Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54697.1

JCVISYN3A_0285

Elongation factor 4.
M. mycoides homolog: Q6MTR6.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 98
Unique PROST Go: 14
Unique BLAST Go: 31
Unique Foldseek Go: 0

Total Homologs: 4288
Unique PROST Homologs: 3
Unique BLAST Homologs: 1868
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: lepA; Elongation factor 4
Zhang et al. [4]: GO:0006414|translational elongation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A4S3R2 (Translation factor GUF1 homolog, mitochondrial) with a FATCAT P-Value: 0 and RMSD of 2.34 angstrom. The sequence alignment identity is 42.4%.
Structural alignment shown in left. Query protein AVX54697.1 colored as red in alignment, homolog A4S3R2 colored as blue. Query protein AVX54697.1 is also shown in right top, homolog A4S3R2 showed in right bottom. They are colored based on secondary structures.

  AVX54697.1 -----------------------------------------------MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKRE-MQDQLLDSMDIERER 52
      A4S3R2 MALRRVLVDRIVRSCAARAFASTSASYASARDALKEERPPTADELAAIPRERTRNFSIIAHVDHGKSTLADRLLELTGAI-KRDGSNKQVLDTLPVERRR 99

  AVX54697.1 GITIKLNSVQLKYHS--KDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKQEIE 150
      A4S3R2 GITVKAQAVSI-LHREPSDGQAYLLNLIDTPGHADFSFEVSRSLSACDGAVMLVDATQGVEAQTIATFYLALDRNLAIVPAANKVDMTSADVERVAKQME 198

  AVX54697.1 EIIGLDCSNAPL-ISAKTGLNVEDVLQAIVERIPSPS-DAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLRVGDKIKLMSTNAEYEVTYLGIKTPKIV 248
      A4S3R2 RAFGVEREDV-LEVSGKTGHNAEKVLSAVVKHVPHPSGD--PNGPLRVLLLDCHYDDYRGAVNIVQVADGVIRKGDKVSSCASGQHFEVLELGMMTPERT 295

  AVX54697.1 KKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLN-PADEPLEGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLG 347
      A4S3R2 KTDAMYAGQVGYMITNVRDVRSSKVGDTL-HMKNEPV-EPLAGIRPAKPMVFQGLYPVNSDDFEKLKAAVSKLTLNDASVTAQTENSTALGAGFRCGFLG 393

  AVX54697.1 LLHMEVIQERLEREYNLELIATAPSVVYKV-HLTNKQIIELDNPALLPEA---QKIAKIEEPFVEIK-IATPSEYIGDLMNLCQNKLG--IYKNMEVIDN 440
      A4S3R2 LLHADVFHQRLQEEFGAEIIATAPTVPYRIKHANDEAYIDCTSPLAIPSGGFPSKGTEIEEPLVEATIICQP-HVVGKVVELCMDRRGEQLEQNF--LDD 490

  AVX54697.1 NRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKV 540
      A4S3R2 SRVILRYRLPLGEVAADFADELKSRSSGYATFDYDDAGMAKSDIVRMDVLVNGSVVDALATLVHRSKAQRHGRDLVARLKEALPRQLYEVALQAALGSKV 590

  AVX54697.1 ISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKKKMKEIGTVEVPQEAFVAIL--KIDD 600
      A4S3R2 IARETISAMRKNVTAKCYGGDISRKKKLLEKQKEGKRRMRRIGNVDIPNETFAGILSNKRN- 651

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0043022	ribosome binding
1. PBF	GO:0032790	ribosome disassembly
1. PBF	GO:0006414	translational elongation
1. PBF	GO:1990904	ribonucleoprotein complex
1. PBF	GO:0005743	mitochondrial inner membrane
1. PBF	GO:0030623	U5 snRNA binding
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0097177	mitochondrial ribosome binding
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0003743	translation initiation factor activity
1. PBF	GO:0005634	nucleus
1. PBF	GO:0071007	U2-type catalytic step 2 spliceosome
1. PBF	GO:0003746	translation elongation factor activity
1. PBF	GO:0070125	mitochondrial translational elongation
1. PBF	GO:0005759	mitochondrial matrix
1. PBF	GO:0045727	positive regulation of translation
1. PBF	GO:0005525	GTP binding
2. PF	GO:0071005	U2-type precatalytic spliceosome
3. BF	GO:0006413	translational initiation
3. BF	GO:0005829	cytosol
4. PB	GO:0032543	mitochondrial translation
4. PB	GO:0071364	cellular response to epidermal growth factor stimulus
4. PB	GO:0003723	RNA binding
4. PB	GO:0014009	glial cell proliferation
4. PB	GO:0006364	rRNA processing
4. PB	GO:0005615	extracellular space
4. PB	GO:0030864	cortical actin cytoskeleton
4. PB	GO:0005853	eukaryotic translation elongation factor 1 complex
4. PB	GO:0042256	mature ribosome assembly
4. PB	GO:0005739	mitochondrion
4. PB	GO:0035368	selenocysteine insertion sequence binding
4. PB	GO:0005524	ATP binding
4. PB	GO:1904714	regulation of chaperone-mediated autophagy
4. PB	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
4. PB	GO:0046540	U4/U6 x U5 tri-snRNP complex
4. PB	GO:0051881	regulation of mitochondrial membrane potential
4. PB	GO:0016259	selenocysteine metabolic process
4. PB	GO:0042802	identical protein binding
4. PB	GO:0005737	cytoplasm
4. PB	GO:0006449	regulation of translational termination
4. PB	GO:0051593	response to folic acid
4. PB	GO:0000287	magnesium ion binding
4. PB	GO:0005576	extracellular region
4. PB	GO:0090218	positive regulation of lipid kinase activity
4. PB	GO:0016150	translation release factor activity, codon nonspecific
4. PB	GO:1900022	regulation of D-erythro-sphingosine kinase activity
4. PB	GO:2000767	positive regulation of cytoplasmic translation
4. PB	GO:0016020	membrane
4. PB	GO:0006415	translational termination
4. PB	GO:0001514	selenocysteine incorporation
4. PB	GO:0016149	translation release factor activity, codon specific
4. PB	GO:0005654	nucleoplasm
4. PB	GO:0019843	rRNA binding
5. P	GO:0070590	spore wall biogenesis
5. P	GO:0042244	spore wall assembly
5. P	GO:0032587	ruffle membrane
5. P	GO:0045694	regulation of embryo sac egg cell differentiation
5. P	GO:0031160	spore wall
5. P	GO:0000002	mitochondrial genome maintenance
5. P	GO:0016235	aggresome
5. P	GO:0000049	tRNA binding
5. P	GO:0070499	exosporium assembly
5. P	GO:0010035	response to inorganic substance
5. P	GO:0010446	response to alkaline pH
5. P	GO:0046677	response to antibiotic
5. P	GO:0098574	cytoplasmic side of lysosomal membrane
5. P	GO:0034301	endospore formation
7. B	GO:0008135	translation factor activity, RNA binding
7. B	GO:0009986	cell surface
7. B	GO:0016539	intein-mediated protein splicing
7. B	GO:0009535	chloroplast thylakoid membrane
7. B	GO:0042254	ribosome biogenesis
7. B	GO:0004020	adenylylsulfate kinase activity
7. B	GO:0003747	translation release factor activity
7. B	GO:0045903	positive regulation of translational fidelity
7. B	GO:0004781	sulfate adenylyltransferase (ATP) activity
7. B	GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
7. B	GO:0001731	formation of translation preinitiation complex
7. B	GO:0046872	metal ion binding
7. B	GO:0043231	intracellular membrane-bounded organelle
7. B	GO:0020011	apicoplast
7. B	GO:0000103	sulfate assimilation
7. B	GO:0006412	translation
7. B	GO:0070814	hydrogen sulfide biosynthetic process
7. B	GO:0043024	ribosomal small subunit binding
7. B	GO:0008270	zinc ion binding
7. B	GO:0007165	signal transduction
7. B	GO:0048471	perinuclear region of cytoplasm
7. B	GO:0097216	guanosine tetraphosphate binding
7. B	GO:0006314	intron homing
7. B	GO:0005850	eukaryotic translation initiation factor 2 complex
7. B	GO:0006790	sulfur compound metabolic process
7. B	GO:0002182	cytoplasmic translational elongation
7. B	GO:1990533	Dom34-Hbs1 complex
7. B	GO:0070124	mitochondrial translational initiation
7. B	GO:0002184	cytoplasmic translational termination
7. B	GO:0007049	cell cycle
7. B	GO:0018444	translation release factor complex

Uniprot GO Annotations

GO	Description
GO:0043022	ribosome binding
GO:0006412	translation
GO:0006414	translational elongation
GO:0005886	plasma membrane
GO:0016787	hydrolase activity
GO:0003924	GTPase activity
GO:0016020	membrane
GO:0045727	positive regulation of translation
GO:0003746	translation elongation factor activity
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	A7ZQ13	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8921
1. PBF	Q8DTF3	Elongation factor 4	0.00e+00	1.60e-66	0.0	0.9898
1. PBF	Q8PUR7	Elongation factor 2	1.79e-13	9.43e-25	1.47e-20	0.6646
1. PBF	Q1QX26	Elongation factor 4	0.00e+00	5.08e-63	0.0	0.9257
1. PBF	Q3K1F9	Elongation factor 4	0.00e+00	8.07e-68	0.0	0.9753
1. PBF	A3MSN3	Elongation factor 2	1.01e-13	1.61e-23	4.72e-20	0.6549
1. PBF	C0RMH8	Elongation factor 4	0.00e+00	4.70e-71	0.0	0.9447
1. PBF	C6DC02	Elongation factor 4	0.00e+00	5.46e-74	0.0	0.9455
1. PBF	C5CCD4	Elongation factor 4	0.00e+00	7.38e-62	0.0	0.9307
1. PBF	Q3J8D2	Elongation factor 4	0.00e+00	2.49e-63	0.0	0.9067
1. PBF	Q11AY3	Elongation factor 4	0.00e+00	6.95e-71	0.0	0.944
1. PBF	A2C0M8	Elongation factor 4	0.00e+00	1.15e-70	0.0	0.9391
1. PBF	B7N6F7	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.897
1. PBF	B2I601	Elongation factor 4	0.00e+00	1.65e-70	0.0	0.9211
1. PBF	O93632	Elongation factor 2	1.97e-13	6.67e-25	5.24e-24	0.6675
1. PBF	Q2A5X6	Elongation factor 4	0.00e+00	5.16e-74	0.0	0.9485
1. PBF	B1ILM7	Elongation factor 4	0.00e+00	3.36e-71	0.0	0.9688
1. PBF	B1X3K4	Translation factor GUF1 homolog, organellar chromatophore	0.00e+00	1.63e-71	0.0	0.9449
1. PBF	A6TCI3	Elongation factor 4	0.00e+00	6.48e-76	0.0	0.944
1. PBF	Q5B6J8	Elongation factor G, mitochondrial	7.33e-14	2.47e-03	3.28e-23	0.6018
1. PBF	Q2GJV7	Elongation factor 4	0.00e+00	1.77e-76	0.0	0.9418
1. PBF	B7PJS6	Translation factor GUF1 homolog, mitochondrial	0.00e+00	8.86e-29	6.30e-177	0.9
1. PBF	Q6A9B2	Elongation factor 4	0.00e+00	8.36e-67	0.0	0.9223
1. PBF	B4UDQ7	Elongation factor 4	0.00e+00	1.88e-69	0.0	0.9492
1. PBF	A5VR09	Elongation factor G	0.00e+00	1.56e-16	1.18e-20	0.6134
1. PBF	A1TLE7	Elongation factor 4	0.00e+00	3.97e-68	0.0	0.9433
1. PBF	Q823H7	Elongation factor 4	0.00e+00	6.68e-69	0.0	0.9503
1. PBF	B6YVG5	Elongation factor 2	1.50e-13	6.95e-22	5.31e-23	0.6486
1. PBF	Q8DPN5	Elongation factor 4	0.00e+00	3.85e-69	0.0	0.9916
1. PBF	Q97JJ6	Elongation factor 4	0.00e+00	7.71e-67	0.0	0.9691
1. PBF	C4K3Z1	Elongation factor 4	0.00e+00	2.32e-73	0.0	0.9421
1. PBF	A0K5V7	Elongation factor 4	0.00e+00	7.24e-68	0.0	0.9537
1. PBF	Q8Y742	Elongation factor 4	0.00e+00	1.58e-72	0.0	0.989
1. PBF	B4S5N0	Elongation factor G	1.67e-15	8.55e-17	3.52e-20	0.6155
1. PBF	C0M8H9	Elongation factor 4	0.00e+00	1.68e-67	0.0	0.9846
1. PBF	A8Z4C4	Elongation factor 4	0.00e+00	1.51e-69	0.0	0.9742
1. PBF	Q88VN0	Elongation factor 4 1	0.00e+00	2.23e-76	0.0	0.9892
1. PBF	A7GHI0	Elongation factor 4	0.00e+00	3.36e-71	0.0	0.9635
1. PBF	B1ZC10	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9502
1. PBF	Q3KHM1	Elongation factor 4	0.00e+00	3.63e-75	0.0	0.9543
1. PBF	A6WYK4	Elongation factor 4	0.00e+00	1.03e-70	0.0	0.947
1. PBF	B3PLG4	Elongation factor 4	0.00e+00	8.09e-75	0.0	0.9498
1. PBF	P60930	Elongation factor 4	0.00e+00	3.24e-67	0.0	0.9513
1. PBF	B8H2Z7	Elongation factor 4	0.00e+00	2.04e-69	0.0	0.9471
1. PBF	A1CHC3	Elongation factor G, mitochondrial	6.34e-14	5.96e-04	9.81e-23	0.6058
1. PBF	Q11HP9	Elongation factor G	0.00e+00	1.40e-14	9.80e-20	0.682
1. PBF	Q6G550	Elongation factor 4	0.00e+00	5.25e-66	0.0	0.9424
1. PBF	Q2JQ51	Elongation factor 4	0.00e+00	1.84e-70	0.0	0.9511
1. PBF	B8DIZ5	Elongation factor 4	0.00e+00	2.46e-74	0.0	0.9659
1. PBF	B9GHA6	Translation factor GUF1 homolog, chloroplastic	0.00e+00	5.70e-19	0.0	0.9438
1. PBF	O83523	Elongation factor 4	0.00e+00	4.94e-69	0.0	0.9683
1. PBF	B0B9H2	Elongation factor 4	0.00e+00	1.39e-70	0.0	0.9411
1. PBF	Q0C5X0	Elongation factor 4	0.00e+00	1.22e-67	0.0	0.9603
1. PBF	B9RHQ5	Translation factor GUF1 homolog, chloroplastic	0.00e+00	2.61e-18	0.0	0.9435
1. PBF	C6BST2	Elongation factor 4	0.00e+00	3.77e-74	0.0	0.9008
1. PBF	Q1H2L5	Elongation factor 4	0.00e+00	8.90e-76	0.0	0.9278
1. PBF	C1F2I3	Elongation factor 4	0.00e+00	2.15e-67	0.0	0.9347
1. PBF	C4K153	Elongation factor 4	0.00e+00	2.48e-64	0.0	0.9512
1. PBF	B7KJX0	Elongation factor 4	0.00e+00	1.94e-70	0.0	0.9345
1. PBF	B9KIE5	Elongation factor 4	0.00e+00	2.28e-71	0.0	0.9488
1. PBF	Q5F9P9	Elongation factor 4	0.00e+00	6.83e-72	0.0	0.9377
1. PBF	A5UFI9	Elongation factor 4	0.00e+00	1.18e-73	0.0	0.9474
1. PBF	Q21IH3	Elongation factor 4	0.00e+00	1.56e-73	0.0	0.9547
1. PBF	B8G6S9	Elongation factor G	5.44e-15	5.69e-16	2.25e-18	0.6055
1. PBF	A6VLV6	Elongation factor 4	0.00e+00	7.86e-75	0.0	0.9444
1. PBF	B1XZN0	Elongation factor 4	0.00e+00	7.46e-69	0.0	0.9312
1. PBF	Q57LC8	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9339
1. PBF	Q4UIN6	Translation factor GUF1 homolog, mitochondrial	0.00e+00	4.32e-15	1.04e-162	0.8929
1. PBF	Q8K9Q9	Elongation factor 4	0.00e+00	7.16e-70	0.0	0.9466
1. PBF	A5FLU8	Elongation factor 4	0.00e+00	1.30e-72	0.0	0.9464
1. PBF	Q2YT42	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9739
1. PBF	C0PYG5	Elongation factor 4	0.00e+00	3.44e-76	0.0	0.8895
1. PBF	C5M6K8	Translation factor GUF1, mitochondrial	0.00e+00	4.72e-31	0.0	0.8851
1. PBF	Q576S5	Elongation factor 4	0.00e+00	5.26e-71	0.0	0.947
1. PBF	A1JKK1	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9419
1. PBF	A5ULM6	Elongation factor 2	4.69e-12	4.10e-21	5.86e-30	0.6636
1. PBF	Q1J6V6	Elongation factor 4	0.00e+00	5.22e-69	0.0	0.9829
1. PBF	Q8YU48	Elongation factor 4	0.00e+00	3.02e-68	0.0	0.9402
1. PBF	Q1QR19	Elongation factor 4	0.00e+00	1.11e-64	0.0	0.9458
1. PBF	B4U6M2	Elongation factor 4	0.00e+00	2.05e-75	0.0	0.9138
1. PBF	Q48TU0	Elongation factor 4	0.00e+00	3.09e-69	0.0	0.9748
1. PBF	B2RLZ4	Elongation factor G	0.00e+00	2.49e-16	4.75e-22	0.631
1. PBF	Q28LR4	Elongation factor 4	0.00e+00	1.90e-68	0.0	0.9486
1. PBF	Q1JH37	Elongation factor 4	0.00e+00	6.77e-70	0.0	0.9878
1. PBF	A3NBT1	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9486
1. PBF	A1D5Z0	Translation factor guf1, mitochondrial	0.00e+00	2.27e-24	2.35e-173	0.9442
1. PBF	B1KI55	Elongation factor 4	0.00e+00	1.24e-73	0.0	0.9422
1. PBF	Q2P4M4	Elongation factor 4	0.00e+00	2.41e-69	0.0	0.9192
1. PBF	C1AQW9	Elongation factor 4	0.00e+00	1.46e-36	0.0	0.9455
1. PBF	Q4L6T4	Elongation factor 4	0.00e+00	4.18e-69	0.0	0.9512
1. PBF	Q9A9F4	Elongation factor 4	0.00e+00	2.63e-65	0.0	0.9525
1. PBF	Q0BRZ7	Elongation factor 4	0.00e+00	2.87e-70	0.0	0.9517
1. PBF	Q3YSC2	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9401
1. PBF	Q8DC78	Elongation factor 4	0.00e+00	2.86e-72	0.0	0.9466
1. PBF	B2G6W5	Elongation factor 4	0.00e+00	6.08e-77	0.0	0.9902
1. PBF	B8I3E6	Elongation factor 4	0.00e+00	1.78e-66	0.0	0.9597
1. PBF	Q5XCD2	Elongation factor 4	0.00e+00	1.55e-69	0.0	0.9793
1. PBF	Q1GRH5	Elongation factor 4	0.00e+00	7.83e-73	0.0	0.9545
1. PBF	Q112D2	Elongation factor 4	0.00e+00	6.61e-73	0.0	0.9297
1. PBF	B5QTV0	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.936
1. PBF	A8GI27	Elongation factor 4	0.00e+00	8.40e-76	0.0	0.9406
1. PBF	B4RK41	Elongation factor 4	0.00e+00	6.83e-72	0.0	0.9341
1. PBF	B7LS46	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6113
1. PBF	Q2NJE6	Elongation factor 4	0.00e+00	1.22e-67	0.0	0.9585
1. PBF	A9MCW5	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9466
1. PBF	Q87XF8	Elongation factor 4	0.00e+00	2.92e-74	0.0	0.9364
1. PBF	B0JQT7	Elongation factor 4	0.00e+00	5.01e-72	0.0	0.9422
1. PBF	Q8YDB8	Elongation factor 4	0.00e+00	4.70e-71	0.0	0.945
1. PBF	Q88MY7	Elongation factor 4	0.00e+00	3.08e-73	0.0	0.9558
1. PBF	Q8ZD74	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9415
1. PBF	A5DG70	Translation factor GUF1, mitochondrial	0.00e+00	2.67e-23	0.0	0.9311
1. PBF	A1S3X9	Elongation factor 4	0.00e+00	7.26e-74	0.0	0.9491
1. PBF	B7M8I2	Elongation factor 4	0.00e+00	1.06e-75	0.0	0.9372
1. PBF	A6RGX9	Translation factor GUF1, mitochondrial	0.00e+00	2.06e-26	1.04e-177	0.9427
1. PBF	Q15R31	Elongation factor 4	0.00e+00	2.68e-67	0.0	0.94
1. PBF	A9WH62	Elongation factor G	6.44e-15	1.06e-15	9.45e-19	0.6129
1. PBF	Q5HFH6	Elongation factor 4	0.00e+00	1.51e-69	0.0	0.9775
1. PBF	B6H2S6	Translation factor guf1, mitochondrial	0.00e+00	2.15e-23	5.56e-176	0.9461
1. PBF	P0A1W5	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.8918
1. PBF	B1LP82	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9356
1. PBF	Q15YA7	Elongation factor G 2	1.78e-15	5.83e-17	1.25e-21	0.6139
1. PBF	B8DE32	Elongation factor 4	0.00e+00	1.58e-72	0.0	0.9889
1. PBF	B3QZT9	Elongation factor 4	0.00e+00	3.24e-64	0.0	0.9467
1. PBF	A9KKU4	Elongation factor 4	0.00e+00	4.42e-69	0.0	0.9727
1. PBF	A6H1S4	Elongation factor 4	0.00e+00	1.63e-72	0.0	0.9459
1. PBF	B5E4T8	Elongation factor 4	0.00e+00	2.62e-69	0.0	0.906
1. PBF	B0S1G2	Elongation factor 4	0.00e+00	1.00e-67	0.0	0.973
1. PBF	B9IY86	Elongation factor 4	0.00e+00	6.68e-69	0.0	0.9866
1. PBF	A4FWF0	Elongation factor 2	2.84e-13	2.36e-20	7.93e-22	0.6727
1. PBF	Q5PNC0	Elongation factor 4	0.00e+00	3.74e-75	0.0	0.9396
1. PBF	Q3SH47	Elongation factor 4	0.00e+00	2.19e-73	0.0	0.9536
1. PBF	Q0TNS2	Elongation factor 4	0.00e+00	4.72e-70	0.0	0.9689
