon opus 1.31e-01 NA NA 0.5928
6. F Q5LNJ2 Ribonuclease H 3.55e-09 NA NA 0.6405
6. F Q1MKH6 Ribonuclease H 2.17e-10 NA NA 0.6771
6. F A9W185 Ribonuclease H 3.74e-08 NA NA 0.7188
6. F A1JKB1 Ribonuclease H 4.95e-09 NA NA 0.6856
6. F B6JJ39 Ribonuclease H 7.94e-11 NA NA 0.6879
6. F P54162 14.7 kDa ribonuclease H-like protein 1.89e-11 NA NA 0.797
6. F A8FUS8 Ribonuclease H 5.31e-10 NA NA 0.7121
6. F P0A2B9 Ribonuclease HI 4.94e-09 NA NA 0.6813
6. F Q72E89 Ribonuclease H 7.70e-11 NA NA 0.6912
6. F Q92GL5 Ribonuclease HI 4.74e-10 NA NA 0.6763
6. F B3EH35 Ribonuclease H 5.15e-11 NA NA 0.6872
6. F B6J5V1 Ribonuclease H 1.84e-10 NA NA 0.7095
6. F Q3YR62 Ribonuclease H 2.54e-10 NA NA 0.6984
6. F A7H185 Ribonuclease H 1.24e-10 NA NA 0.7077
6. F C5BEV5 Ribonuclease H 2.42e-09 NA NA 0.6868
6. F Q5PFD8 Ribonuclease H 5.20e-09 NA NA 0.6811
6. F A8EXT7 Ribonuclease H 4.10e-10 NA NA 0.6465
6. F A4Y6C1 Ribonuclease H 2.80e-10 NA NA 0.6887
6. F B8HPS9 Ribonuclease H 1.15e-08 NA NA 0.6781
6. F Q9JTD9 Ribonuclease HI 3.95e-11 NA NA 0.7279
6. F A4G7G3 Ribonuclease H 1.01e-10 NA NA 0.7346
6. F A6WWG8 Ribonuclease H 1.82e-10 NA NA 0.6408
6. F B2KAC9 Ribonuclease H 4.78e-09 NA NA 0.6859
6. F Q1LL89 Ribonuclease H 4.49e-11 NA NA 0.7092
6. F B0K1A7 Ribonuclease H 7.59e-10 NA NA 0.6859
6. F Q87YT0 Ribonuclease HI 2.49e-09 NA NA 0.6992
6. F Q08885 Ribonuclease H 9.78e-10 NA NA 0.6871
6. F F9VN79 Ribonuclease HI 6.45e-11 NA NA 0.8411
6. F P56120 Ribonuclease HI 7.92e-10 NA NA 0.7501
6. F A1W6Q8 Ribonuclease H 2.59e-10 NA NA 0.7029
6. F Q1H190 Ribonuclease H 5.98e-11 NA NA 0.7107
6. F Q8PBX8 Ribonuclease H 1.98e-10 NA NA 0.6764
6. F A0R3Q8 Ribonuclease H 1.53e-10 NA NA 0.679
6. F Q4QP49 Ribonuclease H 6.00e-10 NA NA 0.6836
6. F P9WLH4 Uncharacterized protein MT2287 1.04e-06 NA NA 0.6735
6. F A0LGJ7 Ribonuclease H 2.28e-10 NA NA 0.693
6. F A1AW38 Ribonuclease H 1.58e-10 NA NA 0.7304
6. F A1VMW5 Ribonuclease H 1.08e-09 NA NA 0.6689
6. F B4SV39 Ribonuclease H 4.86e-09 NA NA 0.6813
6. F Q1CFI6 Ribonuclease H 4.12e-10 NA NA 0.7046
6. F Q2KV56 Ribonuclease H 6.04e-11 NA NA 0.7372
6. F A1WXD7 Ribonuclease H 2.66e-11 NA NA 0.715
6. F B5BDW5 Ribonuclease H 5.25e-09 NA NA 0.6812
6. F A1SS86 Ribonuclease H 1.39e-10 NA NA 0.6805
6. F Q493H7 Ribonuclease H 3.05e-09 NA NA 0.6976
6. F Q07705 Ribonuclease H 1.36e-10 NA NA 0.6791