1. PBF	Q0AF67	Elongation factor 4	0.00e+00	2.16e-72	0.0	0.9506
1. PBF	Q5N390	Elongation factor 4	0.00e+00	4.55e-68	0.0	0.9454
1. PBF	A5G4G3	Elongation factor 4	0.00e+00	6.04e-71	0.0	0.9551
1. PBF	C5DWG7	Translation factor GUF1, mitochondrial	0.00e+00	1.02e-37	4.75e-179	0.9413
1. PBF	A8ACA7	Elongation factor 2	4.94e-13	8.61e-21	3.55e-26	0.679
1. PBF	Q5LC85	Elongation factor 4	0.00e+00	5.58e-70	0.0	0.9459
1. PBF	B0XZZ2	Translation factor guf1, mitochondrial	0.00e+00	8.94e-23	1.90e-174	0.9474
1. PBF	A1SSM6	Elongation factor 4	0.00e+00	2.84e-74	0.0	0.9432
1. PBF	Q4QPM8	Elongation factor 4	0.00e+00	1.18e-73	0.0	0.9426
1. PBF	B0SRL4	Elongation factor 4	0.00e+00	6.28e-72	0.0	0.9237
1. PBF	Q8PMV3	Elongation factor 4	0.00e+00	8.36e-67	0.0	0.9145
1. PBF	Q8DM20	Elongation factor 4	0.00e+00	3.65e-73	0.0	0.9354
1. PBF	A9A0N0	Elongation factor 4	0.00e+00	2.90e-67	0.0	0.9343
1. PBF	C5BAI0	Elongation factor 4	0.00e+00	1.70e-74	0.0	0.9429
1. PBF	B2U978	Elongation factor 4	0.00e+00	5.43e-70	0.0	0.9466
1. PBF	Q5M008	Elongation factor 4	0.00e+00	1.21e-70	0.0	0.9899
1. PBF	Q1LTI1	Elongation factor 4	0.00e+00	2.90e-67	0.0	0.9406
1. PBF	A1WAW8	Elongation factor 4	0.00e+00	2.79e-70	0.0	0.934
1. PBF	Q2UGQ2	Elongation factor G, mitochondrial	6.69e-14	5.70e-03	6.70e-23	0.5888
1. PBF	Q0SRD8	Elongation factor 4	0.00e+00	4.99e-70	0.0	0.9702
1. PBF	Q6MTR6	Elongation factor 4	0.00e+00	1.78e-102	0.0	0.9906
1. PBF	B8ENL1	Elongation factor 4	0.00e+00	1.63e-72	0.0	0.9551
1. PBF	A0RIT7	Elongation factor 4	0.00e+00	4.18e-69	0.0	0.9847
1. PBF	A1KT27	Elongation factor 4	0.00e+00	1.23e-71	0.0	0.9302
1. PBF	B0R8C8	Elongation factor 2	1.21e-10	3.33e-23	7.78e-23	0.5732
1. PBF	Q88T65	Elongation factor 4 2	0.00e+00	2.00e-68	1.47e-169	0.9739
1. PBF	A7A0X4	Elongation factor G, mitochondrial	1.67e-15	1.39e-09	5.01e-24	0.6605
1. PBF	A5FR18	Elongation factor 4	0.00e+00	3.24e-63	0.0	0.9259
1. PBF	A8GRF6	Elongation factor 4	0.00e+00	2.83e-64	0.0	0.9491
1. PBF	A7ZSL5	Elongation factor G	1.11e-16	4.73e-19	1.14e-17	0.6049
1. PBF	B0KA85	Elongation factor 4	0.00e+00	1.64e-69	0.0	0.9663
1. PBF	Q7N1X3	Elongation factor 4	0.00e+00	4.33e-76	0.0	0.9411
1. PBF	A9R400	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9314
1. PBF	Q5H1R5	Elongation factor 4	0.00e+00	2.41e-69	0.0	0.9453
1. PBF	Q72E76	Elongation factor 4	0.00e+00	6.07e-73	0.0	0.9543
1. PBF	P0DC22	Elongation factor 4	0.00e+00	1.18e-69	0.0	0.9839
1. PBF	Q2W0F9	Elongation factor 4	0.00e+00	2.64e-70	0.0	0.9476
1. PBF	A6LLL0	Elongation factor G	0.00e+00	1.06e-15	6.29e-21	0.5923
1. PBF	Q1D777	Elongation factor G 2	0.00e+00	9.19e-19	9.10e-22	0.6806
1. PBF	Q73HR8	Elongation factor 4	0.00e+00	4.31e-75	0.0	0.9148
1. PBF	Q1G9R4	Elongation factor 4	0.00e+00	2.28e-69	0.0	0.9631
1. PBF	Q03KW7	Elongation factor 4	0.00e+00	1.21e-70	0.0	0.9915
1. PBF	Q5HBH4	Elongation factor 4	0.00e+00	6.85e-68	0.0	0.9386
1. PBF	A7GT14	Elongation factor 4	0.00e+00	6.68e-69	0.0	0.9811
1. PBF	A4TKY0	Elongation factor 4	0.00e+00	9.70e-76	0.0	0.9374
1. PBF	A5WCD6	Elongation factor 4	0.00e+00	1.28e-73	0.0	0.9553
1. PBF	A8A379	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8921
1. PBF	A0Q1R8	Elongation factor 4	0.00e+00	2.22e-69	0.0	0.9692
1. PBF	Q31R08	Elongation factor 4	0.00e+00	4.84e-73	0.0	0.945
1. PBF	Q21BS0	Elongation factor 4	0.00e+00	3.07e-64	0.0	0.9474
1. PBF	C3L5S2	Elongation factor 4	0.00e+00	2.71e-70	0.0	0.9878
1. PBF	A6TSM4	Elongation factor 4	0.00e+00	4.74e-65	0.0	0.9718
1. PBF	P65270	Elongation factor 4	0.00e+00	1.46e-36	0.0	0.9447
1. PBF	Q00ZZ1	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.16e-22	0.0	0.936
1. PBF	A1KB30	Elongation factor G	0.00e+00	9.34e-17	1.31e-17	0.6959
1. PBF	Q7WD30	Elongation factor 4	0.00e+00	2.60e-66	0.0	0.9513
1. PBF	C4YIT6	Translation factor GUF1, mitochondrial	0.00e+00	5.39e-32	1.37e-180	0.8741
1. PBF	Q46GZ6	Elongation factor 4	0.00e+00	2.06e-70	0.0	0.9548
1. PBF	A2QU25	Translation factor guf1, mitochondrial	0.00e+00	2.63e-23	0.0	0.9514
1. PBF	Q71ZJ1	Elongation factor 4	0.00e+00	1.58e-72	0.0	0.9879
1. PBF	Q7U5L9	Elongation factor 4	0.00e+00	7.27e-65	0.0	0.9484
1. PBF	B1J4D8	Elongation factor 4	0.00e+00	5.78e-74	0.0	0.9417
1. PBF	Q818E4	Elongation factor 4	0.00e+00	3.28e-68	0.0	0.9663
1. PBF	B2SRY0	Elongation factor 4	0.00e+00	4.35e-70	0.0	0.9125
1. PBF	Q3KMV7	Elongation factor 4	0.00e+00	1.72e-71	0.0	0.9448
1. PBF	B7MIQ4	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9399
1. PBF	Q98N59	Elongation factor G	2.00e-15	1.75e-14	2.26e-19	0.6152
1. PBF	D0NKK0	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.55e-26	6.03e-164	0.9408
1. PBF	P60790	Elongation factor 4	0.00e+00	6.86e-74	0.0	0.981
1. PBF	Q97QK5	Elongation factor 4	0.00e+00	5.22e-69	0.0	0.9899
1. PBF	Q3MG20	Elongation factor 4	0.00e+00	5.07e-69	0.0	0.9384
1. PBF	Q13E78	Elongation factor 4	0.00e+00	1.28e-70	0.0	0.9489
1. PBF	Q9RDC9	Elongation factor 4	0.00e+00	1.58e-55	0.0	0.9439
1. PBF	C3PMX3	Elongation factor 4	0.00e+00	6.34e-66	0.0	0.9427
1. PBF	Q6BMV8	Translation factor GUF1, mitochondrial	0.00e+00	3.40e-50	0.0	0.9288
1. PBF	B0TIV5	Elongation factor 4	0.00e+00	1.19e-68	0.0	0.9476
1. PBF	Q0SP76	Elongation factor 4	0.00e+00	2.75e-73	0.0	0.9268
1. PBF	P61878	Elongation factor 2	7.17e-14	6.10e-22	3.04e-23	0.6554
1. PBF	Q979T3	Elongation factor 2	1.82e-10	2.18e-23	6.51e-21	0.5278
1. PBF	C4KHE9	Elongation factor 2	1.23e-10	2.11e-21	9.56e-27	0.5748
1. PBF	B2JFK0	Elongation factor 4	0.00e+00	1.99e-66	0.0	0.9478
1. PBF	Q7URV2	Elongation factor G	0.00e+00	2.20e-18	1.55e-22	0.5982
1. PBF	C8VPJ1	Translation factor guf1, mitochondrial	0.00e+00	9.43e-25	4.39e-179	0.9479
1. PBF	B0U3D5	Elongation factor 4	0.00e+00	1.69e-70	0.0	0.9175
1. PBF	P9WK96	Elongation factor 4	0.00e+00	1.46e-36	0.0	0.9444
1. PBF	Q8EH83	Elongation factor 4	0.00e+00	1.78e-69	0.0	0.9494
1. PBF	B7NRM2	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9405
1. PBF	Q8EK71	Elongation factor G 1	5.55e-15	2.09e-16	1.10e-20	0.6045
1. PBF	Q254E1	Elongation factor 4	0.00e+00	1.83e-67	0.0	0.9453
1. PBF	B3R202	Elongation factor 4	0.00e+00	3.01e-69	0.0	0.9502
1. PBF	B5ZBD4	Elongation factor 4	0.00e+00	4.33e-76	0.0	0.9718
1. PBF	Q3IDL4	Elongation factor 4	0.00e+00	4.36e-72	0.0	0.9487
1. PBF	A9M5Q3	Elongation factor G	3.11e-15	2.15e-16	1.19e-20	0.6137
1. PBF	Q2KDL5	Elongation factor 4	0.00e+00	1.94e-70	0.0	0.949
1. PBF	B3CPV1	Elongation factor 4	0.00e+00	4.86e-76	0.0	0.9426
1. PBF	A8H1C5	Elongation factor 4	0.00e+00	3.36e-69	0.0	0.9425
1. PBF	A1BHJ8	Elongation factor 4	0.00e+00	2.48e-72	0.0	0.9559
1. PBF	C4ZUJ5	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6185
1. PBF	B1KZP1	Elongation factor 4	0.00e+00	2.10e-72	0.0	0.9669
1. PBF	B8JAF3	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.955
1. PBF	A7HCF3	Elongation factor 4	0.00e+00	2.07e-65	0.0	0.9713
1. PBF	A3DMV6	Elongation factor 2	5.64e-14	1.98e-24	5.64e-26	0.6796
1. PBF	Q8XIS6	Elongation factor 4	0.00e+00	4.99e-70	0.0	0.9607
1. PBF	C4ZYJ2	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9418
1. PBF	Q3IUM4	Elongation factor 2	1.46e-13	1.50e-22	2.88e-22	0.6569
1. PBF	Q89BJ8	Elongation factor 4	0.00e+00	1.20e-71	0.0	0.9499
1. PBF	B6I5E3	Elongation factor 4	0.00e+00	3.96e-75	0.0	0.8933
1. PBF	Q16BA3	Elongation factor 4	0.00e+00	1.77e-76	0.0	0.9461
1. PBF	Q2IIA6	Elongation factor 4	0.00e+00	8.55e-69	0.0	0.9451
1. PBF	Q9KD76	Elongation factor 4	0.00e+00	8.93e-70	0.0	0.9463
1. PBF	A2CBG9	Elongation factor 4	0.00e+00	7.24e-68	0.0	0.9439
1. PBF	B5BAS8	Elongation factor 4	0.00e+00	3.74e-75	0.0	0.9305
1. PBF	Q6MEF3	Elongation factor 4	0.00e+00	5.82e-69	0.0	0.9483
1. PBF	Q83BK3	Elongation factor 4	0.00e+00	2.76e-74	0.0	0.9462
1. PBF	Q5PAX8	Elongation factor 4	0.00e+00	2.28e-71	0.0	0.9445
1. PBF	A5UBC2	Elongation factor 4	0.00e+00	1.18e-73	0.0	0.8994
1. PBF	Q46Z15	Elongation factor 4	0.00e+00	1.98e-71	0.0	0.9524
1. PBF	Q2RKX8	Elongation factor 4	0.00e+00	1.74e-70	0.0	0.9414
1. PBF	B4U3G9	Elongation factor 4	0.00e+00	5.57e-67	0.0	0.9723
1. PBF	A6QHC7	Elongation factor 4	0.00e+00	1.51e-69	0.0	0.979
1. PBF	A3PHQ9	Elongation factor 4	0.00e+00	8.99e-66	0.0	0.9499
1. PBF	Q038N6	Elongation factor 4	0.00e+00	2.53e-66	0.0	0.9922
1. PBF	B4RVA8	Elongation factor 4	0.00e+00	1.24e-64	0.0	0.9476
1. PBF	Q48EV0	Elongation factor 4	0.00e+00	3.74e-75	0.0	0.9369
1. PBF	Q98DV1	Elongation factor 4	0.00e+00	3.68e-70	0.0	0.9484
1. PBF	Q1JC06	Elongation factor 4	0.00e+00	2.88e-58	0.0	0.9733
1. PBF	Q92BN4	Elongation factor 4	0.00e+00	5.58e-73	0.0	0.9888
1. PBF	C5GRI9	Translation factor GUF1, mitochondrial	0.00e+00	4.36e-27	1.46e-178	0.9475
1. PBF	A9L5N4	Elongation factor 4	0.00e+00	4.45e-71	0.0	0.9118
1. PBF	A5GMR2	Elongation factor 4	0.00e+00	4.97e-66	0.0	0.9467
1. PBF	Q049W8	Elongation factor 4	0.00e+00	2.28e-69	0.0	0.9726
1. PBF	Q6AL53	Elongation factor 4	0.00e+00	5.61e-72	0.0	0.9464
1. PBF	B2J0M4	Elongation factor 4	0.00e+00	1.32e-67	0.0	0.9356
1. PBF	A4RZA6	Translation factor GUF1 homolog, chloroplastic	0.00e+00	1.04e-68	0.0	0.9117
1. PBF	Q7W455	Elongation factor G 2	0.00e+00	2.39e-17	1.47e-18	0.6327
1. PBF	C1FVU4	Elongation factor 4	0.00e+00	1.98e-71	0.0	0.9557
1. PBF	B9DNK4	Elongation factor 4	0.00e+00	3.09e-69	0.0	0.9459
1. PBF	Q49Y26	Elongation factor 4	0.00e+00	8.93e-70	0.0	0.9817
1. PBF	C3MQ53	Elongation factor 2	4.07e-14	2.11e-21	9.56e-27	0.686
1. PBF	P60789	Elongation factor 4	0.00e+00	4.36e-67	0.0	0.9572
1. PBF	A4FUD3	116 kDa U5 small nuclear ribonucleoprotein component	7.77e-06	9.84e-06	1.25e-19	0.6292
1. PBF	A4G6S1	Elongation factor 4	0.00e+00	1.59e-69	0.0	0.9485
1. PBF	B5FAH2	Elongation factor 4	0.00e+00	1.39e-74	0.0	0.9455
1. PBF	Q2GGA6	Elongation factor 4	0.00e+00	3.78e-70	0.0	0.932
1. PBF	B7HPL8	Elongation factor 4	0.00e+00	1.64e-69	0.0	0.9495
1. PBF	B1AIW2	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9705
1. PBF	Q92QH2	Elongation factor G	0.00e+00	1.47e-15	2.54e-20	0.6367
1. PBF	Q3J4P0	Elongation factor 4	0.00e+00	1.62e-65	0.0	0.9537
1. PBF	Q9CGI8	Elongation factor 4	0.00e+00	3.02e-72	0.0	0.9908
1. PBF	Q1AU26	Elongation factor G	8.99e-15	1.35e-15	2.90e-19	0.6149
1. PBF	Q1LKM8	Elongation factor 4	0.00e+00	1.84e-70	0.0	0.9463
1. PBF	A1WMW4	Elongation factor 4	0.00e+00	2.98e-67	0.0	0.9361
1. PBF	Q1C557	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.903
1. PBF	A4VUL8	Elongation factor 4	0.00e+00	6.00e-66	0.0	0.9891
1. PBF	B8FUP2	Elongation factor 4	0.00e+00	2.64e-70	0.0	0.9778
1. PBF	C5A6N7	Elongation factor 2	1.47e-13	3.11e-23	4.14e-24	0.663
1. PBF	B8BYH3	Translation factor GUF1 homolog, mitochondrial	0.00e+00	3.17e-13	0.0	0.9193
1. PBF	A7TPD4	Translation factor GUF1, mitochondrial	0.00e+00	2.29e-33	6.56e-159	0.9413
1. PBF	B5XLC6	Elongation factor 4	0.00e+00	1.08e-69	0.0	0.9869
1. PBF	Q6G1F5	Elongation factor 4	0.00e+00	6.36e-65	0.0	0.9396
1. PBF	B3Q991	Elongation factor 4	0.00e+00	5.56e-71	0.0	0.9452
1. PBF	Q4FUV9	Elongation factor 4	0.00e+00	2.60e-73	0.0	0.9433
1. PBF	Q2J2Y0	Elongation factor 4	0.00e+00	4.45e-71	0.0	0.9494
1. PBF	C0RJK4	Elongation factor G	0.00e+00	1.63e-16	1.15e-20	0.6157
1. PBF	P37949	Elongation factor 4	0.00e+00	7.24e-68	0.0	0.9821
1. PBF	Q5ZUD2	Elongation factor 4	0.00e+00	5.06e-60	0.0	0.9535
1. PBF	Q057R2	Elongation factor 4	0.00e+00	6.34e-66	0.0	0.947
1. PBF	A6X0B5	Elongation factor G	3.00e-15	1.05e-16	1.58e-20	0.6152
1. PBF	Q5SKA7	Elongation factor 4	0.00e+00	4.69e-64	0.0	0.9538
1. PBF	Q0HG96	Elongation factor 4	0.00e+00	1.07e-72	0.0	0.9509
1. PBF	A0AIS8	Elongation factor 4	0.00e+00	9.54e-73	0.0	0.9519
1. PBF	Q2A5H2	Elongation factor G	1.11e-16	4.08e-16	6.02e-18	0.6184
1. PBF	Q7MHN6	Elongation factor 4	0.00e+00	2.86e-72	0.0	0.95
1. PBF	B3WEQ5	Elongation factor 4	0.00e+00	2.53e-66	0.0	0.9872
1. PBF	Q6CUH2	Translation factor GUF1, mitochondrial	0.00e+00	1.42e-43	2.56e-180	0.9268
1. PBF	A4Y4K2	Elongation factor 4	0.00e+00	7.43e-72	0.0	0.9513
1. PBF	Q4Q3F0	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.80e-06	3.56e-112	0.8189
1. PBF	B9LJC8	Elongation factor G	0.00e+00	1.06e-15	9.45e-19	0.606
1. PBF	Q1R0H8	Elongation factor G	0.00e+00	6.76e-17	3.20e-19	0.6847
1. PBF	B2VI44	Elongation factor 4	0.00e+00	1.15e-75	0.0	0.9397
1. PBF	Q2YJP8	Elongation factor 4	0.00e+00	5.26e-71	0.0	0.9505
1. PBF	B8J444	Elongation factor 4	0.00e+00	1.14e-73	0.0	0.9485
1. PBF	A7X2Y7	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9766
1. PBF	A4JCQ9	Elongation factor 4	0.00e+00	3.91e-67	0.0	0.9407
1. PBF	B7GKC4	Elongation factor 4	0.00e+00	1.28e-67	0.0	0.9795
1. PBF	Q0AWL9	Elongation factor 4	0.00e+00	3.56e-68	0.0	0.9565
1. PBF	Q5JFZ3	Elongation factor 2	1.24e-13	1.06e-22	1.61e-23	0.6668
1. PBF	A8GMT1	Elongation factor 4	0.00e+00	1.71e-64	0.0	0.9519
1. PBF	B0USR9	Elongation factor 4	0.00e+00	6.86e-74	0.0	0.944
1. PBF	A9BNJ8	Elongation factor 4	0.00e+00	1.56e-68	0.0	0.9286
1. PBF	B6I240	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6221
1. PBF	A0KGF0	Elongation factor 4	0.00e+00	1.51e-69	0.0	0.9427
1. PBF	Q1R5U3	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6122
1. PBF	Q2JDK2	Elongation factor 4	0.00e+00	4.83e-45	0.0	0.9379
1. PBF	A0Q453	Elongation factor 4	0.00e+00	1.85e-73	0.0	0.955
1. PBF	A5VJE9	Elongation factor 4	0.00e+00	6.08e-77	0.0	0.9921
1. PBF	Q87C09	Elongation factor 4	0.00e+00	1.65e-70	0.0	0.9176
1. PBF	Q5NEF8	Elongation factor 4	0.00e+00	6.07e-73	0.0	0.9488
1. PBF	Q32B26	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6066
1. PBF	B3PYC6	Elongation factor 4	0.00e+00	1.65e-70	0.0	0.9537
1. PBF	Q5NLP5	Elongation factor 4	0.00e+00	4.61e-67	0.0	0.9474
1. PBF	Q24SR6	Elongation factor 4	0.00e+00	2.64e-70	0.0	0.9691
1. PBF	Q0VP16	Elongation factor 4	0.00e+00	1.19e-72	0.0	0.9545
1. PBF	A5U598	Elongation factor 4	0.00e+00	1.46e-36	0.0	0.9447
1. PBF	B2S682	Elongation factor G	0.00e+00	1.70e-16	1.19e-20	0.6422
1. PBF	B4TS16	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.8936
1. PBF	B2HWQ2	Elongation factor 4	0.00e+00	4.23e-70	0.0	0.948
1. PBF	A8FM79	Elongation factor 4	0.00e+00	3.18e-74	0.0	0.9571
1. PBF	A3PBD8	Elongation factor 4	0.00e+00	3.29e-70	0.0	0.9543
1. PBF	Q2NS11	Elongation factor 4	0.00e+00	9.01e-73	0.0	0.9405
1. PBF	A9MGX5	Elongation factor 4	0.00e+00	2.73e-75	0.0	0.9344
1. PBF	Q7W5J4	Elongation factor 4	0.00e+00	2.60e-66	0.0	0.9464
1. PBF	A8QCE7	Translation factor GUF1 homolog, mitochondrial	0.00e+00	3.33e-26	1.27e-135	0.8742
1. PBF	Q9HM85	Elongation factor 2	9.52e-12	3.33e-23	7.78e-23	0.5252
1. PBF	Q9PQG7	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9747
1. PBF	P0A1W4	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9353
1. PBF	Q1BXU3	Elongation factor 4	0.00e+00	7.24e-68	0.0	0.912
1. PBF	B7GYS7	Elongation factor 4	0.00e+00	4.23e-70	0.0	0.9181
1. PBF	C5CSF2	Elongation factor 4	0.00e+00	4.86e-67	0.0	0.9265
1. PBF	Q72QU8	Elongation factor 4	0.00e+00	1.60e-67	0.0	0.9361
1. PBF	C4Z9E3	Elongation factor 4	0.00e+00	1.79e-70	0.0	0.9887
1. PBF	B7MYK1	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9399
1. PBF	A4IR35	Elongation factor 4	0.00e+00	6.32e-69	0.0	0.9711
1. PBF	D1ZET3	Translation factor GUF1, mitochondrial	0.00e+00	7.54e-14	1.04e-174	0.9549
1. PBF	P33159	Elongation factor 2	7.79e-14	3.51e-20	1.10e-23	0.689
1. PBF	Q7UE01	Elongation factor 4 2	0.00e+00	4.33e-76	0.0	0.9311
1. PBF	Q8RB72	Elongation factor 4	0.00e+00	9.70e-71	0.0	0.9688
1. PBF	B6H460	Elongation factor G, mitochondrial	1.78e-15	3.26e-03	7.38e-23	0.6058
1. PBF	A6KYJ7	Elongation factor G	1.11e-16	1.17e-17	3.31e-19	0.6085
1. PBF	C1CR98	Elongation factor 4	0.00e+00	3.85e-69	0.0	0.9898
1. PBF	Q2U3T4	Translation factor guf1, mitochondrial	0.00e+00	1.56e-23	1.81e-178	0.9366
1. PBF	A2BPP8	Elongation factor 4	0.00e+00	4.72e-70	0.0	0.9389
1. PBF	Q1IV51	Elongation factor 4	0.00e+00	1.49e-62	0.0	0.928
1. PBF	Q1DLM0	Elongation factor G, mitochondrial	3.33e-16	4.41e-02	1.04e-22	0.6573
1. PBF	A7MZB0	Elongation factor 4	0.00e+00	5.42e-75	0.0	0.9478
1. PBF	C6HPI9	Translation factor GUF1, mitochondrial	0.00e+00	4.36e-27	4.32e-177	0.943
1. PBF	D2VRR7	Translation factor GUF1 homolog, mitochondrial	0.00e+00	7.38e-16	0.0	0.9325
1. PBF	B9E6X5	Elongation factor 4	0.00e+00	1.67e-71	0.0	0.9865
1. PBF	B5FRC7	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9404
1. PBF	Q39I75	Elongation factor 4	0.00e+00	8.45e-70	0.0	0.9549
1. PBF	P74751	Elongation factor 4	0.00e+00	1.45e-71	0.0	0.9454
1. PBF	Q9X1V8	Elongation factor 4	0.00e+00	1.28e-59	0.0	0.928
1. PBF	A9BE39	Elongation factor 4	0.00e+00	5.66e-68	0.0	0.9463
1. PBF	Q74M52	Elongation factor 2	7.70e-13	5.34e-24	5.29e-19	0.641
1. PBF	A5I644	Elongation factor 4	0.00e+00	4.61e-72	0.0	0.9673
1. PBF	Q02Z80	Elongation factor 4	0.00e+00	4.72e-70	0.0	0.9862
1. PBF	A3NXL8	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9387
1. PBF	B7KR78	Elongation factor 4	0.00e+00	2.39e-74	0.0	0.9451
1. PBF	Q0BP65	Elongation factor 4	0.00e+00	5.16e-74	0.0	0.9423
1. PBF	B8D953	Elongation factor 4	0.00e+00	3.02e-68	0.0	0.9478
1. PBF	P75498	Elongation factor 4	0.00e+00	6.59e-70	0.0	0.9821
1. PBF	A9N944	Elongation factor 4	0.00e+00	2.76e-74	0.0	0.9451
1. PBF	B9M4U5	Elongation factor 4	0.00e+00	1.55e-69	0.0	0.9606
1. PBF	B7K3Z7	Elongation factor 4	0.00e+00	4.08e-68	0.0	0.9388
1. PBF	A4WMR8	Elongation factor 2	2.30e-14	3.38e-23	1.90e-19	0.6679
1. PBF	A7FXL9	Elongation factor 4	0.00e+00	4.61e-72	0.0	0.9729
1. PBF	Q2G550	Elongation factor 4	0.00e+00	2.60e-73	0.0	0.9394
1. PBF	C1C7G9	Elongation factor 4	0.00e+00	2.62e-69	0.0	0.9909
1. PBF	Q3JQ75	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9419
1. PBF	Q6F9B9	Elongation factor 4	0.00e+00	2.30e-70	0.0	0.9481
1. PBF	Q47WP3	Elongation factor 4	0.00e+00	1.51e-70	0.0	0.9515
1. PBF	O28385	Elongation factor 2	7.02e-14	1.10e-24	5.36e-26	0.6727
1. PBF	B5F1G3	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.8922
1. PBF	Q62LT1	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9504
1. PBF	A7N9S4	Elongation factor G	1.11e-16	2.13e-15	6.08e-18	0.6149
1. PBF	Q13VM6	Elongation factor 4	0.00e+00	6.41e-70	0.0	0.9356
1. PBF	C0SHD5	Translation factor GUF1, mitochondrial	0.00e+00	1.46e-25	1.63e-177	0.9394
1. PBF	B2KA49	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9465
1. PBF	P0A6M9	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.605
1. PBF	Q47RQ0	Elongation factor 4	0.00e+00	2.71e-68	0.0	0.9383
1. PBF	B4F049	Elongation factor 4	0.00e+00	1.94e-70	0.0	0.9016
1. PBF	C5BRN3	Elongation factor 4	0.00e+00	3.54e-76	0.0	0.9438
1. PBF	Q6FZB9	Elongation factor G	2.55e-15	2.95e-17	6.52e-20	0.6026
1. PBF	Q3ZXK4	Elongation factor 4	0.00e+00	3.24e-63	0.0	0.9443
1. PBF	C0MDV7	Elongation factor 4	0.00e+00	3.91e-67	0.0	0.9847
1. PBF	Q8UE15	Elongation factor G	1.33e-15	6.03e-16	1.53e-20	0.6159
1. PBF	Q5F3X4	116 kDa U5 small nuclear ribonucleoprotein component	6.36e-06	9.07e-06	1.20e-19	0.6294
1. PBF	Q07TF1	Elongation factor 4	0.00e+00	1.74e-70	0.0	0.95
1. PBF	A6U856	Elongation factor G	1.19e-14	8.76e-16	4.90e-21	0.6225
1. PBF	Q2KWY3	Elongation factor 4	0.00e+00	7.25e-69	0.0	0.9138
1. PBF	A3DF29	Elongation factor 4	0.00e+00	2.16e-66	0.0	0.9576
1. PBF	B0CS18	Translation factor GUF1, mitochondrial	0.00e+00	5.95e-44	0.0	0.9237
1. PBF	Q01SV7	Elongation factor 4	0.00e+00	2.04e-66	0.0	0.9491
1. PBF	C3NED6	Elongation factor 2	3.72e-14	2.11e-21	9.56e-27	0.6768
1. PBF	O67618	Elongation factor 4	0.00e+00	5.22e-69	0.0	0.9547
1. PBF	P65273	Elongation factor 4	0.00e+00	8.07e-68	0.0	0.9722
1. PBF	Q0CS42	Translation factor guf1, mitochondrial	0.00e+00	1.94e-25	1.29e-177	0.9511
1. PBF	A0M6M2	Elongation factor 4	0.00e+00	3.67e-74	0.0	0.9438
1. PBF	Q30XI4	Elongation factor 4	0.00e+00	4.12e-72	0.0	0.9708
1. PBF	B1XTL2	Elongation factor 4	0.00e+00	1.15e-67	0.0	0.9385
1. PBF	C3P8M5	Elongation factor 4	0.00e+00	3.29e-70	0.0	0.9681
1. PBF	A7IEG8	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9482
1. PBF	Q92IQ1	Elongation factor 4	0.00e+00	1.54e-64	0.0	0.9486
1. PBF	Q2SL35	Elongation factor 4	0.00e+00	2.73e-76	0.0	0.9505
1. PBF	A9A9U4	Elongation factor 2	1.58e-13	3.74e-20	5.92e-22	0.6678
1. PBF	Q0HSI9	Elongation factor 4	0.00e+00	1.07e-72	0.0	0.9487
1. PBF	P65272	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9803
1. PBF	A5D3X6	Elongation factor 4	0.00e+00	2.53e-73	0.0	0.9644
1. PBF	B0K3Y4	Elongation factor 4	0.00e+00	2.62e-69	0.0	0.9682
1. PBF	Q8NWA7	Elongation factor 4	0.00e+00	1.73e-69	0.0	0.9814
1. PBF	C4L433	Elongation factor 4	0.00e+00	5.41e-71	0.0	0.9874
1. PBF	A7Z6W5	Elongation factor 4	0.00e+00	2.94e-68	0.0	0.9503
1. PBF	C3MAX7	Elongation factor G	6.44e-15	6.03e-16	1.31e-20	0.6169
1. PBF	A2QI77	Elongation factor G, mitochondrial	3.33e-16	4.37e-02	2.41e-23	0.6545
1. PBF	Q8F500	Elongation factor 4	0.00e+00	1.60e-67	0.0	0.9454
1. PBF	B8MS24	Translation factor guf1, mitochondrial	0.00e+00	1.75e-23	5.67e-178	0.9478
1. PBF	B1XK44	Elongation factor 4	0.00e+00	4.30e-69	0.0	0.9282
1. PBF	Q5WHG5	Elongation factor 4	0.00e+00	5.13e-70	0.0	0.9787
1. PBF	Q5HNW2	Elongation factor 4	0.00e+00	2.62e-69	0.0	0.9843
1. PBF	A9KF98	Elongation factor 4	0.00e+00	1.26e-71	0.0	0.9458
1. PBF	Q1D6M1	Elongation factor 4	0.00e+00	2.71e-68	0.0	0.9314
1. PBF	B2WBM8	Elongation factor G, mitochondrial	6.17e-14	2.86e-04	9.79e-22	0.5957
1. PBF	A1TYJ4	Elongation factor G	0.00e+00	1.83e-16	2.64e-20	0.6115
1. PBF	A1AE99	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9309
1. PBF	B0RX30	Elongation factor 4	0.00e+00	8.79e-72	0.0	0.9445
1. PBF	A9VHU6	Elongation factor 4	0.00e+00	9.00e-68	0.0	0.9878
1. PBF	O93637	Elongation factor 2	2.32e-13	7.53e-25	3.78e-24	0.6655
1. PBF	B9JVN4	Elongation factor G	7.99e-15	1.62e-15	1.12e-20	0.6152
1. PBF	A4XKA0	Elongation factor 4	0.00e+00	1.60e-70	0.0	0.9526
1. PBF	B7J9J8	Elongation factor 4	0.00e+00	1.47e-74	0.0	0.9353
1. PBF	Q0TER9	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9388
1. PBF	Q4WYV0	Translation factor guf1, mitochondrial	0.00e+00	6.73e-23	1.15e-174	0.9447
1. PBF	Q1I5V6	Elongation factor 4	0.00e+00	1.56e-74	0.0	0.962
1. PBF	Q92SU3	Elongation factor 4	0.00e+00	2.54e-71	0.0	0.9549
1. PBF	Q67S76	Elongation factor 4	0.00e+00	1.35e-67	0.0	0.9607
1. PBF	Q0I4Z1	Elongation factor 4	0.00e+00	6.86e-74	0.0	0.9463
1. PBF	Q5M4M2	Elongation factor 4	0.00e+00	2.23e-70	0.0	0.9895
1. PBF	Q9PKX6	Elongation factor 4	0.00e+00	5.43e-70	0.0	0.941
1. PBF	Q4UKS2	Elongation factor 4	0.00e+00	3.01e-69	0.0	0.9497
1. PBF	Q8KCH0	Elongation factor 4	0.00e+00	4.94e-69	0.0	0.9433
1. PBF	Q5E312	Elongation factor 4	0.00e+00	2.20e-74	0.0	0.9485
1. PBF	B7UYX5	Elongation factor 4	0.00e+00	1.63e-75	0.0	0.9604
1. PBF	B7J464	Elongation factor G	0.00e+00	2.36e-17	3.82e-18	0.6874
1. PBF	Q126K0	Elongation factor 4	0.00e+00	2.63e-68	0.0	0.9517
1. PBF	Q68X95	Elongation factor 4	0.00e+00	3.56e-71	0.0	0.9522
1. PBF	P23112	Elongation factor 2	6.62e-14	8.33e-22	1.06e-26	0.6813
1. PBF	A2R994	Ribosome-releasing factor 2, mitochondrial	8.46e-09	1.48e-12	1.27e-18	0.5685
1. PBF	Q31HP5	Elongation factor 4	0.00e+00	2.03e-71	0.0	0.9346
1. PBF	Q7VRQ8	Elongation factor 4	0.00e+00	1.12e-62	0.0	0.9123
1. PBF	B1YE08	Elongation factor 2	1.63e-13	6.96e-23	3.63e-20	0.6543
1. PBF	A1KL96	Elongation factor 4	0.00e+00	1.46e-36	0.0	0.9439
1. PBF	B5ZXQ5	Elongation factor 4	0.00e+00	6.39e-71	0.0	0.9549
1. PBF	B7M1P1	Elongation factor G	1.11e-16	4.73e-19	1.14e-17	0.6125
1. PBF	Q74ZG2	Translation factor GUF1, mitochondrial	0.00e+00	6.50e-35	0.0	0.9356
1. PBF	A8YVQ1	Elongation factor 4	0.00e+00	8.22e-70	0.0	0.9364
1. PBF	Q8ZZC1	Elongation factor 2	8.39e-14	1.51e-23	2.86e-20	0.6705
1. PBF	Q1MIE4	Elongation factor G	9.10e-15	4.08e-16	1.28e-20	0.62
1. PBF	B8IMT0	Elongation factor 4	0.00e+00	4.24e-72	0.0	0.9481
1. PBF	A0KZN4	Elongation factor 4	0.00e+00	1.30e-71	0.0	0.9483
1. PBF	B0Y604	Elongation factor G, mitochondrial	2.22e-16	1.20e-02	5.11e-22	0.6654
1. PBF	C1CEG3	Elongation factor 4	0.00e+00	5.66e-69	0.0	0.9756
1. PBF	C4JWU3	Translation factor GUF1, mitochondrial	0.00e+00	7.15e-25	2.43e-177	0.9443
1. PBF	A8AWG3	Elongation factor 4	0.00e+00	2.54e-71	0.0	0.9893
1. PBF	B3E9R0	Elongation factor 4	0.00e+00	2.76e-64	0.0	0.9566
1. PBF	A9IW31	Elongation factor G	1.89e-15	2.49e-16	1.76e-20	0.6053
1. PBF	A5ITB2	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9738
1. PBF	Q3AWX3	Elongation factor 4	0.00e+00	4.13e-67	0.0	0.9427
1. PBF	Q730L6	Elongation factor 4	0.00e+00	3.36e-69	0.0	0.9489
1. PBF	B7LUZ5	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9372
1. PBF	A4VIX2	Elongation factor 4	0.00e+00	8.54e-72	0.0	0.9403
1. PBF	C6A4M0	Elongation factor 2	1.19e-13	7.95e-23	9.60e-23	0.6588
1. PBF	B8GJK8	Elongation factor 2	1.48e-13	2.08e-23	3.21e-26	0.6766
1. PBF	A5DWY7	Translation factor GUF1, mitochondrial	0.00e+00	1.55e-22	6.91e-175	0.8583
1. PBF	O27131	Elongation factor 2	7.60e-09	3.01e-23	1.51e-30	0.5266
1. PBF	C3NHB6	Elongation factor 2	1.51e-10	2.11e-21	9.56e-27	0.5829
1. PBF	Q65W89	Elongation factor G	1.11e-16	2.86e-17	1.82e-18	0.6142
1. PBF	P60794	Elongation factor 4	0.00e+00	1.63e-71	0.0	0.9406
1. PBF	Q9JV65	Elongation factor 4	0.00e+00	1.58e-71	0.0	0.9386
1. PBF	Q5LUS0	Elongation factor 4	0.00e+00	3.03e-70	0.0	0.9463
1. PBF	Q0ATE3	Elongation factor 4	0.00e+00	3.38e-72	0.0	0.9422
1. PBF	B3QPU3	Elongation factor 4	0.00e+00	6.49e-68	0.0	0.9409
1. PBF	Q4FNH3	Elongation factor 4	0.00e+00	7.90e-74	0.0	0.9308
1. PBF	P57348	Elongation factor 4	0.00e+00	1.48e-68	0.0	0.9441
1. PBF	B1JYB1	Elongation factor 4	0.00e+00	7.24e-68	0.0	0.9065
1. PBF	A0L631	Elongation factor 4	0.00e+00	2.34e-71	0.0	0.9629
1. PBF	Q8PB55	Elongation factor 4	0.00e+00	1.15e-70	0.0	0.9308
1. PBF	Q1MQF3	Elongation factor 4	0.00e+00	7.99e-70	0.0	0.9555
1. PBF	A9III9	Elongation factor 4	0.00e+00	1.20e-71	0.0	0.9425
1. PBF	B3PWR8	Elongation factor G	1.09e-14	3.28e-16	1.46e-20	0.6174
1. PBF	B1YKS5	Elongation factor 4	0.00e+00	1.54e-72	0.0	0.9871
1. PBF	A6VAK9	Elongation factor 4	0.00e+00	7.93e-76	0.0	0.9604
1. PBF	Q9KPB0	Elongation factor 4	0.00e+00	1.39e-73	0.0	0.946
1. PBF	B6IUG3	Elongation factor 4	0.00e+00	2.23e-64	0.0	0.9486
1. PBF	Q2JWR1	Elongation factor 4	0.00e+00	1.23e-72	0.0	0.9434
1. PBF	Q14FW1	Elongation factor 4	0.00e+00	6.07e-73	0.0	0.9492
1. PBF	Q608M4	Elongation factor 4	0.00e+00	4.09e-73	0.0	0.9546
1. PBF	D3E3N9	Elongation factor 2	2.98e-12	5.43e-24	8.85e-14	0.6668
1. PBF	A8FSD4	Elongation factor 4	0.00e+00	1.56e-73	0.0	0.9462
1. PBF	P60787	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9405
1. PBF	B3EE17	Elongation factor 4	0.00e+00	2.43e-70	0.0	0.9404
1. PBF	A7MH13	Elongation factor 4	0.00e+00	2.81e-76	0.0	0.9407
1. PBF	Q7S0P6	Translation factor guf1, mitochondrial	0.00e+00	2.12e-10	4.54e-176	0.9543
1. PBF	A0B7D5	Elongation factor 2	2.80e-13	1.50e-22	1.33e-15	0.6678
1. PBF	Q1MMQ8	Elongation factor 4	0.00e+00	2.79e-70	0.0	0.9534
1. PBF	C5PCH4	Translation factor GUF1, mitochondrial	0.00e+00	6.64e-26	3.10e-166	0.942
1. PBF	Q0V3J4	Translation factor GUF1, mitochondrial	0.00e+00	8.50e-25	1.67e-173	0.9391
1. PBF	B1YVM2	Elongation factor 4	0.00e+00	9.77e-68	0.0	0.949
1. PBF	B1JRC5	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9403
1. PBF	Q667U9	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9026
1. PBF	Q81LR7	Elongation factor 4	0.00e+00	3.29e-70	0.0	0.9904
1. PBF	B0TAD2	Elongation factor 4	0.00e+00	4.55e-68	0.0	0.9741
1. PBF	Q87LN7	Elongation factor 4	0.00e+00	1.05e-74	0.0	0.9508
1. PBF	A1AWP9	Elongation factor 4	0.00e+00	1.48e-68	0.0	0.9483
1. PBF	Q82BZ3	Elongation factor 4	0.00e+00	2.62e-56	0.0	0.9438
1. PBF	Q7VDF7	Elongation factor 4	0.00e+00	1.36e-68	0.0	0.9454
1. PBF	Q3A445	Elongation factor 4	0.00e+00	2.94e-72	0.0	0.9479
1. PBF	Q5L659	Elongation factor 4	0.00e+00	6.15e-69	0.0	0.9417
1. PBF	A4SVW0	Elongation factor 4	0.00e+00	1.68e-67	0.0	0.9521
1. PBF	Q5FJP6	Elongation factor 4	0.00e+00	3.89e-72	0.0	0.9556
1. PBF	B0UFE0	Elongation factor 4	0.00e+00	1.61e-73	0.0	0.9482
1. PBF	A5CWJ4	Elongation factor 4	0.00e+00	3.32e-66	0.0	0.9488
1. PBF	Q38W39	Elongation factor 4	0.00e+00	1.28e-69	0.0	0.9904
1. PBF	P60792	Elongation factor 4	0.00e+00	1.31e-69	0.0	0.9532
1. PBF	A8AD16	Elongation factor 4	0.00e+00	9.92e-74	0.0	0.9031
1. PBF	B7UH09	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9348
1. PBF	Q5P089	Elongation factor 4	0.00e+00	6.96e-70	0.0	0.9458
1. PBF	Q4ZPD8	Elongation factor 4	0.00e+00	1.15e-75	0.0	0.9601
1. PBF	B7I580	Elongation factor 4	0.00e+00	4.23e-70	0.0	0.9057
1. PBF	Q5FHQ1	Elongation factor 4	0.00e+00	6.73e-67	0.0	0.9383
1. PBF	B7HCU5	Elongation factor 4	0.00e+00	4.57e-71	0.0	0.9837
1. PBF	Q9RV84	Elongation factor 4	0.00e+00	8.79e-72	0.0	0.9565
1. PBF	P65271	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9766
1. PBF	B3CRQ1	Elongation factor 4	0.00e+00	7.88e-69	0.0	0.9585
1. PBF	Q64T74	Elongation factor 4	0.00e+00	5.58e-70	0.0	0.9379
1. PBF	Q8AA33	Elongation factor 4	0.00e+00	3.85e-69	0.0	0.9446
1. PBF	B2SC25	Elongation factor 4	0.00e+00	5.26e-71	0.0	0.9456
1. PBF	Q8KQB3	Elongation factor G	2.33e-15	3.47e-17	1.84e-20	0.6067
1. PBF	B7L4L1	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6124
1. PBF	Q7NWC7	Elongation factor 4	0.00e+00	6.39e-71	0.0	0.932
1. PBF	Q65VN2	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.9426
1. PBF	Q9PBA1	Elongation factor 4	0.00e+00	5.88e-71	0.0	0.9211
1. PBF	Q0ICF2	Elongation factor 4	0.00e+00	2.15e-67	0.0	0.944
1. PBF	Q5X443	Elongation factor 4	0.00e+00	5.06e-60	0.0	0.9749
1. PBF	Q6F0Z2	Elongation factor 4	0.00e+00	1.55e-85	0.0	0.9558
1. PBF	A8GW16	Elongation factor 4	0.00e+00	4.08e-68	0.0	0.9521
1. PBF	Q0T1T6	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8939
1. PBF	A5VVU4	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9493
1. PBF	Q5KWZ3	Elongation factor 4	0.00e+00	3.37e-68	0.0	0.9712
1. PBF	A4J080	Elongation factor 4	0.00e+00	5.90e-73	0.0	0.9517
1. PBF	O51115	Elongation factor 4	0.00e+00	3.58e-72	0.0	0.9403
1. PBF	C3LR06	Elongation factor 4	0.00e+00	1.39e-73	0.0	0.948
1. PBF	Q99ZV8	Elongation factor 4	0.00e+00	2.28e-69	0.0	0.9884
1. PBF	Q7NGX4	Elongation factor 4	0.00e+00	3.77e-74	0.0	0.9471
1. PBF	C4LBZ6	Elongation factor 4	0.00e+00	5.90e-73	0.0	0.9493
1. PBF	Q5WVI1	Elongation factor 4	0.00e+00	2.59e-60	0.0	0.9498
1. PBF	Q02HR9	Elongation factor 4	0.00e+00	1.63e-75	0.0	0.9442
1. PBF	B1I6E0	Elongation factor 4	0.00e+00	1.18e-70	0.0	0.9581
1. PBF	Q1GIV5	Elongation factor 4	0.00e+00	1.72e-72	0.0	0.9498
1. PBF	A4S3R2	Translation factor GUF1 homolog, mitochondrial	0.00e+00	3.94e-30	0.0	0.9355
1. PBF	Q3B2V1	Elongation factor 4	0.00e+00	6.77e-70	0.0	0.9439
1. PBF	P61877	Elongation factor 2	7.43e-12	6.10e-22	3.04e-23	0.6554
1. PBF	A8A5E7	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6117
1. PBF	A7AQ93	Translation factor GUF1 homolog, mitochondrial	0.00e+00	6.78e-13	1.04e-171	0.9161
1. PBF	A4XSC1	Elongation factor 4	0.00e+00	2.53e-74	0.0	0.9007
1. PBF	A8G3D2	Elongation factor 4	0.00e+00	2.50e-70	0.0	0.9574
1. PBF	Q0K8N0	Elongation factor 4	0.00e+00	9.29e-69	0.0	0.9551
1. PBF	B5Z143	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9394
1. PBF	A9M3J8	Elongation factor 4	0.00e+00	1.30e-71	0.0	0.9358
1. PBF	B4S9B7	Elongation factor 4	0.00e+00	1.99e-69	0.0	0.9495
1. PBF	A8LR11	Elongation factor 4	0.00e+00	1.31e-74	0.0	0.936
1. PBF	P60786	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9401
1. PBF	B2SZV7	Elongation factor 4	0.00e+00	4.02e-67	0.0	0.9429
1. PBF	Q464Z3	Elongation factor 2	1.11e-13	1.32e-25	8.08e-21	0.6647
1. PBF	B4SBG4	Elongation factor 4	0.00e+00	2.33e-74	0.0	0.9555
1. PBF	B5RD51	Elongation factor 4	0.00e+00	1.22e-75	0.0	0.9385
1. PBF	B4T1G0	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.8905
1. PBF	C0NZL9	Translation factor GUF1, mitochondrial	0.00e+00	5.61e-27	5.49e-177	0.9441
1. PBF	A3CXM8	Elongation factor 2	1.16e-13	4.81e-23	7.37e-18	0.672
1. PBF	C1DQS0	Elongation factor 4	0.00e+00	4.21e-71	0.0	0.9486
1. PBF	Q8Y0I4	Elongation factor 4	0.00e+00	2.11e-70	0.0	0.9452
1. PBF	Q0HNU0	Elongation factor G 1	2.22e-15	4.27e-17	1.02e-20	0.6055
1. PBF	B4SKW0	Elongation factor G	5.00e-15	6.27e-17	2.78e-21	0.6138
1. PBF	A5N6L8	Elongation factor 4	0.00e+00	8.30e-68	0.0	0.9539
1. PBF	A8MFA6	Elongation factor 4	0.00e+00	6.14e-68	0.0	0.9677
1. PBF	A5VB59	Elongation factor 4	0.00e+00	4.57e-71	0.0	0.953
1. PBF	C3L3H1	Elongation factor 4	0.00e+00	5.30e-72	0.0	0.9596
1. PBF	P57806	Elongation factor 4	0.00e+00	4.87e-74	0.0	0.9441
1. PBF	Q1IXW5	Elongation factor 4	0.00e+00	1.28e-70	0.0	0.9581
1. PBF	A5GRE6	Elongation factor 4	0.00e+00	7.71e-67	0.0	0.9427
1. PBF	A4WDE0	Elongation factor 4	0.00e+00	3.06e-75	0.0	0.947
1. PBF	Q63S94	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9503
1. PBF	Q8UIQ2	Elongation factor 4	0.00e+00	1.04e-66	0.0	0.9503
1. PBF	Q4KHT3	Elongation factor 4	0.00e+00	1.93e-72	0.0	0.9613
1. PBF	B8D6B2	Elongation factor 2	7.48e-14	2.33e-21	8.26e-24	0.6933
1. PBF	C1ESL3	Elongation factor 4	0.00e+00	4.18e-69	0.0	0.9873
1. PBF	Q3BVV9	Elongation factor 4	0.00e+00	2.93e-69	0.0	0.942