6. F Q6N1Y3 Ribonuclease H 2.42e-10 NA NA 0.6329
6. F A8AKR0 Ribonuclease H 5.01e-09 NA NA 0.6757
6. F Q30X61 Ribonuclease H 4.64e-11 NA NA 0.7303
6. F Q8ZH30 Ribonuclease HI 4.95e-09 NA NA 0.6856
6. F Q1I7T4 Ribonuclease H 5.59e-10 NA NA 0.7045
6. F Q83GM3 Ribonuclease H 4.43e-09 NA NA 0.6387
6. F C0Q6N2 Ribonuclease H 4.94e-09 NA NA 0.6814
6. F Q46Z81 Ribonuclease H 5.10e-11 NA NA 0.7418
6. F Q3J7D4 Ribonuclease H 4.89e-11 NA NA 0.6727
6. F P57813 Ribonuclease HI 9.01e-11 NA NA 0.7137
6. F A4W6V4 Ribonuclease H 3.87e-09 NA NA 0.679
6. F Q1QW64 Ribonuclease H 3.21e-10 NA NA 0.656
6. F A8Z6F7 Ribonuclease H 4.19e-10 NA NA 0.7369
6. F B0K9M0 Ribonuclease H 5.32e-10 NA NA 0.6858
6. F Q5ZVQ7 Ribonuclease H 1.69e-11 NA NA 0.7261
6. F Q48KX6 Ribonuclease H 1.31e-09 NA NA 0.6963
6. F B4TYH0 Ribonuclease H 4.91e-09 NA NA 0.6815
6. F A1KV38 Ribonuclease H 4.93e-11 NA NA 0.7259
6. F A4SFZ9 Ribonuclease H 4.00e-11 NA NA 0.698
6. F A1VFS4 Ribonuclease H 8.15e-11 NA NA 0.6912
6. F A1BE10 Ribonuclease H 4.66e-11 NA NA 0.6968
6. F A1WFG9 Ribonuclease H 9.88e-10 NA NA 0.6626
6. F Q8XZ91 Ribonuclease H 6.40e-11 NA NA 0.7243
6. F Q6D1V7 Ribonuclease H 3.65e-10 NA NA 0.7174
6. F A4VLR0 Ribonuclease H 3.19e-11 NA NA 0.671
6. F B6J1Y7 Ribonuclease H 3.65e-11 NA NA 0.7064
6. F Q2GDA1 Ribonuclease H 1.76e-09 NA NA 0.6995
6. F Q3BWP3 Ribonuclease H 1.79e-10 NA NA 0.703
6. F P66673 Ribonuclease HI 2.14e-10 NA NA 0.6332
6. F Q83HK9 Ribonuclease H 2.48e-09 NA NA 0.651
6. F P29253 Ribonuclease H 1.86e-09 NA NA 0.6539
6. F B5F8X2 Ribonuclease H 4.77e-09 NA NA 0.6815
6. F B2VHJ5 Ribonuclease H 4.61e-09 NA NA 0.6793
6. F A3QET0 Ribonuclease H 4.82e-10 NA NA 0.7212
6. F Q7WCJ8 Ribonuclease H 1.22e-10 NA NA 0.7287
6. F Q9ZLH3 Ribonuclease HI 8.31e-10 NA NA 0.7362
6. F A1U0U9 Ribonuclease H 6.09e-11 NA NA 0.7158
6. F A1AT66 Ribonuclease H 7.49e-10 NA NA 0.7223
6. F A9KLJ9 Ribonuclease H 1.23e-09 NA NA 0.6794
6. F Q0AMI4 Ribonuclease H 2.27e-10 NA NA 0.6961
6. F Q1QH30 Ribonuclease H 1.13e-10 NA NA 0.703
6. F Q89UU3 Ribonuclease H 8.08e-11 NA NA 0.6865
6. F A4FMU3 Ribonuclease H 1.39e-10 NA NA 0.6763
6. F A4WNV1 Ribonuclease H 1.49e-09 NA NA 0.6423
6. F Q3A827 Ribonuclease H 6.63e-11 NA NA 0.7295
6. F B4R8T3 Ribonuclease H 4.24e-10 NA NA 0.6877
6. F A3DD79 Ribonuclease H 1.20e-10 NA NA 0.7052