1. PBF	Q3Z864	Elongation factor 4	0.00e+00	1.80e-64	0.0	0.9215
1. PBF	B6QW35	Translation factor guf1, mitochondrial	0.00e+00	9.05e-24	1.82e-175	0.9509
1. PBF	Q2K9L9	Elongation factor G	0.00e+00	3.85e-16	1.59e-20	0.6452
1. PBF	Q8CXD0	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9577
1. PBF	Q1WUE6	Elongation factor 4	0.00e+00	4.68e-77	0.0	0.9888
1. PBF	Q5R6E0	116 kDa U5 small nuclear ribonucleoprotein component	5.53e-08	2.49e-05	1.33e-19	0.6289
1. PBF	B0C9R9	Elongation factor 4	0.00e+00	1.13e-72	0.0	0.9446
1. PBF	B0BWV5	Elongation factor 4	0.00e+00	2.83e-64	0.0	0.9516
1. PBF	Q72KV2	Elongation factor 4	0.00e+00	1.91e-63	0.0	0.9577
1. PBF	B1V9C5	Elongation factor 4	0.00e+00	1.47e-69	0.0	0.9542
1. PBF	B6K286	Elongation factor G, mitochondrial	3.77e-15	3.78e-07	4.06e-23	0.6531
1. PBF	Q5GRW9	Elongation factor 4	0.00e+00	6.63e-77	0.0	0.9404
1. PBF	C1KVC6	Elongation factor 4	0.00e+00	1.58e-72	0.0	0.9909
1. PBF	B5EQB5	Elongation factor 4	0.00e+00	1.47e-74	0.0	0.9401
1. PBF	Q6LMS0	Elongation factor 4	0.00e+00	3.46e-68	0.0	0.9396
1. PBF	A4J7F8	Elongation factor 4	0.00e+00	1.08e-76	0.0	0.9575
1. PBF	Q7V2Q1	Elongation factor 4	0.00e+00	9.18e-71	0.0	0.9447
1. PBF	B6EKN1	Elongation factor 4	0.00e+00	1.02e-74	0.0	0.9348
1. PBF	Q6C255	Translation factor GUF1, mitochondrial	0.00e+00	1.71e-25	0.0	0.9325
1. PBF	Q0BNS9	Elongation factor G	1.11e-16	4.08e-16	6.02e-18	0.6167
1. PBF	Q32CV2	Elongation factor 4	0.00e+00	2.23e-75	0.0	0.9418
1. PBF	C3K6G8	Elongation factor 4	0.00e+00	1.75e-73	0.0	0.9593
1. PBF	A6L744	Elongation factor 4	0.00e+00	8.68e-71	0.0	0.9419
1. PBF	A1RMC9	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9515
1. PBF	A8XT37	Translation factor GUF1 homolog, mitochondrial	0.00e+00	4.03e-47	5.89e-174	0.926
1. PBF	Q5FUC2	Elongation factor 4	0.00e+00	1.44e-68	0.0	0.9531
1. PBF	B7IYH2	Elongation factor 4	0.00e+00	2.34e-71	0.0	0.9566
1. PBF	Q8FV17	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9428
1. PBF	C4Z541	Elongation factor 4	0.00e+00	7.56e-70	0.0	0.969
1. PBF	Q089Q7	Elongation factor G 1	0.00e+00	1.98e-18	4.03e-21	0.6149
1. PBF	B9DSE0	Elongation factor 4	0.00e+00	6.87e-69	0.0	0.9864
1. PBF	Q3YYU7	Elongation factor 4	0.00e+00	2.50e-75	0.0	0.9334
1. PBF	Q3SVT1	Elongation factor 4	0.00e+00	2.27e-67	0.0	0.9471
1. PBF	Q2LTN3	Elongation factor 4	0.00e+00	7.47e-74	0.0	0.9391
1. PBF	Q2SXT6	Elongation factor 4	0.00e+00	4.80e-68	0.0	0.9492
1. PBF	A2SDH0	Elongation factor 4	0.00e+00	3.71e-67	0.0	0.9422
1. PBF	A5F5G3	Elongation factor 4	0.00e+00	1.39e-73	0.0	0.9509
1. PBF	C1GGI6	Translation factor GUF1, mitochondrial	0.00e+00	4.58e-26	1.66e-177	0.9401
1. PBF	A1K601	Elongation factor 4	0.00e+00	2.93e-71	0.0	0.9549
1. PBF	Q831Z0	Elongation factor 4	0.00e+00	1.78e-69	0.0	0.9858
1. PBF	A7N9A4	Elongation factor 4	0.00e+00	5.16e-74	0.0	0.9405
1. PBF	A1U2V8	Elongation factor 4	0.00e+00	3.06e-67	0.0	0.9412
1. PBF	Q492C9	Elongation factor 4	0.00e+00	6.38e-67	0.0	0.9457
1. PBF	Q2YM00	Elongation factor G	2.78e-15	1.70e-16	1.19e-20	0.612
1. PBF	C0R5S3	Elongation factor 4	0.00e+00	2.81e-75	0.0	0.9446
1. PBF	O59521	Elongation factor 2	8.94e-14	1.19e-22	2.93e-23	0.6519
1. PBF	Q39US7	Elongation factor 4	0.00e+00	3.97e-68	0.0	0.9476
1. PBF	A3D1V4	Elongation factor 4	0.00e+00	1.21e-70	0.0	0.9472
1. PBF	A9GWZ4	Elongation factor 4	0.00e+00	5.95e-74	0.0	0.9497
1. PBF	Q6HDK2	Elongation factor 4	0.00e+00	4.18e-69	0.0	0.9535
1. PBF	B2S3A4	Elongation factor 4	0.00e+00	4.94e-69	0.0	0.9667
1. PBF	B9KNH9	Elongation factor 4	0.00e+00	4.84e-66	0.0	0.9502
1. PBF	C5JRK2	Translation factor GUF1, mitochondrial	0.00e+00	4.36e-27	1.46e-178	0.9445
1. PBF	Q6GGB6	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9794
1. PBF	A4SFN5	Elongation factor 4	0.00e+00	1.63e-71	0.0	0.9508
1. PBF	A1V6B9	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9516
1. PBF	A5W8F4	Elongation factor 4	0.00e+00	5.74e-75	0.0	0.9439
1. PBF	A3MM44	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9464
1. PBF	Q04SN9	Elongation factor 4	0.00e+00	5.61e-72	0.0	0.9289
1. PBF	Q8D307	Elongation factor 4	0.00e+00	8.52e-66	0.0	0.9389
1. PBF	C1D7L2	Elongation factor 4	0.00e+00	8.22e-70	0.0	0.945
1. PBF	B0BB51	Elongation factor 4	0.00e+00	1.39e-70	0.0	0.9421
1. PBF	P70782	Elongation factor G	1.78e-15	7.06e-16	1.40e-20	0.6193
1. PBF	Q2N9U6	Elongation factor 4	0.00e+00	2.11e-70	0.0	0.9416
1. PBF	Q30Q17	Elongation factor 4	0.00e+00	4.36e-72	0.0	0.9522
1. PBF	B8EBQ4	Elongation factor 4	0.00e+00	4.45e-71	0.0	0.9502
1. PBF	Q8YHP3	Elongation factor G	0.00e+00	1.20e-16	1.15e-20	0.6389
1. PBF	O66428	Elongation factor G	3.00e-14	5.04e-15	2.23e-23	0.6063
1. PBF	A6WKQ5	Elongation factor 4	0.00e+00	1.21e-70	0.0	0.9506
1. PBF	B4TE17	Elongation factor 4	0.00e+00	5.30e-76	0.0	0.9395
1. PBF	Q1R8G3	Elongation factor 4	0.00e+00	1.85e-74	0.0	0.9417
1. PBF	A9RFQ5	Translation factor GUF1 homolog, chloroplastic	0.00e+00	6.21e-09	0.0	0.9352
1. PBF	Q1QDV6	Elongation factor 4	0.00e+00	1.08e-73	0.0	0.9482
1. PBF	Q31XR8	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9378
1. PBF	A7FFT7	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.8929
1. PBF	Q47EG0	Elongation factor 4	0.00e+00	1.26e-71	0.0	0.95
1. PBF	Q9K055	Elongation factor 4	0.00e+00	2.93e-71	0.0	0.9319
1. PBF	Q8G075	Elongation factor G	0.00e+00	2.15e-16	1.19e-20	0.6424
1. PBF	A7I4X4	Elongation factor 2	1.67e-13	6.96e-23	7.56e-24	0.6705
1. PBF	B8D7F7	Elongation factor 4	0.00e+00	3.02e-68	0.0	0.9499
1. PBF	P40173	Elongation factor G 1	0.00e+00	1.47e-15	1.13e-22	0.6205
1. PBF	A8EY28	Elongation factor 4	0.00e+00	8.41e-64	0.0	0.9592
1. PBF	P30925	Elongation factor 2	1.42e-10	1.63e-21	5.95e-27	0.611
1. PBF	Q9Z8I4	Elongation factor 4	0.00e+00	2.90e-66	0.0	0.9455
1. PBF	B2SEJ6	Elongation factor 4	0.00e+00	6.48e-74	0.0	0.9475
1. PBF	B2FQC4	Elongation factor 4	0.00e+00	1.20e-71	0.0	0.943
1. PBF	Q820H8	Elongation factor 4	0.00e+00	1.52e-73	0.0	0.9405
1. PBF	A6UV44	Elongation factor 2	3.28e-13	9.33e-21	9.29e-22	0.6751
1. PBF	Q2Y873	Elongation factor 4	0.00e+00	6.04e-67	0.0	0.9448
1. PBF	Q0A8Z4	Elongation factor 4	0.00e+00	1.98e-48	0.0	0.9433
1. PBF	B1WWD8	Elongation factor 4	0.00e+00	1.58e-71	0.0	0.9444
1. PBF	A2BV79	Elongation factor 4	0.00e+00	1.32e-70	0.0	0.9481
1. PBF	Q6D217	Elongation factor 4	0.00e+00	1.63e-75	0.0	0.9384
1. PBF	B7VK81	Elongation factor 4	0.00e+00	4.60e-74	0.0	0.9403
1. PBF	Q7VL73	Elongation factor 4	0.00e+00	3.87e-71	0.0	0.9469
1. PBF	Q3ATB2	Elongation factor 4	0.00e+00	3.67e-74	0.0	0.9472
1. PBF	B9MJZ5	Elongation factor 4	0.00e+00	7.55e-71	0.0	0.955
1. PBF	A9HG78	Elongation factor 4	0.00e+00	1.88e-67	0.0	0.9512
1. PBF	Q5R104	Elongation factor 4	0.00e+00	4.23e-74	0.0	0.9483
1. PBF	Q3ALG5	Elongation factor 4	0.00e+00	5.65e-64	0.0	0.9454
1. PBF	Q03QU8	Elongation factor 4	0.00e+00	5.58e-75	0.0	0.9838
1. PBF	C4Y8M4	Translation factor GUF1, mitochondrial	0.00e+00	1.84e-27	7.73e-180	0.934
1. PBF	B0VTM2	Elongation factor 4	0.00e+00	4.11e-70	0.0	0.9139
1. PBF	Q182F4	Elongation factor 4	0.00e+00	7.25e-66	0.0	0.9654
1. PBF	Q65H50	Elongation factor 4	0.00e+00	2.34e-66	0.0	0.941
1. PBF	A5FY07	Elongation factor 4	0.00e+00	2.28e-72	0.0	0.9551
1. PBF	P56865	Elongation factor 4	0.00e+00	9.07e-67	0.0	0.9297
1. PBF	Q9PNR1	Elongation factor 4	0.00e+00	3.18e-74	0.0	0.9578
1. PBF	C3N5S0	Elongation factor 2	3.63e-14	2.11e-21	9.56e-27	0.6823
1. PBF	Q2GD00	Elongation factor 4	0.00e+00	5.74e-77	0.0	0.9546
1. PBF	B5XNG8	Elongation factor 4	0.00e+00	6.44e-75	0.0	0.9044
1. PBF	Q050R3	Elongation factor 4	0.00e+00	5.61e-72	0.0	0.9265
1. PBF	Q0TCB9	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6112
1. PBF	B2GBR9	Elongation factor 4	0.00e+00	2.76e-74	0.0	0.9915
1. PBF	A9ADE0	Elongation factor 4	0.00e+00	1.31e-69	0.0	0.9083
1. PBF	C5BQ43	Elongation factor G	2.56e-14	1.98e-18	2.47e-19	0.6088
1. PBF	A3QBS5	Elongation factor 4	0.00e+00	5.82e-68	0.0	0.9472
1. PBF	Q0RP81	Elongation factor 4	0.00e+00	3.19e-68	0.0	0.9375
1. PBF	P0DC23	Elongation factor 4	0.00e+00	1.18e-69	0.0	0.9882
1. PBF	A3M7P5	Elongation factor 4	0.00e+00	4.23e-70	0.0	0.9456
1. PBF	A5CE57	Elongation factor 4	0.00e+00	1.36e-68	0.0	0.9564
1. PBF	B8ZQ69	Elongation factor 4	0.00e+00	3.85e-69	0.0	0.9905
1. PBF	Q634M2	Elongation factor 4	0.00e+00	4.18e-69	0.0	0.9819
1. PBF	A1ARG8	Elongation factor 4	0.00e+00	4.01e-72	0.0	0.9588
1. PBF	P47384	Elongation factor 4	0.00e+00	3.15e-67	0.0	0.9753
1. PBF	A6SXR0	Elongation factor 4	0.00e+00	1.88e-67	0.0	0.9463
1. PBF	C1CKU6	Elongation factor 4	0.00e+00	5.22e-69	0.0	0.9924
1. PBF	B2TYI0	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.9378
1. PBF	B9WBR8	Translation factor GUF1, mitochondrial	0.00e+00	1.27e-30	0.0	0.9259
1. PBF	C6DZ67	Elongation factor 4	0.00e+00	4.86e-70	0.0	0.9405
1. PBF	B6JJT7	Elongation factor 4	0.00e+00	1.74e-70	0.0	0.9475
1. PBF	C1N1Y2	Translation factor GUF1 homolog, chloroplastic	0.00e+00	1.08e-16	0.0	0.9337
1. PBF	Q0CLP3	Elongation factor G, mitochondrial	2.78e-15	3.00e-02	8.14e-22	0.5974
1. PBF	B0VCT7	Elongation factor 4	0.00e+00	4.23e-70	0.0	0.9475
1. PBF	Q2FGD9	Elongation factor 4	0.00e+00	1.51e-69	0.0	0.9795
1. PBF	A4SRD4	Elongation factor 4	0.00e+00	2.09e-71	0.0	0.9502
1. PBF	B1XB43	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8952
1. PBF	B7G816	Translation factor GUF1 homolog, mitochondrial	0.00e+00	4.51e-15	0.0	0.9285
1. PBF	A6U257	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9735
1. PBF	Q9ZDQ1	Elongation factor 4	0.00e+00	6.06e-70	0.0	0.9456
1. PBF	B9MDP9	Elongation factor 4	0.00e+00	2.79e-70	0.0	0.9479
1. PBF	Q9V1Z8	Elongation factor 2	8.74e-14	1.27e-22	3.38e-23	0.6546
1. PBF	Q31CB8	Elongation factor 4	0.00e+00	2.64e-70	0.0	0.941
1. PBF	Q8CP13	Elongation factor 4	0.00e+00	2.62e-69	0.0	0.9809
1. PBF	P43729	Elongation factor 4	0.00e+00	1.11e-73	0.0	0.9446
1. PBF	Q3AF13	Elongation factor 4	0.00e+00	6.77e-70	0.0	0.9714
1. PBF	Q1CKE6	Elongation factor 4	0.00e+00	1.09e-75	0.0	0.939
1. PBF	Q4USF4	Elongation factor 4	0.00e+00	8.79e-72	0.0	0.944
1. PBF	O84067	Elongation factor 4	0.00e+00	7.86e-72	0.0	0.9414
1. PBF	A1VRT5	Elongation factor 4	0.00e+00	1.01e-68	0.0	0.9567
1. PBF	P09604	Elongation factor 2	1.88e-13	4.61e-22	8.58e-22	0.67
1. PBF	Q2SSF7	Elongation factor 4	0.00e+00	6.37e-107	0.0	0.9911
1. PBF	Q04KB7	Elongation factor 4	0.00e+00	3.85e-69	0.0	0.9928
1. PBF	B5EB36	Elongation factor 4	0.00e+00	9.25e-68	0.0	0.9647
1. PBF	Q07YZ4	Elongation factor 4	0.00e+00	1.84e-70	0.0	0.9435
1. PBF	B3EH94	Elongation factor G	2.89e-15	3.55e-14	4.91e-19	0.6008
1. PBF	B1IC02	Elongation factor 4	0.00e+00	1.73e-69	0.0	0.9918
1. PBF	B9JDS6	Elongation factor G	1.05e-14	1.27e-15	5.21e-21	0.6193
1. PBF	C1GX39	Translation factor GUF1, mitochondrial	0.00e+00	8.20e-26	5.18e-180	0.9436
1. PBF	C3MVH1	Elongation factor 2	2.13e-10	2.11e-21	9.56e-27	0.5971
1. PBF	B7LDG2	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8946
1. PBF	A4W0W0	Elongation factor 4	0.00e+00	6.00e-66	0.0	0.9885
1. PBF	B5ZYT2	Elongation factor G	9.99e-15	5.37e-16	7.54e-21	0.618
1. PBF	B0CH35	Elongation factor G	0.00e+00	1.68e-16	1.18e-21	0.6394
1. PBF	P60793	Elongation factor 4	0.00e+00	5.56e-71	0.0	0.9467
1. PBF	B8CQJ7	Elongation factor 4	0.00e+00	1.22e-68	0.0	0.9454
1. PBF	B7JNV1	Elongation factor 4	0.00e+00	1.64e-69	0.0	0.9491
1. PBF	A2S9Z3	Elongation factor 4	0.00e+00	3.51e-67	0.0	0.9549
1. PBF	A1RVX2	Elongation factor 2	1.08e-14	2.23e-24	5.34e-20	0.6634
1. PBF	A1CLD7	Translation factor guf1, mitochondrial	0.00e+00	9.26e-25	2.13e-174	0.947
1. PBF	Q57CQ5	Elongation factor G	3.22e-15	1.70e-16	1.19e-20	0.6135
1. PBF	B3EPG7	Elongation factor 4	0.00e+00	2.07e-73	0.0	0.9486
1. PBF	Q21XN4	Elongation factor 4	0.00e+00	5.58e-70	0.0	0.9304
1. PBF	Q8RFD1	Elongation factor 4	0.00e+00	8.54e-72	0.0	0.9614
1. PBF	Q2RNY6	Elongation factor 4	0.00e+00	6.62e-75	0.0	0.9438
1. PBF	B4SRL3	Elongation factor 4	0.00e+00	4.21e-71	0.0	0.9442
1. PBF	Q044A7	Elongation factor 4	0.00e+00	9.60e-75	0.0	0.9798
1. PBF	A4WX88	Elongation factor 4	0.00e+00	6.31e-68	0.0	0.9517
1. PBF	Q662S4	Elongation factor 4	0.00e+00	1.35e-74	0.0	0.9268
1. PBF	A8FFD6	Elongation factor 4	0.00e+00	5.72e-67	0.0	0.9762
1. PBF	Q6G8Y3	Elongation factor 4	0.00e+00	1.69e-69	0.0	0.9765
1. PBF	A2RL76	Elongation factor 4	0.00e+00	1.60e-70	0.0	0.9916
1. PBF	Q1JLY8	Elongation factor 4	0.00e+00	3.09e-69	0.0	0.9814
1. PBF	C5FMX6	Translation factor GUF1, mitochondrial	0.00e+00	6.47e-27	8.26e-170	0.9261
1. PBF	B7MCV5	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	0.6118
1. PBF	Q89AM5	Elongation factor 4	0.00e+00	1.76e-60	0.0	0.9321
1. PBF	Q0BH06	Elongation factor 4	0.00e+00	9.77e-68	0.0	0.9549
1. PBF	A0LI00	Elongation factor 4	0.00e+00	2.84e-74	0.0	0.9507
1. PBF	A5ID24	Elongation factor 4	0.00e+00	5.06e-60	0.0	0.9419
1. PBF	B1IVQ8	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8868
1. PBF	A9WW49	Elongation factor 4	0.00e+00	1.46e-72	0.0	0.9486
1. PBF	P65274	Elongation factor 4	0.00e+00	8.07e-68	0.0	0.9911
1. PBF	Q4WP57	Elongation factor G, mitochondrial	1.33e-15	1.20e-02	5.11e-22	0.6024
1. PBF	Q8TRC3	Elongation factor 2	1.46e-13	4.50e-24	1.69e-20	0.665
1. PBF	Q12KH9	Elongation factor 4	0.00e+00	7.56e-70	0.0	0.9501
1. PBF	B8HLK8	Elongation factor 4	0.00e+00	7.64e-75	0.0	0.9349
1. PBF	Q9I5G8	Elongation factor 4	0.00e+00	1.63e-75	0.0	0.9708
1. PBF	B0TW33	Elongation factor 4	0.00e+00	5.77e-72	0.0	0.9396
1. PBF	B0S8S7	Elongation factor 4	0.00e+00	6.28e-72	0.0	0.925
1. PBF	O93640	Elongation factor 2	1.72e-13	1.18e-24	1.54e-20	0.6718
1. PBF	Q892Q6	Elongation factor 4	0.00e+00	1.78e-67	0.0	0.9734
1. PBF	Q64NK6	Elongation factor G	1.11e-16	1.42e-17	3.79e-18	0.6128
1. PBF	B0KV29	Elongation factor 4	0.00e+00	3.43e-75	0.0	0.8967
1. PBF	P60788	Elongation factor 4	0.00e+00	2.97e-75	0.0	0.8931
1. PBF	Q7V8S4	Elongation factor 4	0.00e+00	2.47e-67	0.0	0.9464
3. BF	Q47RV1	Translation initiation factor IF-2	1.86e-04	NA	5.26e-20	0.7212
3. BF	A0LE19	Translation initiation factor IF-2	2.03e-04	NA	4.85e-13	0.7145
3. BF	B0RDY9	Translation initiation factor IF-2	4.90e-04	NA	7.35e-16	0.7061
3. BF	Q038M5	Translation initiation factor IF-2	2.50e-04	NA	1.86e-16	0.7318
3. BF	B2J955	Translation initiation factor IF-2	2.99e-04	NA	1.35e-13	0.7408
3. BF	B0SH18	Translation initiation factor IF-2	1.87e-04	NA	1.27e-14	0.6902
3. BF	Q5M5V5	Translation initiation factor IF-2	3.63e-05	NA	6.27e-13	0.6905
3. BF	C1CQ48	Translation initiation factor IF-2	2.37e-04	NA	2.25e-13	0.6961
3. BF	A8M746	Translation initiation factor IF-2	3.61e-04	NA	1.68e-18	0.7402
3. BF	A1A0A2	Translation initiation factor IF-2	7.52e-04	NA	5.20e-16	0.7892
3. BF	Q73VV4	Translation initiation factor IF-2	1.27e-04	NA	9.52e-17	0.7182
3. BF	A4FM34	Translation initiation factor IF-2	8.63e-04	NA	4.50e-17	0.7165
3. BF	Q92C29	Translation initiation factor IF-2	2.27e-04	NA	9.02e-18	0.6869
3. BF	B1VGC2	Translation initiation factor IF-2	1.36e-04	NA	3.75e-13	0.7296
3. BF	A1R516	Translation initiation factor IF-2	6.12e-04	NA	1.24e-14	0.7138
3. BF	Q7NH85	Translation initiation factor IF-2	3.44e-04	NA	2.53e-10	0.7215
3. BF	B9IVA1	Translation initiation factor IF-2	3.59e-06	NA	2.18e-15	0.6993
3. BF	Q1BA94	Translation initiation factor IF-2	4.04e-04	NA	4.21e-14	0.7016
3. BF	A5GNJ0	Translation initiation factor IF-2	6.33e-04	NA	3.38e-14	0.7544
3. BF	A5FQR6	Translation initiation factor IF-2	1.91e-05	NA	7.11e-17	0.7317
3. BF	A9BJ54	Translation initiation factor IF-2	4.21e-05	NA	4.24e-20	0.7226
3. BF	Q6NGN2	Translation initiation factor IF-2	1.70e-04	NA	4.76e-15	0.7372
3. BF	A5VJE0	Translation initiation factor IF-2	4.96e-05	NA	4.23e-17	0.6805
3. BF	Q6YR66	Translation initiation factor IF-2	9.66e-05	NA	1.03e-10	0.7606
3. BF	B8I6E7	Translation initiation factor IF-2	1.26e-03	NA	3.36e-19	0.7242
3. BF	A4W3R7	Translation initiation factor IF-2	8.51e-04	NA	1.33e-13	0.39
3. BF	C0ZYA5	Translation initiation factor IF-2	2.88e-04	NA	5.74e-18	0.7162
3. BF	Q6MMS6	Translation initiation factor IF-2	2.48e-04	NA	2.81e-10	0.707
3. BF	B8ZM93	Translation initiation factor IF-2	2.38e-04	NA	2.08e-13	0.6966
3. BF	A6MVX8	Translation initiation factor IF-2, chloroplastic	1.52e-04	NA	4.16e-20	0.7158
3. BF	Q0BK70	Translation initiation factor IF-2	2.71e-04	NA	2.68e-13	0.6855
3. BF	Q6MTQ0	Translation initiation factor IF-2	1.19e-05	NA	5.86e-13	0.7217
3. BF	B5E266	Translation initiation factor IF-2	2.44e-04	NA	2.29e-13	0.696
3. BF	Q5YSC6	Translation initiation factor IF-2	2.78e-04	NA	6.97e-19	0.7259
3. BF	Q82K53	Translation initiation factor IF-2	3.32e-04	NA	6.80e-19	0.7133
3. BF	B8HUA9	Translation initiation factor IF-2	1.24e-04	NA	1.05e-15	0.742
3. BF	A4X4N7	Translation initiation factor IF-2	3.75e-04	NA	8.76e-19	0.7291
3. BF	Q0RDS4	Translation initiation factor IF-2	1.04e-03	NA	3.20e-09	0.7175
3. BF	A6W7Z2	Translation initiation factor IF-2	3.63e-04	NA	2.17e-13	0.7354
3. BF	Q8NP40	Translation initiation factor IF-2	2.33e-04	NA	1.91e-17	0.7167
3. BF	B2A397	Translation initiation factor IF-2	3.20e-05	NA	3.79e-14	0.7057
3. BF	Q5M1B9	Translation initiation factor IF-2	4.84e-05	NA	6.55e-13	0.6904
3. BF	P44323	Translation initiation factor IF-2	3.08e-04	NA	3.76e-19	0.707
3. BF	A7ZS65	Translation initiation factor IF-2	4.68e-04	NA	2.11e-13	0.7208
3. BF	Q2S1N7	Translation initiation factor IF-2	3.73e-04	NA	6.91e-12	0.68
3. BF	Q8YQJ1	Translation initiation factor IF-2	7.55e-04	NA	4.99e-14	0.7073
3. BF	A0PQC4	Translation initiation factor IF-2	1.57e-04	NA	9.64e-17	0.7212
3. BF	A6T0Y8	Translation initiation factor IF-2	4.70e-04	NA	3.55e-18	0.6902
3. BF	A0AIC6	Translation initiation factor IF-2	8.58e-05	NA	7.56e-18	0.7077
3. BF	A4IMD7	Translation initiation factor IF-2	2.63e-04	NA	1.72e-14	0.7124
3. BF	P65132	Translation initiation factor IF-2	1.13e-04	NA	1.97e-15	0.709
3. BF	Q8CJQ8	Translation initiation factor IF-2	3.11e-04	NA	1.14e-16	0.7307
3. BF	Q65JI1	Translation initiation factor IF-2	5.07e-05	NA	6.33e-16	0.7405
3. BF	Q812X7	Translation initiation factor IF-2	3.98e-06	NA	2.88e-15	0.6978
3. BF	Q8A2A1	Translation initiation factor IF-2	8.27e-05	NA	3.57e-14	0.7091
3. BF	Q1R6H0	Translation initiation factor IF-2	4.96e-04	NA	2.11e-13	0.7081
3. BF	B3WER5	Translation initiation factor IF-2	4.39e-05	NA	1.80e-16	0.7318
3. BF	Q01W31	Translation initiation factor IF-2	5.22e-04	NA	2.43e-13	0.7286
3. BF	B1HR05	Translation initiation factor IF-2	3.34e-04	NA	8.33e-14	0.7095
3. BF	Q9Z5I9	Translation initiation factor IF-2	1.27e-04	NA	1.27e-17	0.7293
3. BF	B0CK11	Translation initiation factor IF-2	2.78e-04	NA	2.02e-13	0.7148
3. BF	A1SLK7	Translation initiation factor IF-2	6.54e-04	NA	4.28e-17	0.7451
3. BF	Q2G5E7	Translation initiation factor IF-2	1.54e-04	NA	1.14e-08	0.7063
3. BF	B4RC55	Translation initiation factor IF-2	4.96e-04	NA	2.70e-11	0.7066
3. BF	B1L7T1	Translation initiation factor IF-2	4.16e-05	NA	1.02e-24	0.7547
3. BF	Q5N0A5	Translation initiation factor IF-2	3.03e-04	NA	3.38e-15	0.7319
3. BF	Q318P8	Translation initiation factor IF-2	6.99e-04	NA	7.88e-14	0.7415
3. BF	Q1IZ02	Translation initiation factor IF-2	1.82e-05	NA	9.48e-16	0.7367
3. BF	B8EIA7	Translation initiation factor IF-2	1.45e-04	NA	1.64e-12	0.6836
3. BF	B2HKS2	Translation initiation factor IF-2	1.56e-04	NA	1.05e-16	0.7149
3. BF	A4QEZ2	Translation initiation factor IF-2	2.53e-04	NA	1.88e-17	0.7182
3. BF	C3P5L5	Translation initiation factor IF-2	3.98e-06	NA	6.03e-15	0.6949
3. BF	B4TWD8	Translation initiation factor IF-2	5.12e-04	NA	3.48e-13	0.6683
3. BF	B8HG54	Translation initiation factor IF-2	2.46e-04	NA	5.56e-14	0.7444
3. BF	B7NDF4	Translation initiation factor IF-2	4.76e-04	NA	2.11e-13	0.729
3. BF	Q88VK7	Translation initiation factor IF-2	2.73e-04	NA	1.59e-14	0.6878
3. BF	Q0AK69	Translation initiation factor IF-2	1.99e-04	NA	1.87e-09	0.682
3. BF	Q8ZBC2	Translation initiation factor IF-2	5.11e-04	NA	1.65e-12	0.7065
3. BF	A9M9Z4	Translation initiation factor IF-2	2.78e-04	NA	1.99e-13	0.6893
3. BF	Q03WH4	Translation initiation factor IF-2	4.66e-04	NA	5.83e-16	0.7049
3. BF	C0QTL9	Translation initiation factor IF-2	1.32e-04	NA	5.67e-18	0.6676
3. BF	A8F5A0	Translation initiation factor IF-2	2.62e-05	NA	7.95e-18	0.391
3. BF	Q8FPA7	Translation initiation factor IF-2	2.26e-04	NA	5.88e-16	0.7202
3. BF	A5FV21	Translation initiation factor IF-2	2.03e-04	NA	3.85e-13	0.6953
3. BF	B7GG75	Translation initiation factor IF-2	5.24e-06	NA	2.42e-15	0.7201
3. BF	A4TCF8	Translation initiation factor IF-2	1.31e-04	NA	1.41e-17	0.7206
3. BF	B7HDT6	Translation initiation factor IF-2	3.49e-06	NA	2.88e-15	0.7144
3. BF	Q6AG49	Translation initiation factor IF-2	3.94e-04	NA	1.68e-15	0.6999
3. BF	A0JUU0	Translation initiation factor IF-2	2.77e-04	NA	2.20e-14	0.7136
3. BF	B1MZH4	Translation initiation factor IF-2	1.58e-04	NA	2.80e-16	0.6959
3. BF	B7GNA3	Translation initiation factor IF-2	7.91e-04	NA	2.42e-15	0.7405
3. BF	Q0I3P5	Translation initiation factor IF-2	3.31e-04	NA	2.10e-20	0.6906
3. BF	Q732Q9	Translation initiation factor IF-2	3.37e-06	NA	2.23e-15	0.716
3. BF	Q30WJ0	Translation initiation factor IF-2	2.81e-04	NA	2.99e-12	0.7218
3. BF	B2GKR5	Translation initiation factor IF-2	2.62e-04	NA	1.78e-16	0.7644
3. BF	B2IME4	Translation initiation factor IF-2	2.44e-04	NA	2.13e-13	0.6964
3. BF	Q71ZZ7	Translation initiation factor IF-2	2.32e-04	NA	7.57e-18	0.7109
3. BF	O78489	Translation initiation factor IF-2, chloroplastic	4.63e-05	NA	3.87e-17	0.4047
3. BF	C1AFV3	Translation initiation factor IF-2	1.14e-04	NA	1.97e-15	0.7111
3. BF	B8ZRT4	Translation initiation factor IF-2	5.87e-04	NA	1.27e-17	0.7505
3. BF	B0UU13	Translation initiation factor IF-2	3.15e-04	NA	2.41e-20	0.7113
3. BF	Q5NIL7	Translation initiation factor IF-2	2.73e-04	NA	3.30e-13	0.7048
3. BF	A1UER8	Translation initiation factor IF-2	4.18e-04	NA	4.21e-14	0.7315
3. BF	Q9KA77	Translation initiation factor IF-2	8.68e-06	NA	5.49e-14	0.705
3. BF	Q6HF02	Translation initiation factor IF-2	3.47e-06	NA	2.93e-15	0.6976
3. BF	C1CJ39	Translation initiation factor IF-2	9.82e-04	NA	1.94e-13	0.6966
3. BF	B7IF03	Translation initiation factor IF-2	3.28e-05	NA	1.74e-22	0.6817
3. BF	A1T7H8	Translation initiation factor IF-2	4.47e-04	NA	1.14e-16	0.703
3. BF	Q7VYR2	Translation initiation factor IF-2	7.97e-05	NA	2.13e-18	0.6939
3. BF	A3CQ18	Translation initiation factor IF-2	8.56e-04	NA	2.48e-12	0.7199
3. BF	Q0C5Z5	Translation initiation factor IF-2	1.35e-04	NA	1.64e-12	0.6925
3. BF	B1XI09	Translation initiation factor IF-2	4.03e-04	NA	7.89e-16	0.7487
3. BF	A9ITX6	Translation initiation factor IF-2	7.91e-05	NA	1.40e-18	0.6822
3. BF	Q4QK37	Translation initiation factor IF-2	3.60e-04	NA	9.07e-19	0.7121
3. BF	Q8G3Y5	Translation initiation factor IF-2	8.62e-04	NA	2.13e-15	0.7441
3. BF	Q1GXD6	Translation initiation factor IF-2	3.99e-04	NA	1.77e-19	0.7039
3. BF	C5BWS3	Translation initiation factor IF-2	6.86e-04	NA	5.24e-15	0.7085
3. BF	B1VYN5	Translation initiation factor IF-2	3.14e-04	NA	5.52e-18	0.7298
3. BF	Q6A7M5	Translation initiation factor IF-2	2.09e-04	NA	3.71e-16	0.7245
3. BF	A5U6J1	Translation initiation factor IF-2	1.12e-04	NA	1.97e-15	0.6982
3. BF	B3DQF0	Translation initiation factor IF-2	9.59e-04	NA	2.35e-15	0.7189
3. BF	Q044B7	Translation initiation factor IF-2	3.57e-05	NA	2.07e-18	0.7071
3. BF	C1L2N1	Translation initiation factor IF-2	3.56e-04	NA	7.57e-18	0.6866
3. BF	A8L6F4	Translation initiation factor IF-2	3.53e-04	NA	4.76e-12	0.7229
3. BF	A3PY75	Translation initiation factor IF-2	4.16e-04	NA	4.21e-14	0.7256
3. BF	Q8DBW0	Translation initiation factor IF-2	6.09e-04	NA	6.71e-13	0.7057
3. BF	B8DW43	Translation initiation factor IF-2	1.94e-04	NA	1.69e-16	0.7264
3. BF	Q2NIQ6	Translation initiation factor IF-2	1.03e-04	NA	2.08e-10	0.4048
3. BF	A5UBT6	Translation initiation factor IF-2	3.20e-04	NA	3.56e-19	0.7121
3. BF	A3N005	Translation initiation factor IF-2	3.40e-04	NA	1.03e-18	0.714
3. BF	P9WKK0	Translation initiation factor IF-2	1.09e-04	NA	1.97e-15	0.7119
3. BF	Q72KE8	Translation initiation factor IF-2	1.33e-05	NA	5.50e-17	0.7297
3. BF	C3PH19	Translation initiation factor IF-2	1.40e-04	NA	1.35e-15	0.7398
3. BF	C5C9T1	Translation initiation factor IF-2	1.75e-04	NA	1.88e-14	0.734
3. BF	Q8DQV2	Translation initiation factor IF-2	2.38e-04	NA	1.99e-13	0.6962
3. BF	Q4JV51	Translation initiation factor IF-2	4.55e-04	NA	4.78e-16	0.7226
3. BF	Q9WZN3	Translation initiation factor IF-2	3.93e-05	NA	2.91e-24	0.7233
3. BF	B3H163	Translation initiation factor IF-2	3.36e-04	NA	1.03e-18	0.7138
3. BF	Q0S219	Translation initiation factor IF-2	2.81e-04	NA	2.70e-17	0.7328
3. BF	Q97S57	Translation initiation factor IF-2	4.83e-04	NA	2.42e-13	0.6964
3. BF	Q9XEK9	Translation initiation factor IF-2, chloroplastic (Fragment)	1.66e-04	NA	3.55e-15	0.7478
3. BF	Q04LW0	Translation initiation factor IF-2	9.90e-04	NA	1.99e-13	0.6963
3. BF	C5CDZ4	Translation initiation factor IF-2	5.93e-05	NA	1.50e-18	0.7558
3. BF	B2G6V6	Translation initiation factor IF-2	2.20e-04	NA	4.23e-17	0.6787
3. BF	Q87M02	Translation initiation factor IF-2	3.67e-04	NA	6.36e-13	0.712
3. BF	A8AVQ2	Translation initiation factor IF-2	6.45e-04	NA	1.46e-12	0.7202
3. BF	A5UF34	Translation initiation factor IF-2	3.39e-04	NA	1.04e-18	0.7124
3. BF	A0LV27	Translation initiation factor IF-2	1.11e-04	NA	5.94e-19	0.748
3. BF	B1MD87	Translation initiation factor IF-2	1.22e-04	NA	1.66e-17	0.7258
3. BF	A9VT50	Translation initiation factor IF-2	3.63e-06	NA	3.98e-15	0.7035
3. BF	A6Q226	Translation initiation factor IF-2	1.55e-04	NA	6.52e-18	0.7377
3. BF	A5IJ09	Translation initiation factor IF-2	4.88e-05	NA	8.51e-25	0.7234
3. BF	Q7VA20	Translation initiation factor IF-2	9.45e-04	NA	5.17e-14	0.7373
3. BF	C4L8X4	Translation initiation factor IF-2	5.60e-04	NA	3.01e-14	0.7159
3. BF	C1C5S8	Translation initiation factor IF-2	2.38e-04	NA	2.25e-13	0.6964
3. BF	Q92SW4	Translation initiation factor IF-2	1.80e-04	NA	1.71e-13	0.706
3. BF	C1CCT8	Translation initiation factor IF-2	2.37e-04	NA	1.99e-13	0.6963
3. BF	C1B313	Translation initiation factor IF-2	2.73e-04	NA	2.05e-17	0.7296
3. BF	B1XY67	Translation initiation factor IF-2	6.80e-04	NA	2.73e-16	0.6942
3. BF	A1AMM1	Translation initiation factor IF-2	4.57e-05	NA	4.47e-13	0.709
3. BF	A6LP48	Translation initiation factor IF-2	1.45e-04	NA	1.11e-20	0.7187
3. BF	Q2JSB7	Translation initiation factor IF-2	1.42e-03	NA	9.27e-18	0.7135
3. BF	Q6F1H1	Translation initiation factor IF-2	6.03e-05	NA	1.76e-14	0.7422
3. BF	Q2SSE6	Translation initiation factor IF-2	1.52e-05	NA	9.30e-13	0.7157
3. BF	B0BNR5	Translation initiation factor IF-2	3.29e-04	NA	1.33e-17	0.7128
3. BF	Q636L3	Translation initiation factor IF-2	3.48e-06	NA	2.93e-15	0.6975
3. BF	A8YVQ7	Translation initiation factor IF-2	2.05e-04	NA	1.54e-16	0.3757
3. BF	A1KMI2	Translation initiation factor IF-2	1.10e-04	NA	1.97e-15	0.7117
3. BF	Q835U8	Translation initiation factor IF-2	3.53e-04	NA	7.02e-16	0.7049
3. BF	B2GBN7	Translation initiation factor IF-2	2.73e-04	NA	9.77e-17	0.681
3. BF	Q6LUJ2	Translation initiation factor IF-2	5.63e-04	NA	1.60e-12	0.6874
3. BF	A5CSZ4	Translation initiation factor IF-2	4.82e-04	NA	7.10e-16	0.7251
3. BF	A8FDD1	Translation initiation factor IF-2	8.20e-06	NA	1.28e-17	0.7268
3. BF	C5D9C9	Translation initiation factor IF-2	3.06e-04	NA	1.65e-15	0.723
3. BF	Q3AB98	Translation initiation factor IF-2	9.01e-05	NA	2.92e-16	0.7172
3. BF	A7HN01	Translation initiation factor IF-2	4.75e-05	NA	4.36e-20	0.6979
3. BF	P48515	Translation initiation factor IF-2	1.40e-05	NA	5.50e-17	0.7302
4. PB	B8ELG6	Elongation factor G	5.55e-15	4.44e-15	4.22e-19	NA
4. PB	P57879	Peptide chain release factor 3	3.06e-09	1.27e-09	2.03e-17	NA
4. PB	Q4UXA5	Peptide chain release factor 3	8.80e-07	2.25e-10	1.68e-19	NA
4. PB	Q5X6N0	Peptide chain release factor 3	4.40e-07	2.65e-08	2.76e-20	NA
4. PB	Q9HDF6	Elongation factor 1-alpha	2.89e-06	3.56e-02	4.02e-09	NA
4. PB	P68788	Elongation factor G	1.79e-14	2.46e-17	2.34e-17	NA
4. PB	B2UUV6	Elongation factor G	2.22e-16	1.86e-17	7.54e-19	NA
4. PB	A9KD34	Elongation factor G	0.00e+00	1.42e-17	8.49e-18	NA
4. PB	Q0W8X2	Probable translation initiation factor IF-2	3.75e-04	2.08e-12	5.12e-06	NA
4. PB	B1W417	Elongation factor G	0.00e+00	3.69e-16	6.38e-21	NA
4. PB	Q2YSB4	Elongation factor G	2.50e-14	2.46e-17	2.34e-17	NA
4. PB	B0JIY7	Peptide chain release factor 3	8.87e-08	6.05e-12	1.88e-21	NA
4. PB	B1LHE0	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	B7LEM0	Peptide chain release factor 3	3.45e-09	3.56e-08	2.23e-18	NA
4. PB	A7I3T6	Elongation factor G	0.00e+00	3.57e-17	4.33e-19	NA
4. PB	Q4DKF7	Translation factor GUF1 homolog 1, mitochondrial	0.00e+00	4.95e-17	6.48e-118	NA
4. PB	Q51238	Tetracycline resistance protein TetM	1.44e-15	6.65e-19	2.97e-18	NA
4. PB	A1KGG4	Elongation factor G	4.12e-14	1.22e-15	7.58e-19	NA
4. PB	A5PKR8	Elongation factor G, mitochondrial	1.78e-15	3.31e-11	1.50e-20	NA
4. PB	Q6AP74	Elongation factor G 2	2.28e-14	1.88e-14	4.55e-18	NA
4. PB	A8IAT3	Elongation factor G	1.11e-16	1.03e-15	2.45e-21	NA
4. PB	A3GHT9	Elongation factor G, mitochondrial	9.99e-16	2.22e-06	1.86e-23	NA
4. PB	A1WSZ8	Peptide chain release factor 3	1.53e-06	9.33e-10	2.36e-19	NA
4. PB	Q75CZ5	Elongation factor G, mitochondrial	1.67e-15	3.41e-09	2.70e-24	NA
4. PB	Q83P06	Peptide chain release factor 3	8.08e-09	4.89e-08	2.25e-18	NA
4. PB	B1IPV9	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	A1R6W8	Elongation factor 4	0.00e+00	9.02e-58	0.0	NA
4. PB	C0QQM0	Elongation factor G	3.46e-14	6.88e-18	5.23e-20	NA
4. PB	P69946	Elongation factor G	1.61e-14	1.37e-15	1.38e-19	NA
4. PB	C5DN84	Translation factor GUF1, mitochondrial	0.00e+00	2.16e-41	0.0	NA
4. PB	B8FGS8	Peptide chain release factor 3	2.59e-05	8.90e-09	7.03e-20	NA
4. PB	Q890N8	Elongation factor G	2.22e-16	4.33e-17	1.42e-19	NA
4. PB	B3PLU0	Elongation factor 4	0.00e+00	2.36e-75	0.0	NA
4. PB	A1AME1	Peptide chain release factor 3	2.13e-06	1.03e-08	2.37e-14	NA
4. PB	Q466D5	Probable translation initiation factor IF-2	9.04e-05	8.39e-13	7.29e-05	NA
4. PB	Q9PI16	Elongation factor G	2.22e-16	3.74e-17	2.17e-18	NA
4. PB	A0LLL8	Peptide chain release factor 3	3.04e-07	5.52e-09	3.46e-21	NA
4. PB	B0KCJ7	Elongation factor G	0.00e+00	4.11e-18	2.23e-20	NA
4. PB	Q2A1V8	Peptide chain release factor 3	4.06e-09	6.98e-09	3.20e-20	NA
4. PB	A1WVC5	Elongation factor G	2.22e-16	4.44e-18	3.91e-20	NA
4. PB	C8ZDQ3	Translation factor GUF1, mitochondrial	0.00e+00	3.82e-36	6.28e-174	NA
4. PB	Q875S0	Elongation factor 2	1.96e-08	6.87e-15	6.90e-21	NA
4. PB	Q8XV10	Elongation factor G 1	1.11e-16	4.72e-16	3.68e-18	NA
4. PB	B0RU85	Elongation factor G	1.89e-15	8.30e-17	3.57e-22	NA
4. PB	C0Q0C2	Elongation factor G	1.11e-16	5.19e-19	1.66e-17	NA
4. PB	Q5PIW3	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	Q8TYP6	Elongation factor 1-alpha	3.07e-06	2.52e-02	9.25e-24	NA
4. PB	Q9ZEU4	Elongation factor G	6.00e-15	7.42e-18	1.54e-21	NA
4. PB	Q1D9P5	Elongation factor G 1	1.22e-15	2.92e-16	6.93e-23	NA
4. PB	Q2W2I8	Elongation factor G	0.00e+00	1.17e-15	4.07e-17	NA
4. PB	A4W2D1	Peptide chain release factor 3	4.82e-10	6.40e-08	5.14e-20	NA
4. PB	A4VSN3	Elongation factor G	6.22e-15	8.76e-16	9.75e-20	NA
4. PB	B7GJ64	Elongation factor G	2.34e-14	1.73e-16	6.55e-20	NA
4. PB	B9KHV3	Elongation factor G	0.00e+00	1.29e-16	2.08e-19	NA
4. PB	A5UJM9	Probable translation initiation factor IF-2	8.98e-04	1.64e-12	9.62e-09	NA
4. PB	B2K3I2	Peptide chain release factor 3	1.10e-09	1.95e-08	6.94e-17	NA
4. PB	Q1CMZ7	Peptide chain release factor 3	8.13e-09	1.41e-08	7.07e-17	NA
4. PB	A9B746	Elongation factor G	0.00e+00	2.59e-15	1.66e-20	NA
4. PB	Q9CDG1	Elongation factor G	2.70e-14	2.95e-15	2.73e-19	NA
4. PB	Q8C3X4	Translation factor Guf1, mitochondrial	0.00e+00	2.29e-29	0.0	NA
4. PB	A7ZVR5	Peptide chain release factor 3	7.96e-09	7.16e-08	2.31e-18	NA
4. PB	B8D0C1	Elongation factor G	0.00e+00	1.39e-16	3.25e-20	NA
4. PB	B2SF23	Peptide chain release factor 3	1.48e-12	9.66e-09	6.14e-20	NA
4. PB	Q3J5S5	Elongation factor G	4.44e-16	1.18e-15	3.55e-19	NA
4. PB	Q1LAN7	Elongation factor G 2	1.11e-16	1.87e-15	4.14e-19	NA
4. PB	Q2NW08	Peptide chain release factor 3	2.16e-09	3.14e-09	3.76e-16	NA
4. PB	Q38BU9	Translation factor GUF1 homolog, mitochondrial	0.00e+00	4.61e-12	2.92e-121	NA
4. PB	Q4QMT6	Elongation factor G	0.00e+00	1.29e-17	9.11e-18	NA
4. PB	H9L427	50S ribosomal subunit assembly factor BipA	7.77e-16	6.80e-32	5.00e-46	NA
4. PB	Q6MER8	Elongation factor G	0.00e+00	1.62e-15	1.68e-15	NA
4. PB	O74945	Ribosome assembly protein 1	3.36e-06	1.05e-08	1.21e-22	NA
4. PB	Q5WLR5	Elongation factor G	2.42e-14	8.43e-17	1.86e-20	NA
4. PB	B8AI54	Translation factor GUF1 homolog, chloroplastic	0.00e+00	3.85e-47	0.0	NA
4. PB	A7GZW3	Elongation factor 4	0.00e+00	3.00e-74	0.0	NA
4. PB	B8F7Z4	Elongation factor G	3.89e-15	2.38e-18	4.11e-18	NA
4. PB	Q889X4	Elongation factor G	7.88e-15	5.45e-16	3.24e-20	NA