6. F A5EAL2 Ribonuclease H 4.38e-10 NA NA 0.6873
6. F Q0HI86 Ribonuclease H 1.65e-10 NA NA 0.7161
6. F Q0C3M1 Ribonuclease H 2.58e-10 NA NA 0.7305
6. F Q4URM3 Ribonuclease H 1.98e-10 NA NA 0.7066
6. F Q3KE77 Ribonuclease H 1.40e-09 NA NA 0.678
6. F Q1LT02 Ribonuclease H 7.03e-10 NA NA 0.6653
6. F A5UFU3 Ribonuclease H 5.33e-10 NA NA 0.6836
6. F Q57EP4 Ribonuclease H 1.58e-10 NA NA 0.6333
6. F Q0RJ31 Ribonuclease H 3.92e-10 NA NA 0.635
6. F A4TL54 Ribonuclease H 4.73e-09 NA NA 0.6855
6. F Q131J2 Ribonuclease H 2.51e-10 NA NA 0.6475
6. F Q1CAJ5 Ribonuclease H 4.28e-10 NA NA 0.7044
6. F A9IQR5 Ribonuclease H 2.74e-10 NA NA 0.7031
6. F B8H4W7 Ribonuclease H 3.72e-10 NA NA 0.7251
6. F Q47FN9 Ribonuclease H 1.65e-10 NA NA 0.6874
6. F B5Y1G2 Ribonuclease H 5.04e-09 NA NA 0.6782
6. F A3PMR3 Ribonuclease H 1.97e-09 NA NA 0.652
6. F Q7VQB6 Ribonuclease H 7.96e-09 NA NA 0.6249
6. F Q9JYE5 Ribonuclease HI 4.07e-11 NA NA 0.7277
6. F B5R449 Ribonuclease H 4.89e-09 NA NA 0.6815
6. F Q985W1 Ribonuclease H 1.31e-09 NA NA 0.6665
6. F A4XKQ3 Ribonuclease H 3.26e-11 NA NA 0.6367
6. F Q2Y8K1 Ribonuclease H 1.58e-10 NA NA 0.7102
6. F A6SXA4 Ribonuclease H 7.72e-11 NA NA 0.7425
6. F Q72IE1 Ribonuclease H 1.95e-09 NA NA 0.6436
6. F Q8UHA7 Ribonuclease H 3.01e-10 NA NA 0.7244
6. F B3Q6U1 Ribonuclease H 1.37e-10 NA NA 0.6781
6. F Q667M7 Ribonuclease H 4.18e-10 NA NA 0.7045
6. F B1KHK0 Ribonuclease H 2.49e-10 NA NA 0.7146
6. F Q3APT0 Ribonuclease H 4.32e-11 NA NA 0.6945
6. F P10401 Retrovirus-related Pol polyprotein from transposon gypsy 2.62e-01 NA NA 0.4905
6. F A5EXP9 Ribonuclease H 2.69e-10 NA NA 0.7089
6. F Q92RG0 Ribonuclease H 3.64e-10 NA NA 0.6905
6. F B4S5K2 Ribonuclease H 4.41e-11 NA NA 0.7182
6. F Q8EE30 Ribonuclease HI 1.86e-10 NA NA 0.714
6. F A5CX29 Ribonuclease H 2.47e-10 NA NA 0.6987
6. F Q2J0F8 Ribonuclease H 4.61e-10 NA NA 0.6767
6. F Q7VRX8 Ribonuclease H 1.21e-10 NA NA 0.7265
6. F Q1GDG1 Ribonuclease H 6.69e-09 NA NA 0.638
6. F Q8PNH8 Ribonuclease H 2.05e-10 NA NA 0.6763
6. F Q21YF6 Ribonuclease H 2.56e-10 NA NA 0.6727
6. F A4T6Y5 Ribonuclease H 4.12e-11 NA NA 0.6591
6. F A8GPT6 Ribonuclease H 4.44e-10 NA NA 0.6806
7. B B2S2V0 Ribonuclease H NA NA 5.25e-04 NA
7. B A5HYU6 Ribonuclease H 3.04e-11 NA 0.002 NA
7. B O83372 Ribonuclease H NA NA 5.25e-04 NA
7. B P0A7Y4 Ribonuclease HI 5.37e-09 NA 0.010 NA