4. PB	B3CLA3	Elongation factor G	0.00e+00	6.66e-17	5.07e-19	NA
4. PB	Q9K0H6	Peptide chain release factor 3	7.41e-13	2.14e-08	6.01e-21	NA
4. PB	Q0JY21	Peptide chain release factor 3	5.25e-06	2.37e-07	4.58e-20	NA
4. PB	Q6N4T4	Elongation factor G	0.00e+00	1.29e-16	2.23e-20	NA
4. PB	O25225	50S ribosomal subunit assembly factor BipA	3.91e-14	2.81e-30	6.31e-41	NA
4. PB	Q9PPW7	Elongation factor G	2.10e-14	3.08e-17	1.59e-21	NA
4. PB	A8FKR7	Elongation factor G	0.00e+00	3.74e-17	2.17e-18	NA
4. PB	O25122	Elongation factor 4	0.00e+00	6.64e-72	0.0	NA
4. PB	Q0HXQ8	Peptide chain release factor 3	5.18e-12	7.57e-09	4.80e-19	NA
4. PB	B0U0Z1	Elongation factor G	2.22e-16	1.97e-17	5.57e-18	NA
4. PB	A1W018	Elongation factor 4	0.00e+00	3.18e-74	0.0	NA
4. PB	A3MTU7	Probable translation initiation factor IF-2	8.28e-04	7.83e-12	6.77e-07	NA
4. PB	Q6GI64	Peptide chain release factor 3	9.07e-10	1.74e-09	2.90e-18	NA
4. PB	B5FTB7	Peptide chain release factor 3	2.04e-13	1.54e-09	1.64e-18	NA
4. PB	Q31SW4	Peptide chain release factor 3	8.52e-09	7.16e-08	2.31e-18	NA
4. PB	Q5PK12	Peptide chain release factor 3	3.81e-09	1.54e-09	1.64e-18	NA
4. PB	Q5FA25	Peptide chain release factor 3	1.70e-12	1.70e-08	1.94e-21	NA
4. PB	B0RQB0	Peptide chain release factor 3	3.61e-06	2.25e-10	1.68e-19	NA
4. PB	B9DVS2	Elongation factor G	2.23e-14	3.35e-15	1.83e-19	NA
4. PB	Q07803	Elongation factor G, mitochondrial	1.27e-12	8.28e-08	1.29e-21	NA
4. PB	P0DA84	Elongation factor G	1.47e-14	1.37e-15	1.38e-19	NA
4. PB	A5IQA1	Elongation factor G	2.13e-14	2.46e-17	2.34e-17	NA
4. PB	Q601W8	Elongation factor G	1.08e-13	1.41e-16	5.10e-20	NA
4. PB	B3WAM2	Elongation factor G	0.00e+00	1.78e-16	2.86e-20	NA
4. PB	Q9SI75	Elongation factor G, chloroplastic	1.11e-16	3.92e-03	1.64e-14	NA
4. PB	Q5L6S5	Elongation factor G	6.88e-15	2.68e-16	7.70e-20	NA
4. PB	Q48791	Tetracycline resistance protein TetS	5.29e-13	4.18e-18	7.45e-20	NA
4. PB	O64937	Elongation factor 1-alpha	3.47e-06	1.73e-02	4.90e-09	NA
4. PB	Q1GBM0	Elongation factor G	6.11e-15	6.00e-17	2.45e-23	NA
4. PB	A1A0T0	Elongation factor G	2.56e-14	1.24e-17	1.67e-19	NA
4. PB	Q6FLG2	Ribosome-releasing factor 2, mitochondrial	5.13e-12	5.34e-15	7.26e-23	NA
4. PB	Q318N4	Elongation factor G	2.22e-16	5.65e-18	8.30e-20	NA
4. PB	Q9FNM5	Translation factor GUF1 homolog, chloroplastic	0.00e+00	2.76e-16	0.0	NA
4. PB	Q3A6Q0	Elongation factor G 2	0.00e+00	9.89e-15	1.72e-19	NA
4. PB	A7GZJ4	Elongation factor G	0.00e+00	8.25e-18	4.31e-17	NA
4. PB	O84444	Elongation factor G	0.00e+00	9.97e-16	1.60e-17	NA
4. PB	C3PKP1	Elongation factor G	1.11e-16	2.69e-17	1.19e-19	NA
4. PB	B6J266	Elongation factor G	6.33e-15	1.86e-17	7.00e-18	NA
4. PB	P59451	Elongation factor G	0.00e+00	7.49e-17	1.41e-16	NA
4. PB	B9IZJ1	Elongation factor G	2.33e-14	8.89e-18	7.61e-20	NA
4. PB	Q72CI3	Elongation factor G	1.20e-14	2.15e-17	3.10e-19	NA
4. PB	A0QL36	Elongation factor G	0.00e+00	5.14e-16	1.50e-20	NA
4. PB	A6VIS4	Probable translation initiation factor IF-2	3.64e-05	3.22e-14	3.29e-05	NA
4. PB	Q92D33	Peptide chain release factor 3	2.28e-12	1.55e-08	1.58e-16	NA
4. PB	Q824G0	Elongation factor G	8.88e-15	3.14e-16	2.66e-19	NA
4. PB	B0U5X3	Elongation factor G	5.00e-15	4.74e-14	4.47e-20	NA
4. PB	P13549	Elongation factor 1-alpha, somatic form	4.41e-06	1.74e-02	2.54e-08	NA
4. PB	A8F4Q8	Elongation factor G	3.00e-15	1.39e-15	6.87e-20	NA
4. PB	P39677	Ribosome-releasing factor 2, mitochondrial	7.58e-11	8.36e-15	4.48e-19	NA
4. PB	P0A1H3	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	P29691	Elongation factor 2	5.89e-07	2.66e-14	2.11e-17	NA
4. PB	A7Z0N4	Elongation factor G	3.02e-14	5.61e-16	1.33e-20	NA
4. PB	C5CP58	Elongation factor G	0.00e+00	1.13e-16	1.96e-19	NA
4. PB	Q46QA5	Peptide chain release factor 3	7.35e-06	2.64e-07	9.38e-19	NA
4. PB	Q2IJ93	Elongation factor G 1	4.10e-14	1.42e-17	3.20e-21	NA
4. PB	B4GNT0	Ribosome-releasing factor 2, mitochondrial	8.88e-15	7.54e-12	3.51e-18	NA
4. PB	Q9HJ60	Probable translation initiation factor IF-2	1.74e-04	2.96e-12	6.09e-08	NA
4. PB	A1RUX2	Probable translation initiation factor IF-2	8.36e-04	1.61e-11	8.12e-06	NA
4. PB	Q83MZ5	Elongation factor 4	0.00e+00	3.10e-68	0.0	NA
4. PB	A0AHA7	Peptide chain release factor 3	2.21e-12	2.14e-08	1.61e-16	NA
4. PB	Q83ES7	Elongation factor G	7.66e-15	1.33e-17	7.12e-18	NA
4. PB	A0Q4I1	Elongation factor G	1.11e-16	4.08e-16	6.02e-18	NA
4. PB	A8F981	Elongation factor G	2.34e-14	7.38e-17	3.78e-21	NA
4. PB	Q5AL45	Elongation factor G, mitochondrial	0.00e+00	6.74e-09	1.08e-23	NA
4. PB	B5XJR1	Elongation factor G	1.41e-14	3.96e-16	1.34e-19	NA
4. PB	B8GTY2	Peptide chain release factor 3	1.85e-08	6.98e-09	1.14e-18	NA
4. PB	B5F516	Peptide chain release factor 3	9.11e-09	1.54e-09	1.64e-18	NA
4. PB	A7NE28	Peptide chain release factor 3	4.15e-09	6.98e-09	3.20e-20	NA
4. PB	Q5M364	Peptide chain release factor 3	1.51e-09	1.84e-07	2.10e-16	NA
4. PB	A6W5T4	Elongation factor G	0.00e+00	2.79e-15	1.64e-18	NA
4. PB	P15112	Elongation factor 2	6.49e-09	3.75e-14	1.18e-20	NA
4. PB	Q7MA53	Elongation factor G	0.00e+00	2.00e-16	4.89e-18	NA
4. PB	Q8KTB6	Elongation factor G	0.00e+00	5.19e-15	2.43e-20	NA
4. PB	B0WXB8	Translation factor GUF1 homolog, mitochondrial	0.00e+00	7.57e-34	0.0	NA
4. PB	Q53770	Tetracycline resistance protein TetM	4.55e-15	7.53e-19	3.56e-17	NA
4. PB	Q5WZL5	Elongation factor G	0.00e+00	1.65e-17	1.85e-18	NA
4. PB	A5CF23	Elongation factor G	0.00e+00	1.43e-16	6.65e-20	NA
4. PB	Q9KUZ7	Elongation factor G 1	3.66e-15	6.10e-18	5.52e-16	NA
4. PB	Q8DI43	Elongation factor G	7.44e-15	1.02e-17	1.05e-18	NA
4. PB	C0ZVT6	Elongation factor G	1.11e-16	1.55e-15	7.58e-20	NA
4. PB	Q32PH8	Elongation factor 1-alpha 2	2.43e-06	5.36e-03	7.30e-09	NA
4. PB	A7MGA3	Peptide chain release factor 3	4.51e-09	1.02e-09	1.64e-18	NA
4. PB	B0BRI9	Peptide chain release factor 3	3.55e-09	2.66e-09	2.46e-17	NA
4. PB	A6QNM2	Ribosome-releasing factor 2, mitochondrial	1.11e-16	5.01e-06	2.19e-21	NA
4. PB	Q3AMT5	Elongation factor G	2.22e-16	5.49e-17	1.23e-19	NA
4. PB	P0DD96	Peptide chain release factor 3	5.65e-12	2.26e-08	1.75e-17	NA
4. PB	Q6ASC7	Elongation factor G 1	0.00e+00	9.48e-19	6.12e-23	NA
4. PB	A9NEN3	Elongation factor G	3.89e-15	4.64e-18	6.11e-21	NA
4. PB	P53530	Elongation factor 4	0.00e+00	1.62e-38	0.0	NA
4. PB	A8MLD7	Elongation factor G	2.22e-16	4.08e-17	1.69e-17	NA
4. PB	B3RDA4	Peptide chain release factor 3	6.01e-06	1.20e-07	1.04e-19	NA
4. PB	Q6GJC1	Elongation factor G	2.11e-14	2.46e-17	2.34e-17	NA
4. PB	B6JN34	Elongation factor G	1.11e-16	1.53e-17	8.52e-19	NA
4. PB	Q1CUF5	Elongation factor 4	0.00e+00	1.94e-70	0.0	NA
4. PB	Q6NJD6	Elongation factor G	3.33e-16	1.15e-16	8.71e-20	NA
4. PB	Q2GJ60	Elongation factor G	1.11e-16	1.01e-16	2.90e-18	NA
4. PB	Q0AUH7	Elongation factor G 2	4.77e-15	3.57e-17	5.81e-20	NA
4. PB	B3DT30	Elongation factor G	0.00e+00	4.88e-17	6.42e-19	NA
4. PB	Q8Y421	Elongation factor G	3.15e-14	1.42e-17	1.29e-20	NA
4. PB	A6QEJ9	Elongation factor G	2.84e-14	1.72e-17	2.65e-17	NA
4. PB	Q87M30	Elongation factor G 2	0.00e+00	1.22e-16	4.92e-23	NA
4. PB	A4YCV9	Elongation factor 2	3.10e-09	3.54e-22	7.03e-36	NA
4. PB	Q28UW8	Elongation factor G	0.00e+00	5.03e-17	1.04e-18	NA
4. PB	O24534	Elongation factor 1-alpha	3.32e-06	3.39e-02	3.71e-11	NA
4. PB	B2FR00	Peptide chain release factor 3	8.22e-08	2.92e-11	9.72e-21	NA
4. PB	Q9YC19	Elongation factor 2	1.63e-12	3.38e-23	4.36e-28	NA
4. PB	Q8PI56	Peptide chain release factor 3	9.25e-09	2.31e-10	2.21e-19	NA
4. PB	B7HQU1	Elongation factor G	3.14e-14	8.89e-18	7.61e-20	NA
4. PB	Q7MZN3	Peptide chain release factor 3	6.53e-09	1.80e-08	5.08e-18	NA
4. PB	B2SSM9	Peptide chain release factor 3	2.76e-06	1.34e-10	2.83e-19	NA
4. PB	Q6FYA7	Elongation factor 2	2.47e-08	1.80e-13	1.95e-21	NA
4. PB	A8M532	Elongation factor G	2.58e-14	5.83e-17	4.95e-19	NA
4. PB	A7WYX4	Elongation factor G	2.26e-14	2.46e-17	2.34e-17	NA
4. PB	A5DI11	Elongation factor 2	1.01e-07	8.25e-15	2.08e-22	NA
4. PB	P0CT32	Elongation factor 1-alpha	1.44e-05	1.08e-03	1.42e-09	NA
4. PB	P70882	Tetracycline resistance protein TetQ	1.11e-16	4.32e-22	8.77e-18	NA
4. PB	Q55421	Elongation factor G-like protein	1.22e-14	3.60e-12	4.94e-07	NA
4. PB	Q5FLA9	Peptide chain release factor 3	2.39e-07	5.79e-08	4.96e-18	NA
4. PB	Q6CPQ9	Elongation factor 2	2.45e-08	1.40e-14	9.97e-21	NA
4. PB	A9MRB6	Peptide chain release factor 3	4.97e-09	1.82e-09	1.74e-18	NA
4. PB	Q00251	Elongation factor 1-alpha	3.56e-06	3.28e-02	5.10e-09	NA
4. PB	Q8GCP5	Elongation factor 4	0.00e+00	8.52e-73	0.0	NA
4. PB	Q7WDS1	Peptide chain release factor 3	2.17e-06	2.95e-11	4.06e-21	NA
4. PB	Q3J8R1	Elongation factor G	4.33e-15	6.48e-18	6.10e-19	NA
4. PB	A5ELN0	Elongation factor G	2.22e-16	4.60e-17	6.36e-20	NA
4. PB	P25039	Elongation factor G, mitochondrial	1.44e-15	1.37e-09	4.97e-24	NA
4. PB	B2HSL2	Elongation factor G	4.69e-14	1.37e-15	1.54e-20	NA
4. PB	B2G8K6	Peptide chain release factor 3	1.48e-07	5.12e-07	7.89e-17	NA
4. PB	A5GIP1	Elongation factor G	2.22e-16	2.58e-17	4.29e-19	NA
4. PB	A4IZT6	Elongation factor G	2.22e-16	8.04e-16	6.35e-18	NA
4. PB	Q3AW54	Elongation factor G	2.22e-16	2.61e-17	3.47e-19	NA
4. PB	Q9VM33	Elongation factor G, mitochondrial	4.12e-13	9.08e-13	8.05e-21	NA
4. PB	C1CPE5	Elongation factor G	2.50e-14	5.69e-16	1.09e-19	NA
4. PB	Q9KU64	Peptide chain release factor 3	7.80e-09	2.32e-07	1.26e-18	NA
4. PB	Q1QDP8	Peptide chain release factor 3	8.99e-13	1.80e-08	1.81e-18	NA
4. PB	Q83NA0	Elongation factor G	0.00e+00	5.37e-16	5.02e-19	NA
4. PB	A7MKJ6	Elongation factor G	1.11e-16	5.88e-19	1.55e-17	NA
4. PB	B3QBY3	Elongation factor G	2.22e-16	1.29e-16	2.23e-20	NA
4. PB	A5D5I7	Elongation factor G	4.97e-14	1.81e-16	5.95e-20	NA
4. PB	A1VYJ8	Elongation factor G	0.00e+00	7.60e-17	2.25e-18	NA
4. PB	B1MGH8	Elongation factor G	1.11e-16	6.39e-16	8.15e-20	NA
4. PB	Q81VT3	Elongation factor G	2.92e-14	3.93e-18	7.41e-20	NA
4. PB	Q48D33	Elongation factor G	8.10e-15	2.01e-15	1.02e-19	NA
4. PB	B8D9W5	Peptide chain release factor 3	1.38e-07	3.54e-10	8.63e-21	NA
4. PB	Q1J5X1	Peptide chain release factor 3	5.21e-09	2.26e-08	1.75e-17	NA
4. PB	P19039	Elongation factor 1-alpha	1.09e-05	2.13e-03	1.23e-08	NA
4. PB	Q2LUL6	Elongation factor G 2	0.00e+00	3.13e-13	1.32e-20	NA
4. PB	B4NZM7	Elongation factor G, mitochondrial	3.88e-13	4.37e-13	8.27e-21	NA
4. PB	Q21HQ0	Peptide chain release factor 3	3.52e-13	5.06e-08	5.06e-17	NA
4. PB	B1IGF7	Elongation factor G	1.73e-14	1.88e-17	8.95e-20	NA
4. PB	A5USJ2	Elongation factor G	4.44e-15	9.42e-16	2.67e-19	NA
4. PB	A0B8Q6	Probable translation initiation factor IF-2	1.39e-04	3.07e-11	6.22e-07	NA
4. PB	Q00937	Tetracycline resistance protein TetQ	1.11e-16	7.56e-23	1.80e-17	NA
4. PB	Q487Z1	Elongation factor G 1	0.00e+00	2.22e-17	5.87e-26	NA
4. PB	B3CTE7	Elongation factor G	0.00e+00	1.75e-16	6.04e-20	NA
4. PB	B5R2J0	Peptide chain release factor 3	5.37e-09	1.54e-09	1.64e-18	NA
4. PB	B3EP64	Elongation factor G	2.22e-16	7.94e-17	2.96e-18	NA
4. PB	A9KFG7	Peptide chain release factor 3	3.03e-12	9.72e-11	2.40e-22	NA
4. PB	Q01W89	Elongation factor G	2.22e-16	5.66e-17	1.92e-18	NA
4. PB	B0V8Y3	Elongation factor G	0.00e+00	2.03e-17	7.00e-19	NA
4. PB	B4M416	Ribosome-releasing factor 2, mitochondrial	2.40e-11	3.57e-11	7.51e-21	NA
4. PB	B9W892	Ribosome-releasing factor 2, mitochondrial	4.73e-13	8.27e-16	1.98e-23	NA
4. PB	Q1JNH7	Elongation factor G	1.29e-14	1.37e-15	1.38e-19	NA
4. PB	B3LT39	Elongation factor G, mitochondrial	2.00e-15	1.39e-09	5.01e-24	NA
4. PB	P02994	Elongation factor 1-alpha	1.30e-05	4.94e-02	4.82e-09	NA
4. PB	P21598	Tetracycline resistance protein TetM from transposon Tn916	3.77e-15	7.64e-19	2.62e-18	NA
4. PB	B4JSI3	Ribosome-releasing factor 2, mitochondrial	3.77e-15	2.77e-13	8.66e-23	NA
4. PB	Q0HLF4	Peptide chain release factor 3	3.21e-11	7.57e-09	4.80e-19	NA
4. PB	Q7MV56	Elongation factor 4	0.00e+00	9.88e-75	0.0	NA
4. PB	B2GDX1	Elongation factor G	2.68e-14	8.81e-17	1.16e-20	NA
4. PB	Q6D9Z5	Peptide chain release factor 3	9.96e-14	6.99e-10	5.32e-17	NA
4. PB	A6THZ0	Peptide chain release factor 3	3.70e-09	8.48e-10	1.85e-18	NA
4. PB	Q1D513	Elongation factor G 3	0.00e+00	6.10e-18	1.42e-20	NA
4. PB	A5U9R0	Elongation factor G	1.11e-16	1.57e-17	9.52e-18	NA
4. PB	Q83JC3	Elongation factor G	1.11e-16	7.18e-19	1.12e-17	NA
4. PB	Q0SMG2	Elongation factor G 2	1.11e-16	7.94e-17	8.40e-20	NA
4. PB	Q8PC52	Elongation factor G	5.11e-15	8.30e-17	3.57e-22	NA
4. PB	Q73NV3	Elongation factor G 2	3.33e-16	2.34e-18	7.12e-27	NA
4. PB	Q1C2U0	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	Q9FE64	Elongation factor G, mitochondrial	1.37e-13	4.91e-04	1.46e-20	NA
4. PB	C6A4R7	Elongation factor 1-alpha	2.47e-06	2.88e-02	4.79e-17	NA
4. PB	A7FNN9	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	Q17X87	Elongation factor 4	0.00e+00	5.27e-73	0.0	NA
4. PB	Q0SZX7	Elongation factor G	0.00e+00	7.18e-19	1.12e-17	NA
4. PB	Q5LYK1	Peptide chain release factor 3	7.09e-12	1.84e-07	2.10e-16	NA
4. PB	Q74A61	Elongation factor G 1	0.00e+00	8.89e-16	3.12e-19	NA
4. PB	A4IW75	Peptide chain release factor 3	3.77e-09	6.89e-09	3.32e-20	NA
4. PB	Q6FDS6	Elongation factor G	0.00e+00	8.68e-17	1.88e-18	NA
4. PB	O83464	Elongation factor G 2	0.00e+00	6.03e-16	1.43e-18	NA
4. PB	A8YXK3	Elongation factor G	2.96e-14	4.67e-17	2.95e-25	NA
4. PB	Q89J81	Elongation factor G	1.11e-16	2.60e-16	9.79e-20	NA
4. PB	Q87F03	Peptide chain release factor 3	6.98e-08	7.48e-11	4.17e-20	NA
4. PB	Q5XDW4	Elongation factor G	1.58e-14	1.37e-15	1.38e-19	NA
4. PB	Q2JMX8	Elongation factor G	3.33e-16	2.35e-19	4.30e-18	NA
4. PB	Q8E0G1	Peptide chain release factor 3	2.24e-09	4.27e-08	2.09e-17	NA
4. PB	A8GMA0	Elongation factor G	0.00e+00	1.09e-14	2.99e-21	NA
4. PB	Q2G0N1	Elongation factor G	2.09e-14	2.46e-17	2.34e-17	NA
4. PB	Q11UD0	Elongation factor 4	0.00e+00	2.23e-75	0.0	NA
4. PB	B8DIL5	Peptide chain release factor 3	2.87e-12	1.52e-06	1.57e-18	NA
4. PB	Q3K5Y5	Elongation factor G	0.00e+00	8.16e-16	2.99e-19	NA
4. PB	Q5NHX0	Elongation factor G	2.22e-16	4.39e-16	6.40e-18	NA
4. PB	Q9Z9L7	Elongation factor G	1.77e-14	1.56e-16	4.18e-20	NA
4. PB	A7HM55	Elongation factor G	0.00e+00	1.56e-16	6.63e-21	NA
4. PB	B8DEE7	Peptide chain release factor 3	1.65e-10	2.78e-08	1.60e-16	NA
4. PB	Q8P0C7	Peptide chain release factor 3	7.95e-09	2.71e-08	1.81e-17	NA
4. PB	Q30Z38	Elongation factor G	4.61e-14	1.53e-17	1.36e-17	NA
4. PB	P57508	50S ribosomal subunit assembly factor BipA	7.77e-16	7.50e-29	7.78e-34	NA
4. PB	B5XM60	Peptide chain release factor 3	1.01e-12	3.69e-08	1.86e-17	NA
4. PB	B8DAY6	Elongation factor G	1.11e-16	1.42e-17	1.29e-20	NA
4. PB	Q12SW2	Elongation factor G 1	0.00e+00	3.75e-18	1.03e-20	NA
4. PB	P73473	Peptide chain release factor 3	3.76e-06	9.47e-08	3.97e-22	NA
4. PB	P34824	Elongation factor 1-alpha	4.53e-07	1.58e-02	3.00e-09	NA
4. PB	Q088A4	Elongation factor G 2	0.00e+00	4.18e-18	1.41e-24	NA
4. PB	A3CSP4	Probable translation initiation factor IF-2	2.50e-04	1.46e-12	2.42e-04	NA
4. PB	P0CN31	Elongation factor 1-alpha	1.50e-05	3.93e-02	7.83e-12	NA
4. PB	Q67MT5	Peptide chain release factor 3	1.73e-07	2.34e-10	7.75e-21	NA
4. PB	Q5U8S9	Elongation factor G	1.68e-14	5.24e-18	9.75e-20	NA
4. PB	C4K4F9	Elongation factor G	1.35e-13	3.52e-17	3.08e-17	NA
4. PB	P47335	Elongation factor G	5.11e-15	3.57e-17	1.10e-21	NA
4. PB	Q8KTB7	Elongation factor G	0.00e+00	1.87e-15	1.89e-20	NA
4. PB	Q837X4	Peptide chain release factor 3	5.04e-10	1.12e-06	1.68e-16	NA
4. PB	Q0RRS4	Elongation factor G	0.00e+00	3.79e-17	1.39e-18	NA
4. PB	Q02S69	Peptide chain release factor 3	7.72e-12	3.02e-10	2.07e-18	NA
4. PB	P41752	Elongation factor 1-alpha	2.24e-06	1.29e-02	3.94e-08	NA
4. PB	P11131	Tetracycline resistance protein TetM from transposon Tn1545	6.97e-13	1.07e-18	7.26e-18	NA
4. PB	Q3B6G4	Elongation factor G	2.59e-14	1.20e-15	1.50e-19	NA
4. PB	Q7VNX4	Peptide chain release factor 3	9.00e-09	1.24e-09	2.49e-18	NA
4. PB	Q6F0J4	Elongation factor G	1.04e-14	9.89e-15	4.88e-20	NA
4. PB	Q3JMR0	Elongation factor G 2	1.11e-16	5.74e-17	9.66e-17	NA
4. PB	A6RLH0	Elongation factor G, mitochondrial	6.66e-16	1.89e-03	1.55e-21	NA
4. PB	P43925	Elongation factor G	1.11e-16	2.50e-17	8.28e-18	NA
4. PB	Q14JV7	Peptide chain release factor 3	8.92e-13	5.59e-09	3.63e-20	NA
4. PB	P58252	Elongation factor 2	3.85e-08	6.21e-12	8.44e-22	NA
4. PB	A8GQV7	Elongation factor G	0.00e+00	3.91e-15	2.48e-20	NA
4. PB	A5IHR7	Elongation factor G	0.00e+00	1.44e-17	1.71e-18	NA
4. PB	Q1WUZ8	Peptide chain release factor 3	5.25e-10	1.07e-07	4.06e-17	NA
4. PB	B7N0X6	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	A1R8V0	Elongation factor G	7.21e-14	1.04e-15	6.81e-20	NA
4. PB	B9LQL7	Probable translation initiation factor IF-2	7.58e-05	3.91e-14	2.65e-04	NA
4. PB	Q6CZW5	Elongation factor G	1.11e-16	1.31e-18	1.65e-17	NA
4. PB	Q8A474	Elongation factor G	1.11e-16	1.44e-17	2.89e-18	NA
4. PB	Q8ZIR0	Peptide chain release factor 3	8.69e-09	1.41e-08	7.07e-17	NA
4. PB	Q3IMS5	Probable translation initiation factor IF-2	3.48e-05	9.38e-12	2.80e-04	NA
4. PB	Q7WFL2	Elongation factor G 2	0.00e+00	1.02e-16	9.12e-19	NA
4. PB	Q8R602	Elongation factor G	0.00e+00	1.58e-16	6.19e-18	NA
4. PB	Q8SQT7	Elongation factor 2	2.71e-08	1.85e-12	4.68e-22	NA
4. PB	I1K0K6	Elongation factor G-2, chloroplastic	3.33e-16	3.62e-02	1.53e-13	NA
4. PB	Q7Q1K8	Elongation factor G, mitochondrial	3.49e-13	4.63e-15	1.15e-21	NA
4. PB	B1XFI4	Peptide chain release factor 3	1.43e-12	3.56e-08	2.23e-18	NA
4. PB	Q04VH3	Elongation factor G	0.00e+00	3.05e-16	7.78e-22	NA
4. PB	Q62GK2	Elongation factor G 2	1.11e-16	5.74e-17	9.66e-17	NA
4. PB	C4LBU4	Elongation factor G	1.68e-13	9.05e-19	2.43e-17	NA
4. PB	A0JX50	Elongation factor 4	0.00e+00	4.67e-58	0.0	NA
4. PB	Q3APH0	Elongation factor G	2.12e-14	4.74e-14	1.51e-18	NA
4. PB	A9R462	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	Q5L400	Elongation factor G	1.61e-14	3.17e-17	1.86e-20	NA
4. PB	Q17VN9	Elongation factor G	2.22e-16	2.03e-17	8.45e-19	NA
4. PB	B2SDY7	Elongation factor G	1.11e-16	8.04e-16	6.35e-18	NA
4. PB	P09952	Elongation factor G	0.00e+00	4.15e-17	1.25e-18	NA
4. PB	P72749	50S ribosomal subunit assembly factor BipA	0.00e+00	1.15e-26	9.49e-36	NA
4. PB	A5EX85	Elongation factor G	0.00e+00	1.10e-17	2.04e-18	NA
4. PB	Q2FZP4	Peptide chain release factor 3	9.01e-09	3.22e-09	3.53e-18	NA
4. PB	Q8KTB8	Elongation factor G	0.00e+00	4.90e-15	2.37e-20	NA
4. PB	Q4L527	Peptide chain release factor 3	8.93e-10	4.37e-09	1.09e-18	NA
4. PB	B1I9N0	Peptide chain release factor 3	1.59e-09	8.95e-08	4.51e-19	NA
4. PB	Q74GV6	Peptide chain release factor 3	1.08e-08	7.48e-09	9.28e-19	NA
4. PB	A1KRH0	Elongation factor G	2.22e-16	2.18e-19	7.08e-18	NA
4. PB	Q31H08	Peptide chain release factor 3	4.80e-07	9.91e-10	3.74e-19	NA
4. PB	B2USI5	Elongation factor 4	0.00e+00	2.69e-71	0.0	NA
4. PB	B4U0V9	Elongation factor G	1.81e-14	1.35e-15	1.37e-19	NA
4. PB	Q9KPM5	Elongation factor G 2	4.72e-14	3.08e-17	6.46e-23	NA
4. PB	P0DTT0	50S ribosomal subunit assembly factor BipA	1.11e-16	1.93e-32	2.88e-46	NA
4. PB	B4SBU4	Elongation factor G	7.88e-15	1.45e-16	1.54e-19	NA
4. PB	Q12QG7	Peptide chain release factor 3	4.00e-09	1.02e-08	7.00e-18	NA
4. PB	Q49V57	Elongation factor G	1.90e-14	1.65e-18	3.60e-19	NA
4. PB	A5WH45	Peptide chain release factor 3	9.76e-13	6.06e-09	5.60e-21	NA
4. PB	A8PXR7	Elongation factor G, mitochondrial	2.41e-11	2.44e-12	5.13e-20	NA
4. PB	P0DD97	Peptide chain release factor 3	8.70e-13	2.26e-08	1.75e-17	NA
4. PB	Q5FFE7	Elongation factor G	0.00e+00	1.33e-16	9.42e-19	NA
4. PB	B6ENF7	Peptide chain release factor 3	6.88e-09	3.67e-10	7.83e-19	NA
4. PB	A5IG41	Peptide chain release factor 3	4.21e-07	1.35e-08	3.27e-20	NA
4. PB	Q2SSW9	Elongation factor G	5.11e-15	1.07e-16	1.70e-19	NA
4. PB	Q1LSY5	Elongation factor G	4.44e-16	1.05e-16	1.51e-14	NA
4. PB	Q9PGX4	Peptide chain release factor 3	1.20e-06	5.61e-11	4.09e-20	NA
4. PB	Q253F1	Elongation factor G	6.11e-15	4.26e-16	7.64e-20	NA
4. PB	Q1CS71	Elongation factor G	2.22e-16	2.09e-17	3.53e-18	NA
4. PB	C3LJ79	Elongation factor G	2.66e-14	4.71e-18	7.03e-20	NA
4. PB	Q0I0A8	Elongation factor G 1	2.22e-16	4.27e-17	1.02e-20	NA
4. PB	Q9VCX4	Ribosome-releasing factor 2, mitochondrial	8.11e-11	1.85e-11	3.09e-19	NA
4. PB	P0A7I4	Peptide chain release factor RF3	6.71e-09	3.56e-08	2.23e-18	NA
4. PB	A1AGM7	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	A8G9G8	Peptide chain release factor 3	2.00e-09	7.22e-09	4.53e-18	NA
4. PB	A5EVN8	Peptide chain release factor 3	1.29e-06	1.66e-09	1.47e-19	NA
4. PB	Q6AEB5	Elongation factor 4	0.00e+00	6.55e-60	0.0	NA
4. PB	Q87M18	Peptide chain release factor 3	7.74e-09	2.45e-08	2.52e-20	NA
4. PB	C3KVQ4	Elongation factor G	1.04e-14	6.19e-18	7.70e-20	NA
4. PB	A0SXL6	Elongation factor 2	3.05e-08	1.55e-11	8.74e-22	NA
4. PB	A4VYX6	Elongation factor G	6.22e-15	8.76e-16	9.75e-20	NA
4. PB	B3QY21	Elongation factor G	3.94e-14	3.70e-15	3.31e-19	NA
4. PB	Q5NIF4	Peptide chain release factor 3	8.13e-13	5.59e-09	3.63e-20	NA
4. PB	Q7SH14	Elongation factor G, mitochondrial	2.00e-15	2.44e-02	9.44e-22	NA
4. PB	Q9XV52	Elongation factor G, mitochondrial	3.33e-16	7.65e-14	5.65e-20	NA
4. PB	Q6C9Y6	Elongation factor G, mitochondrial	8.84e-14	2.03e-12	1.58e-24	NA
4. PB	C1C5H4	Peptide chain release factor 3	1.60e-09	1.67e-07	4.55e-19	NA
4. PB	Q8TQL5	Probable translation initiation factor IF-2	2.31e-04	4.73e-12	4.80e-05	NA
4. PB	Q03JD8	Peptide chain release factor 3	1.32e-10	1.92e-07	2.08e-16	NA
4. PB	Q2IXR3	Elongation factor G	0.00e+00	2.03e-16	3.15e-20	NA
4. PB	Q92005	Elongation factor 1-alpha	1.67e-05	3.75e-03	3.58e-08	NA
4. PB	P38525	Elongation factor G	0.00e+00	4.53e-17	1.20e-19	NA
4. PB	Q932I8	Tetracycline resistance protein TetM	8.36e-13	2.92e-19	2.42e-18	NA
4. PB	A9MT06	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	O08810	116 kDa U5 small nuclear ribonucleoprotein component	2.07e-06	8.62e-06	1.25e-19	NA
4. PB	A4SHV8	Elongation factor G	1.69e-13	8.30e-17	6.76e-17	NA
4. PB	Q8F983	Elongation factor G	0.00e+00	4.45e-16	6.75e-22	NA
4. PB	Q5P335	Elongation factor G	1.11e-16	1.37e-16	1.46e-17	NA
4. PB	B0K5P0	Elongation factor G	3.11e-15	4.11e-18	2.23e-20	NA
4. PB	A1SNN6	Elongation factor G	1.11e-16	1.45e-15	5.31e-20	NA
4. PB	Q8KTB0	Elongation factor G	0.00e+00	8.68e-17	1.23e-19	NA
4. PB	P43643	Elongation factor 1-alpha	3.78e-06	7.78e-03	9.65e-10	NA
4. PB	P41084	Elongation factor G	0.00e+00	5.12e-15	1.68e-20	NA
4. PB	Q2G8Y3	Elongation factor G	5.44e-15	2.01e-15	6.38e-18	NA
4. PB	P60791	Elongation factor 4	0.00e+00	1.81e-33	0.0	NA
4. PB	O05197	Tetracycline resistance protein TetQ	1.11e-15	1.55e-21	2.91e-17	NA
4. PB	Q96X45	Elongation factor 2	6.34e-08	3.40e-15	8.03e-22	NA
4. PB	B1GZ80	Elongation factor G	1.11e-16	5.49e-17	8.07e-24	NA
4. PB	P18667	Elongation factor G	0.00e+00	2.36e-17	6.99e-20	NA
4. PB	P68105	Elongation factor 1-alpha 1	1.62e-05	7.26e-03	4.26e-08	NA
4. PB	Q99V72	Peptide chain release factor 3	7.32e-09	2.96e-09	3.29e-18	NA
4. PB	Q9PA90	Elongation factor G	4.88e-15	4.74e-14	4.43e-20	NA
4. PB	Q086G5	Peptide chain release factor 3	4.40e-12	9.77e-09	8.12e-19	NA
4. PB	A6Q6I6	Elongation factor G	1.11e-16	4.67e-17	7.33e-17	NA
4. PB	A4IJI6	Elongation factor G	4.09e-14	1.07e-16	4.77e-20	NA
4. PB	Q72VM5	Elongation factor G	0.00e+00	4.45e-16	6.75e-22	NA
4. PB	Q73F99	Elongation factor G	2.89e-14	4.05e-18	7.61e-20	NA
4. PB	Q1JIM6	Elongation factor G	1.58e-14	1.37e-15	1.38e-19	NA
4. PB	Q0IFX5	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.52e-29	0.0	NA
4. PB	Q2L2H1	Elongation factor G 1	1.11e-16	3.57e-17	5.57e-17	NA
4. PB	Q2N9A7	Elongation factor G	0.00e+00	5.43e-14	1.29e-14	NA
4. PB	Q5N192	Peptide chain release factor 3	1.95e-07	3.77e-08	2.33e-22	NA
4. PB	C5BGM8	Elongation factor G	0.00e+00	1.23e-16	2.59e-18	NA
4. PB	C1CIF3	Elongation factor G	1.97e-14	5.22e-16	8.93e-20	NA
4. PB	A8Z666	Elongation factor G	1.11e-16	9.48e-17	1.01e-18	NA
4. PB	Q5E7K1	Peptide chain release factor 3	9.81e-12	1.09e-09	1.75e-19	NA
4. PB	B3LQ11	Ribosome-releasing factor 2, mitochondrial	7.92e-11	8.36e-15	4.48e-19	NA
4. PB	Q4ZNI9	Peptide chain release factor 3	1.04e-11	9.56e-10	6.58e-19	NA
4. PB	Q5L8A7	Elongation factor G	2.22e-16	1.42e-17	3.79e-18	NA
4. PB	Q5UZS7	Elongation factor 2	1.01e-09	8.08e-23	7.58e-23	NA
4. PB	Q60BD3	Elongation factor G 1	9.99e-15	2.29e-17	2.80e-25	NA
4. PB	B3N6A5	Elongation factor G, mitochondrial	4.09e-13	2.62e-14	8.05e-21	NA
4. PB	B3GZM0	Peptide chain release factor 3	5.22e-09	5.59e-09	2.48e-17	NA
4. PB	Q9C641	Elongation factor G-1, mitochondrial	1.69e-13	1.44e-07	2.30e-21	NA
4. PB	P43928	Peptide chain release factor 3	6.58e-09	1.22e-08	2.68e-18	NA
4. PB	B1I8Z9	Elongation factor G	2.09e-14	3.53e-16	1.08e-19	NA
4. PB	Q4FLL6	Elongation factor G	2.22e-16	2.99e-17	1.23e-20	NA
4. PB	P0A6N0	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	Q7V501	Elongation factor G	0.00e+00	2.00e-17	4.85e-19	NA
4. PB	B4TKM1	Elongation factor G	1.11e-16	5.19e-19	1.66e-17	NA
4. PB	A2RI79	Peptide chain release factor 3	1.30e-07	2.21e-08	2.63e-20	NA
4. PB	A5GW13	Elongation factor G	0.00e+00	2.00e-17	1.15e-18	NA
4. PB	Q7W2F8	Elongation factor G 1	0.00e+00	2.25e-17	5.72e-17	NA
4. PB	B3DSA9	Elongation factor 4	0.00e+00	3.13e-59	0.0	NA
4. PB	Q8EIJ7	Elongation factor G 2	0.00e+00	3.47e-17	2.47e-23	NA
4. PB	Q3ZZM6	Elongation factor G	1.17e-13	1.94e-17	6.07e-20	NA
4. PB	Q5HU70	Elongation factor 4	0.00e+00	9.07e-75	0.0	NA
4. PB	O94429	Ribosome-releasing factor 2, mitochondrial	6.85e-11	2.58e-19	1.09e-21	NA
4. PB	Q6FR62	Translation factor GUF1, mitochondrial	0.00e+00	7.15e-25	0.0	NA
4. PB	Q3BWY7	Elongation factor G	1.12e-14	2.32e-17	2.42e-22	NA
4. PB	A7H311	Elongation factor 4	0.00e+00	2.22e-72	0.0	NA
4. PB	Q9VRH6	Translation factor waclaw, mitochondrial	0.00e+00	1.17e-14	0.0	NA
4. PB	B1VY28	Elongation factor 4	0.00e+00	2.64e-54	0.0	NA
4. PB	B1WUP2	Peptide chain release factor 3	1.01e-06	2.07e-10	2.88e-22	NA
4. PB	Q1IEF7	Peptide chain release factor 3	9.72e-12	7.07e-10	2.50e-18	NA
4. PB	A7IFX8	Elongation factor G	1.11e-16	8.52e-16	6.07e-21	NA
4. PB	B5R297	Elongation factor G	1.11e-16	5.19e-19	1.66e-17	NA
4. PB	B9EAS8	Peptide chain release factor 3	8.74e-10	3.18e-09	2.05e-16	NA
4. PB	A9WSW6	Elongation factor G	0.00e+00	2.76e-16	2.88e-19	NA
4. PB	Q9ZM93	Elongation factor 4	0.00e+00	1.94e-70	0.0	NA
4. PB	B3QZH4	Elongation factor G	5.66e-15	1.78e-16	1.85e-21	NA
4. PB	C1A6Q2	Elongation factor G	0.00e+00	3.59e-15	5.34e-18	NA
4. PB	B7I7S1	Elongation factor G	0.00e+00	2.03e-17	7.00e-19	NA
4. PB	Q0AXN1	Elongation factor G 1	1.47e-14	2.76e-16	2.04e-19	NA
4. PB	Q7NGL0	Peptide chain release factor 3	1.97e-07	4.37e-11	1.06e-21	NA
4. PB	Q05639	Elongation factor 1-alpha 2	1.25e-05	5.36e-03	7.30e-09	NA
4. PB	B2FQ42	Elongation factor G	0.00e+00	1.07e-16	1.94e-21	NA
4. PB	B4RSU5	Elongation factor G	1.11e-16	9.34e-19	2.91e-22	NA
4. PB	Q8FS85	Elongation factor G	1.02e-14	2.25e-16	3.24e-21	NA
4. PB	P0A3B4	50S ribosomal subunit assembly factor BipA	1.11e-16	1.93e-32	2.88e-46	NA
4. PB	Q0HRE9	Elongation factor G 2	0.00e+00	8.00e-18	1.03e-23	NA
4. PB	Q04M39	Peptide chain release factor 3	2.61e-09	1.54e-07	4.84e-19	NA
4. PB	Q5R4R8	Elongation factor 1-alpha 1	3.57e-06	7.26e-03	4.26e-08	NA
4. PB	A6VL11	Elongation factor G	1.11e-16	3.17e-17	6.95e-18	NA
4. PB	A7IAP7	Probable translation initiation factor IF-2	3.44e-05	5.27e-13	3.39e-07	NA
4. PB	Q8YP62	Elongation factor G	3.33e-16	6.86e-17	2.63e-19	NA
4. PB	Q8P6V6	Peptide chain release factor 3	2.18e-06	2.25e-10	1.68e-19	NA
4. PB	B4SSC0	Peptide chain release factor 3	5.54e-08	1.40e-11	1.39e-20	NA
4. PB	Q02652	Tetracycline resistance protein TetM	5.55e-15	8.12e-18	1.46e-15	NA
4. PB	B9F2U5	Translation factor GUF1 homolog, chloroplastic	0.00e+00	4.45e-19	0.0	NA
4. PB	C5C0J4	Elongation factor G	0.00e+00	4.20e-16	4.42e-19	NA
4. PB	B7NH42	Peptide chain release factor 3	4.01e-09	3.56e-08	2.23e-18	NA
4. PB	Q748Y8	Elongation factor G 2	0.00e+00	9.34e-17	6.69e-18	NA
4. PB	P08736	Elongation factor 1-alpha 1	1.26e-06	2.07e-03	3.56e-08	NA
4. PB	Q39DL2	Elongation factor G 2	0.00e+00	2.03e-17	4.36e-19	NA
4. PB	Q7MH42	Elongation factor G 1	3.77e-15	6.67e-16	1.54e-17	NA
4. PB	Q8NXC0	Peptide chain release factor 3	1.89e-08	1.74e-09	2.90e-18	NA
4. PB	B2J573	Peptide chain release factor 3	7.20e-06	1.01e-10	5.44e-20	NA
4. PB	B6J0P2	Peptide chain release factor 3	4.91e-07	2.25e-10	1.18e-22	NA
4. PB	C3K5A9	Peptide chain release factor 3	9.33e-12	2.23e-09	1.07e-18	NA
4. PB	Q4AAQ8	Elongation factor 4	0.00e+00	1.77e-76	0.0	NA
4. PB	Q5M2M6	Elongation factor G	1.38e-14	4.45e-16	8.40e-20	NA
4. PB	Q8YP23	Peptide chain release factor 3	6.37e-07	2.74e-11	6.00e-20	NA
4. PB	Q8Y8C0	Peptide chain release factor 3	1.45e-12	2.42e-08	1.54e-16	NA
4. PB	Q92J93	Elongation factor G	3.33e-16	3.54e-15	2.48e-20	NA
4. PB	A4SCQ6	Elongation factor G	1.03e-14	3.96e-16	1.41e-19	NA
4. PB	Q63WJ7	Elongation factor G 1	1.11e-16	1.94e-17	8.31e-19	NA
4. PB	B6JET0	Elongation factor G	1.11e-16	3.47e-17	1.23e-19	NA
4. PB	A1CXG4	Elongation factor G, mitochondrial	2.80e-14	6.11e-03	4.55e-22	NA
4. PB	Q13TG7	Elongation factor G 2	0.00e+00	9.62e-17	2.51e-17	NA
4. PB	Q2S3R7	Elongation factor G	0.00e+00	1.48e-17	3.75e-19	NA
4. PB	Q6GBU0	Elongation factor G	2.11e-14	2.46e-17	2.34e-17	NA
4. PB	A2BT84	Elongation factor G	1.11e-16	4.37e-18	6.48e-20	NA
4. PB	Q9PJV6	Elongation factor G	9.10e-15	5.61e-16	3.10e-17	NA
4. PB	Q8CQ82	Elongation factor G	2.54e-14	2.54e-17	1.51e-19	NA
4. PB	Q6GAQ7	Peptide chain release factor 3	1.00e-08	1.74e-09	2.90e-18	NA
4. PB	A6WDJ3	Elongation factor 4	0.00e+00	1.88e-57	0.0	NA
4. PB	Q7N9B2	Elongation factor G	2.01e-14	4.40e-17	4.19e-17	NA
4. PB	Q46IW3	Elongation factor G	0.00e+00	1.10e-17	6.31e-19	NA
4. PB	A2BN41	Elongation factor 1-alpha	3.09e-06	2.83e-02	2.81e-19	NA
4. PB	Q17152	Elongation factor 2	2.67e-12	5.86e-13	1.74e-16	NA
4. PB	F4IW10	Elongation factor G-2, mitochondrial	1.94e-13	3.47e-07	2.30e-21	NA
4. PB	Q6L200	Elongation factor 2	5.33e-10	1.91e-23	9.20e-22	NA
4. PB	P56002	Elongation factor G	2.22e-16	1.70e-17	3.44e-18	NA
4. PB	B4MZW9	Elongation factor G, mitochondrial	4.06e-13	1.88e-14	4.27e-21	NA
4. PB	B1YGU7	Elongation factor G	7.88e-15	5.18e-17	6.50e-20	NA
4. PB	P17508	Elongation factor 1-alpha, oocyte form	3.62e-06	2.93e-03	1.23e-10	NA
4. PB	B5F8F8	Elongation factor G	1.11e-16	5.19e-19	1.66e-17	NA
4. PB	Q9JHW4	Selenocysteine-specific elongation factor	2.43e-05	1.86e-08	2.20e-08	NA
4. PB	O13869	Translation factor guf1, mitochondrial	0.00e+00	1.29e-20	1.18e-179	NA
4. PB	C4ZT56	Peptide chain release factor 3	1.96e-12	3.56e-08	2.23e-18	NA
4. PB	Q05FI2	Elongation factor G	0.00e+00	1.98e-19	7.33e-19	NA
4. PB	A2STF0	Elongation factor 1-alpha	3.09e-06	3.23e-02	2.47e-21	NA
4. PB	Q8KAG9	Elongation factor G	6.55e-15	2.58e-17	1.93e-18	NA
4. PB	A7HWQ8	Elongation factor G	0.00e+00	2.06e-16	4.02e-17	NA
4. PB	Q8K935	Peptide chain release factor 3	3.92e-09	4.65e-11	1.24e-19	NA
4. PB	B4TXE8	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	O87844	Elongation factor G 2	0.00e+00	2.58e-17	3.50e-22	NA
4. PB	B4T4G3	Peptide chain release factor 3	8.29e-09	1.54e-09	1.64e-18	NA
4. PB	Q211E5	Elongation factor G	9.77e-15	6.12e-16	1.17e-20	NA
4. PB	P20174	Tetracycline resistance protein TetO	8.34e-13	2.35e-19	2.50e-19	NA
4. PB	Q5AAV3	Ribosome-releasing factor 2, mitochondrial	6.97e-13	3.57e-17	1.80e-22	NA
4. PB	P28996	Elongation factor 2	6.24e-13	5.29e-14	9.37e-24	NA
4. PB	A9BHA8	Elongation factor G	1.11e-16	2.35e-16	8.58e-20	NA
4. PB	Q7Q3I6	Ribosome-releasing factor 2, mitochondrial	1.56e-13	1.08e-11	3.04e-23	NA
4. PB	Q5R1X2	Elongation factor 1-alpha 1	4.16e-06	7.26e-03	4.26e-08	NA
4. PB	A9A813	Probable translation initiation factor IF-2	1.65e-04	4.48e-14	1.31e-05	NA
4. PB	Q88FI4	Elongation factor G 2	2.76e-14	4.14e-16	6.54e-21	NA
4. PB	B2V7L6	Elongation factor G	4.73e-14	6.28e-18	2.35e-19	NA
4. PB	Q9Y9B3	Probable translation initiation factor IF-2	1.53e-04	1.20e-12	0.004	NA
4. PB	C5D3R4	Elongation factor G	2.78e-14	1.83e-16	6.50e-20	NA
4. PB	P0A3B2	50S ribosomal subunit assembly factor BipA	0.00e+00	1.93e-32	2.88e-46	NA
4. PB	Q5UXU6	Probable translation initiation factor IF-2	3.31e-05	1.09e-11	4.16e-05	NA
4. PB	P34823	Elongation factor 1-alpha	4.20e-07	9.48e-03	3.17e-08	NA
4. PB	A7ZCJ3	Elongation factor 4	0.00e+00	2.20e-74	0.0	NA
4. PB	Q8DR09	Peptide chain release factor 3	1.66e-09	1.54e-07	4.84e-19	NA
4. PB	A6VGV5	Elongation factor 2	1.93e-11	3.86e-20	9.80e-22	NA
4. PB	P27592	Elongation factor 1-alpha	1.40e-05	7.14e-03	6.51e-08	NA
4. PB	Q7VRN9	Elongation factor G	3.16e-14	4.58e-16	1.28e-14	NA
4. PB	B8D867	Peptide chain release factor 3	4.56e-13	3.86e-10	2.31e-20	NA
4. PB	Q2S6X1	Elongation factor G 2	0.00e+00	1.01e-16	4.29e-23	NA
4. PB	Q63Q08	Elongation factor G 2	1.11e-16	5.74e-17	9.66e-17	NA
4. PB	Q5NQ66	Elongation factor G	6.00e-15	2.42e-16	4.19e-17	NA
4. PB	Q5HRK5	Elongation factor G	2.12e-14	2.54e-17	1.51e-19	NA
4. PB	B6JKS8	Elongation factor 4	0.00e+00	1.54e-71	0.0	NA
4. PB	A7A1H2	Translation factor GUF1, mitochondrial	0.00e+00	3.82e-36	6.28e-174	NA
4. PB	B5E6U5	Elongation factor G	1.90e-14	4.52e-16	1.11e-19	NA
4. PB	B4EWB0	Peptide chain release factor 3	2.02e-08	1.10e-08	4.01e-17	NA
4. PB	A9BCK1	Elongation factor G	0.00e+00	1.55e-17	1.58e-19	NA
4. PB	A3QGT8	Peptide chain release factor 3	6.67e-13	2.42e-08	2.40e-18	NA
4. PB	B1LWS3	Elongation factor G	0.00e+00	1.39e-16	1.06e-19	NA
4. PB	Q327M2	Peptide chain release factor 3	6.87e-14	3.56e-08	2.23e-18	NA
4. PB	Q2KV83	Elongation factor G 2	1.11e-16	1.15e-17	4.88e-19	NA
4. PB	B7VJG2	Peptide chain release factor 3	6.62e-13	7.06e-09	2.06e-20	NA
4. PB	Q134S6	Elongation factor G	2.22e-16	8.18e-17	2.78e-20	NA
4. PB	Q1WVA0	Elongation factor G	3.83e-14	5.61e-16	2.29e-21	NA
4. PB	B9K883	Elongation factor G	0.00e+00	6.96e-16	9.53e-20	NA
4. PB	Q6M0I6	Probable translation initiation factor IF-2	1.43e-04	3.18e-14	3.23e-05	NA
4. PB	Q21M87	Elongation factor G 2	0.00e+00	1.75e-17	6.09e-23	NA
4. PB	A7TQJ9	Ribosome-releasing factor 2, mitochondrial	7.41e-11	7.38e-17	2.76e-21	NA
4. PB	C1KZK7	Elongation factor G	3.02e-14	1.42e-17	1.29e-20	NA
4. PB	Q2JFH9	Elongation factor G	6.07e-14	1.07e-16	1.41e-18	NA
4. PB	Q6YQV9	Elongation factor G	1.10e-14	9.16e-18	2.24e-22	NA
4. PB	A8WTI8	Elongation factor G, mitochondrial	1.41e-13	1.65e-11	1.78e-19	NA
4. PB	Q03PV4	Elongation factor G	6.77e-15	2.60e-16	6.10e-22	NA
4. PB	Q5PBH2	Elongation factor G	0.00e+00	7.49e-17	2.14e-19	NA
4. PB	Q57G48	Peptide chain release factor 3	4.90e-09	1.54e-09	1.64e-18	NA
4. PB	Q1BRU5	Elongation factor G 2	1.11e-16	1.89e-16	2.40e-16	NA
4. PB	A5DTX8	Ribosome-releasing factor 2, mitochondrial	6.31e-13	8.17e-13	4.04e-21	NA
4. PB	O07631	50S ribosomal subunit assembly factor BipA	7.36e-11	2.33e-30	2.88e-40	NA
4. PB	Q2GFN5	Elongation factor G	0.00e+00	9.62e-17	6.14e-19	NA
4. PB	A1BJ37	Elongation factor G	9.44e-15	1.01e-15	3.59e-17	NA
4. PB	Q15W54	Peptide chain release factor 3	6.81e-12	1.66e-09	2.29e-21	NA
4. PB	Q73R08	Elongation factor G 1	0.00e+00	9.91e-17	1.23e-19	NA
4. PB	B6QHL4	Elongation factor G, mitochondrial	2.44e-15	1.05e-02	2.79e-24	NA
4. PB	P9WNM7	Elongation factor G	1.11e-16	1.22e-15	7.58e-19	NA
4. PB	P17506	Elongation factor 1-alpha	3.29e-06	4.37e-02	5.61e-09	NA
4. PB	B8MR69	Ribosome-releasing factor 2, mitochondrial	1.42e-08	3.80e-09	1.95e-16	NA
4. PB	Q5YPG3	Elongation factor G	0.00e+00	3.65e-15	1.96e-20	NA
4. PB	B2U2U7	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	Q8KTB4	Elongation factor G	3.33e-16	3.65e-15	1.31e-20	NA
4. PB	B0G189	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.23e-16	0.0	NA
4. PB	P68790	Elongation factor G	2.20e-14	2.46e-17	2.34e-17	NA
4. PB	Q2FI57	Peptide chain release factor 3	1.26e-08	3.22e-09	3.53e-18	NA
4. PB	Q2LTB9	Elongation factor G 1	0.00e+00	3.47e-17	1.47e-22	NA
4. PB	A5FRY7	Elongation factor G	1.15e-13	1.94e-17	6.07e-20	NA
4. PB	B8N9M2	Elongation factor G, mitochondrial	8.16e-14	5.70e-03	6.70e-23	NA
4. PB	Q5SHN5	Elongation factor G	0.00e+00	1.95e-15	9.43e-22	NA
4. PB	A5VLK8	Elongation factor G	2.74e-14	4.46e-17	1.83e-21	NA
4. PB	Q9JX07	Elongation factor G	0.00e+00	2.18e-19	7.08e-18	NA
4. PB	B5FJM0	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	Q47LJ0	Elongation factor G	1.11e-16	8.81e-17	3.93e-21	NA
4. PB	Q3IJW9	Elongation factor G 2	3.00e-15	2.38e-18	6.71e-26	NA
4. PB	B9E8Q1	Elongation factor G	2.48e-14	1.57e-18	2.58e-20	NA
4. PB	Q5GSU1	Elongation factor G	0.00e+00	1.08e-16	6.98e-19	NA
4. PB	P23835	Tetracycline resistance protein TetO	7.47e-13	6.35e-19	6.71e-19	NA
4. PB	B8HVR8	Elongation factor G	3.33e-16	9.34e-17	4.89e-15	NA
4. PB	Q7NAT2	Elongation factor 4	0.00e+00	1.04e-68	0.0	NA
4. PB	A8Z0C4	Peptide chain release factor 3	1.36e-08	3.22e-09	3.53e-18	NA
4. PB	B1I1I5	Elongation factor G	0.00e+00	1.95e-15	8.09e-21	NA
4. PB	A9NAM1	Elongation factor G	6.44e-15	1.33e-17	7.12e-18	NA
4. PB	Q00080	Elongation factor 1-alpha	3.10e-06	3.71e-02	6.89e-10	NA
4. PB	Q118Z3	Elongation factor G 1	3.33e-16	5.16e-18	5.85e-18	NA
4. PB	A5IZ33	Elongation factor G	1.11e-16	1.45e-15	6.72e-19	NA
4. PB	P34617	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.33e-46	2.79e-169	NA
4. PB	A2S7H3	Elongation factor G	1.11e-16	5.74e-17	9.66e-17	NA
4. PB	A6VU13	Peptide chain release factor 3	8.29e-12	3.07e-08	1.74e-16	NA
4. PB	B7LXT6	Peptide chain release factor 3	1.78e-12	6.70e-08	2.41e-18	NA
4. PB	Q2NGM6	Probable translation initiation factor IF-2	2.81e-04	1.57e-14	1.01e-04	NA
4. PB	Q6FUQ6	Elongation factor G, mitochondrial	1.55e-15	7.89e-10	3.50e-24	NA
4. PB	Q492B1	Elongation factor G	1.11e-16	1.05e-16	8.83e-17	NA
4. PB	Q8C0D5	Elongation factor-like GTPase 1	1.08e-02	2.16e-06	3.37e-25	NA
4. PB	Q1H0I2	Peptide chain release factor 3	2.15e-06	1.76e-08	8.02e-21	NA
4. PB	B6J6N8	Peptide chain release factor 3	4.16e-07	9.96e-11	1.63e-22	NA
4. PB	Q98QD8	Elongation factor G	2.22e-16	8.37e-18	1.11e-19	NA
4. PB	P9WNM9	Elongation factor G-like protein	6.66e-16	5.27e-13	0.002	NA
4. PB	P10952	Tetracycline resistance protein TetO	5.55e-16	6.35e-19	4.97e-19	NA
4. PB	Q09069	Elongation factor 1-alpha	2.83e-06	5.90e-03	6.92e-10	NA
4. PB	O14460	Elongation factor 2	8.78e-08	8.50e-13	5.16e-22	NA
4. PB	Q9HNQ2	Probable translation initiation factor IF-2	3.39e-05	5.27e-13	9.15e-07	NA
4. PB	Q1GB78	Peptide chain release factor 3	5.57e-08	5.85e-08	3.01e-19	NA
4. PB	Q0SMX0	Elongation factor G 1	1.11e-16	2.50e-19	9.30e-24	NA
4. PB	C6DG80	Elongation factor G	0.00e+00	1.12e-18	1.69e-17	NA
4. PB	A6LPQ8	Elongation factor G	0.00e+00	1.50e-18	1.48e-20	NA
4. PB	Q66RN5	Elongation factor 1-alpha 1	3.67e-06	7.26e-03	4.26e-08	NA
4. PB	B2HUQ4	Elongation factor G	0.00e+00	2.03e-17	7.00e-19	NA
4. PB	Q1R270	Peptide chain release factor 3	6.58e-09	9.34e-07	2.60e-18	NA
4. PB	Q6BJ25	Elongation factor 2	8.14e-08	7.86e-14	2.84e-21	NA
4. PB	B0USE8	Peptide chain release factor 3	1.87e-09	4.03e-09	6.33e-19	NA
4. PB	P9WNM6	Elongation factor G	4.23e-14	1.22e-15	7.58e-19	NA
4. PB	Q7W0G3	Peptide chain release factor 3	8.73e-06	2.95e-11	4.06e-21	NA
4. PB	Q2GD82	Elongation factor G	0.00e+00	1.57e-17	4.45e-19	NA
4. PB	Q0ANP7	Elongation factor G	4.77e-15	2.39e-17	1.06e-20	NA
4. PB	P36048	Pre-mRNA-splicing factor SNU114	1.20e-07	7.95e-06	5.95e-11	NA
4. PB	P13639	Elongation factor 2	3.80e-08	9.14e-12	9.54e-22	NA
4. PB	Q12GX4	Elongation factor G 1	0.00e+00	1.23e-16	1.05e-17	NA
4. PB	Q3K1T4	Peptide chain release factor 3	5.27e-09	4.27e-08	2.09e-17	NA
4. PB	Q47810	Tetracycline resistance protein TetM from transposon TnFO1	7.29e-13	9.78e-19	2.62e-18	NA
4. PB	Q4FUQ9	Peptide chain release factor 3	4.34e-08	1.09e-07	2.75e-19	NA
4. PB	Q7NEF2	Elongation factor G	2.22e-16	6.48e-18	1.05e-15	NA
4. PB	Q2S9X0	Peptide chain release factor 3	8.91e-13	1.25e-08	2.99e-18	NA
4. PB	A7H4P5	Elongation factor G	0.00e+00	3.13e-17	1.97e-18	NA
4. PB	B0UWC4	Elongation factor G	6.88e-15	7.76e-18	5.58e-18	NA
4. PB	C1CB46	Elongation factor G	2.05e-14	4.52e-16	1.11e-19	NA
4. PB	C3PMH0	Elongation factor G	0.00e+00	7.07e-15	2.43e-20	NA
4. PB	P62632	Elongation factor 1-alpha 2	1.25e-05	5.60e-03	5.92e-09	NA
4. PB	A0RQX4	Elongation factor 4	0.00e+00	1.23e-72	0.0	NA
4. PB	Q9ZHZ8	Elongation factor 4	0.00e+00	3.15e-75	0.0	NA
4. PB	Q98QW3	Elongation factor 4	0.00e+00	2.23e-76	0.0	NA
4. PB	A8AUR6	Elongation factor G	2.07e-14	2.52e-15	9.17e-20	NA
4. PB	A0M5A0	Elongation factor G	8.88e-15	1.60e-18	3.66e-21	NA
4. PB	O30913	Elongation factor G 1	1.11e-16	3.21e-19	1.08e-23	NA
4. PB	Q8SS29	Elongation factor 1-alpha	1.12e-05	7.92e-03	1.39e-07	NA
4. PB	B7L0Q8	Elongation factor G	3.33e-16	6.29e-16	2.64e-20	NA
4. PB	B1X6J0	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	Q46306	Tetracycline resistance protein TetP	1.11e-16	8.61e-21	1.08e-21	NA
4. PB	B7UR02	Peptide chain release factor 3	3.61e-09	3.56e-08	2.23e-18	NA
4. PB	B8IS82	Elongation factor G	4.44e-16	4.95e-17	4.07e-20	NA
4. PB	Q5H1V2	Peptide chain release factor 3	8.74e-08	1.34e-10	2.83e-19	NA
4. PB	Q1BU86	Elongation factor G 1	6.44e-15	3.68e-17	2.62e-18	NA
4. PB	B9DQA0	Peptide chain release factor 3	1.48e-08	9.43e-09	5.04e-18	NA
4. PB	Q975H5	Elongation factor 2	4.63e-10	1.66e-20	2.32e-26	NA
4. PB	Q01765	Elongation factor 1-alpha	7.59e-06	1.50e-02	8.87e-10	NA
4. PB	Q30TP3	Elongation factor G	0.00e+00	1.89e-16	1.16e-16	NA
4. PB	B3ESU2	Elongation factor 4	0.00e+00	3.97e-73	0.0	NA
4. PB	A4G9U1	Elongation factor G	1.11e-16	3.33e-16	4.58e-16	NA
4. PB	A6LC18	Elongation factor 4	0.00e+00	2.14e-77	0.0	NA
4. PB	Q6CRY5	Elongation factor G, mitochondrial	1.33e-15	2.17e-10	9.21e-25	NA
4. PB	Q2FJ93	Elongation factor G	2.16e-14	2.46e-17	2.34e-17	NA
4. PB	B2GHU9	Elongation factor 4	0.00e+00	3.27e-60	0.0	NA
4. PB	O29490	Probable translation initiation factor IF-2	1.12e-04	4.30e-10	1.78e-04	NA
4. PB	A4I9M7	Translation factor GUF1 homolog, mitochondrial	0.00e+00	5.96e-06	1.99e-112	NA
4. PB	C3K2X9	Elongation factor G	7.22e-15	4.92e-16	2.91e-19	NA
4. PB	Q2NQL6	Elongation factor G	1.45e-13	1.48e-18	9.52e-16	NA
4. PB	Q8ETY5	Elongation factor G	1.79e-14	2.58e-17	7.54e-20	NA
4. PB	Q2FXY7	Elongation factor 4	0.00e+00	1.51e-69	0.0	NA
4. PB	P57608	Peptide chain release factor 3	4.50e-13	1.78e-10	7.41e-21	NA
4. PB	A4FPM8	Elongation factor G	0.00e+00	4.46e-17	1.39e-17	NA
4. PB	P53013	Elongation factor 1-alpha	4.34e-06	6.11e-03	3.71e-08	NA
4. PB	C7NYH7	Elongation factor 2	8.20e-10	9.52e-24	1.01e-21	NA
4. PB	Q03ZQ2	Elongation factor G	2.73e-14	4.67e-17	1.40e-21	NA
4. PB	B9RUN8	Translation factor GUF1 homolog, mitochondrial	0.00e+00	5.43e-22	0.0	NA
4. PB	B3PME9	Elongation factor G	2.22e-16	1.18e-17	1.02e-20	NA
4. PB	Q726J1	Peptide chain release factor 3	5.58e-08	1.14e-07	3.79e-19	NA
4. PB	Q5ZX60	Peptide chain release factor 3	1.29e-12	2.65e-08	2.76e-20	NA
4. PB	O59949	Elongation factor 1-alpha	4.25e-06	1.20e-02	5.82e-09	NA
4. PB	Q27139	Elongation factor 1-alpha 1	7.03e-07	4.90e-02	4.60e-08	NA
4. PB	A4WIK2	Probable translation initiation factor IF-2	7.62e-04	1.60e-12	2.75e-04	NA
4. PB	A6QFN0	Peptide chain release factor 3	8.29e-09	3.22e-09	3.53e-18	NA
4. PB	Q21RV5	Elongation factor G	0.00e+00	2.28e-16	1.44e-17	NA
4. PB	C3P9Q2	Elongation factor G	4.53e-14	3.93e-18	7.41e-20	NA
4. PB	Q0SH84	Elongation factor 4	0.00e+00	3.36e-52	0.0	NA
4. PB	Q2RQV7	Elongation factor G	0.00e+00	5.91e-17	1.60e-17	NA
4. PB	A8GV17	Elongation factor G	2.22e-16	8.68e-17	1.23e-19	NA
4. PB	B4HEQ8	Ribosome-releasing factor 2, mitochondrial	2.44e-12	2.19e-14	5.31e-19	NA
4. PB	B1ZLK1	Elongation factor G	0.00e+00	5.04e-15	2.40e-20	NA
4. PB	Q8XHS1	Elongation factor G	1.11e-16	9.76e-17	2.05e-20	NA
4. PB	Q9CIK7	Peptide chain release factor 3	1.00e-07	1.18e-08	2.12e-20	NA
4. PB	Q8K0D5	Elongation factor G, mitochondrial	1.05e-12	1.66e-08	9.73e-22	NA
4. PB	A5DK38	Elongation factor G, mitochondrial	2.66e-15	3.50e-09	3.10e-24	NA
4. PB	B5R9U3	Peptide chain release factor 3	7.48e-10	8.37e-10	1.62e-18	NA
4. PB	P60931	Elongation factor 4	0.00e+00	2.69e-64	0.0	NA
4. PB	Q97EH4	Elongation factor G	2.22e-16	3.48e-18	8.76e-20	NA
4. PB	Q3JV86	Elongation factor G 1	0.00e+00	2.78e-17	8.69e-19	NA
4. PB	A5UFG5	Peptide chain release factor 3	1.18e-09	3.64e-08	2.25e-18	NA
4. PB	Q31PV4	Elongation factor G	3.33e-16	2.36e-17	6.99e-20	NA
4. PB	B8DTV6	Elongation factor G	1.11e-16	1.42e-17	3.59e-18	NA
4. PB	C5BNW9	Peptide chain release factor 3	6.58e-12	1.59e-08	1.17e-17	NA
4. PB	P57772	Selenocysteine-specific elongation factor	1.94e-05	2.18e-06	3.11e-06	NA
4. PB	Q9Z802	Elongation factor G	7.33e-15	1.98e-15	2.56e-18	NA
4. PB	A6T3K7	Elongation factor G	1.11e-16	3.19e-16	3.01e-16	NA
4. PB	Q0I537	Elongation factor G	1.11e-16	7.76e-18	5.58e-18	NA
4. PB	A9NDA0	Peptide chain release factor 3	2.58e-12	9.72e-11	2.40e-22	NA
4. PB	B3RHG9	Translation factor GUF1, mitochondrial	0.00e+00	3.82e-36	6.28e-174	NA
4. PB	Q606M6	Peptide chain release factor 3	4.31e-07	4.32e-09	1.81e-20	NA
4. PB	B1AJG4	Elongation factor G	1.70e-14	3.08e-17	1.59e-21	NA
4. PB	Q0ABH8	Elongation factor G	0.00e+00	5.14e-16	2.93e-19	NA
4. PB	Q2P4Q8	Peptide chain release factor 3	2.29e-07	1.07e-10	2.94e-19	NA
4. PB	B6J5C9	Elongation factor G	4.77e-15	1.24e-17	6.94e-18	NA
4. PB	Q83FP1	Elongation factor G	1.11e-16	5.61e-16	4.93e-19	NA
4. PB	Q2HJN4	Elongation factor 1-alpha 1	6.51e-06	2.65e-02	1.70e-07	NA
4. PB	A7I1F0	Elongation factor 4	0.00e+00	3.53e-75	0.0	NA
4. PB	B3E7T2	Elongation factor G	2.22e-16	8.55e-17	1.24e-18	NA
4. PB	Q6MP77	Elongation factor G 2	1.11e-16	1.16e-16	1.17e-22	NA
4. PB	Q4A8T7	Elongation factor G	1.58e-13	1.41e-16	5.10e-20	NA
4. PB	A0JMI9	Ribosome-releasing factor 2, mitochondrial	4.44e-16	1.50e-08	1.70e-23	NA
4. PB	B0R6U5	Probable translation initiation factor IF-2	1.43e-04	5.27e-13	9.15e-07	NA
4. PB	Q2NJ19	Elongation factor G	5.00e-15	9.88e-18	9.13e-22	NA
4. PB	A9N7C9	Peptide chain release factor 3	2.52e-09	1.54e-09	1.64e-18	NA
4. PB	C1AUN7	Elongation factor 4	0.00e+00	8.89e-53	0.0	NA
4. PB	Q976A1	Probable translation initiation factor IF-2	5.13e-04	9.26e-12	1.33e-04	NA
4. PB	Q48SQ1	Peptide chain release factor 3	7.16e-09	2.31e-08	1.85e-17	NA
4. PB	B9MB70	Elongation factor G	0.00e+00	2.38e-16	2.14e-18	NA
4. PB	P62629	Elongation factor 1-alpha 1	4.88e-06	8.85e-03	3.37e-08	NA
4. PB	Q8KTA8	Elongation factor G	3.33e-16	2.67e-15	1.11e-20	NA
4. PB	Q8KTB2	Elongation factor G	0.00e+00	2.19e-15	1.03e-20	NA
4. PB	Q2HJN8	Elongation factor 1-alpha 2	4.31e-06	2.80e-02	2.41e-07	NA
4. PB	P0A7I6	Peptide chain release factor 3	1.25e-13	3.56e-08	2.23e-18	NA
4. PB	B0B809	Elongation factor G	0.00e+00	1.43e-15	2.23e-17	NA
4. PB	C6DJU6	Peptide chain release factor 3	1.40e-12	1.16e-09	1.45e-17	NA
4. PB	P62630	Elongation factor 1-alpha 1	1.51e-05	8.85e-03	3.37e-08	NA
4. PB	Q250N5	Elongation factor G	3.12e-14	8.27e-16	4.51e-18	NA
4. PB	Q31VU9	Elongation factor G	1.11e-16	4.73e-19	1.14e-17	NA
4. PB	Q56121	Peptide chain release factor 3	6.37e-14	1.54e-09	1.64e-18	NA
4. PB	Q11QB0	Elongation factor G	2.15e-14	7.06e-16	3.11e-23	NA
4. PB	C0ZIH5	Elongation factor G	1.78e-15	2.54e-17	2.11e-20	NA
4. PB	B7GYM8	Elongation factor G	0.00e+00	2.09e-17	7.00e-19	NA
4. PB	Q49WE9	Peptide chain release factor 3	4.96e-09	1.32e-09	5.72e-16	NA
4. PB	B7UK50	Elongation factor G	1.11e-16	4.73e-19	1.14e-17	NA
4. PB	P46943	Translation factor GUF1, mitochondrial	0.00e+00	1.12e-36	1.03e-173	NA
4. PB	A5CR97	Elongation factor 4	0.00e+00	9.80e-63	0.0	NA
4. PB	B9MQH0	Elongation factor G	0.00e+00	2.03e-17	1.25e-19	NA
4. PB	A7MUW8	Peptide chain release factor 3	3.51e-09	2.94e-08	2.78e-20	NA
4. PB	A4YCQ5	Probable translation initiation factor IF-2	2.22e-04	4.55e-13	1.09e-05	NA
4. PB	Q2YX08	Peptide chain release factor 3	1.51e-08	1.74e-09	2.90e-18	NA
4. PB	Q0ID58	Elongation factor G	2.22e-16	1.39e-16	4.79e-18	NA
4. PB	A5CXN7	Elongation factor G	0.00e+00	2.10e-15	4.97e-20	NA
4. PB	Q7NQF0	Elongation factor G	1.11e-16	8.18e-17	1.84e-15	NA
4. PB	B0RB35	Elongation factor G	6.49e-14	9.83e-16	1.71e-19	NA
4. PB	Q8K9C8	50S ribosomal subunit assembly factor BipA	4.44e-16	3.66e-30	1.68e-37	NA
4. PB	C1F645	Elongation factor G	5.55e-16	3.49e-15	8.63e-18	NA
4. PB	Q6KHS5	Elongation factor G	2.22e-16	2.79e-15	2.83e-20	NA
4. PB	Q71WB8	Elongation factor G	5.00e-14	1.42e-17	1.29e-20	NA
4. PB	B0W010	Ribosome-releasing factor 2, mitochondrial	2.08e-12	7.03e-11	1.06e-23	NA
4. PB	Q6ACY9	Elongation factor G	6.51e-14	1.15e-17	2.50e-19	NA
4. PB	A8FYR3	Peptide chain release factor 3	1.73e-12	3.04e-08	6.86e-19	NA
4. PB	P75544	Elongation factor G	5.11e-15	8.18e-17	1.18e-22	NA
4. PB	P05303	Elongation factor 1-alpha 2	1.50e-05	1.24e-03	5.65e-09	NA
4. PB	A0Q892	Peptide chain release factor 3	3.91e-09	4.91e-09	3.44e-20	NA
4. PB	Q82DQ1	Elongation factor G	0.00e+00	1.43e-16	1.04e-22	NA
4. PB	Q7NVF7	Peptide chain release factor 3	3.93e-13	1.74e-09	2.48e-19	NA
4. PB	B1JIV5	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	Q3SSW9	Elongation factor G	1.11e-16	3.38e-16	1.69e-19	NA
4. PB	A8ALY7	Peptide chain release factor 3	1.92e-13	6.91e-10	1.66e-18	NA
4. PB	A6UVG0	Probable translation initiation factor IF-2	4.26e-04	5.51e-14	3.26e-05	NA
4. PB	Q08BB1	Elongation factor G, mitochondrial	5.55e-16	4.37e-13	5.25e-22	NA
4. PB	A7FMI1	Peptide chain release factor 3	1.70e-09	1.95e-08	6.94e-17	NA
4. PB	C0MF25	Elongation factor G	1.50e-14	1.31e-15	1.37e-19	NA
4. PB	Q1C156	Peptide chain release factor 3	5.67e-08	1.41e-08	7.07e-17	NA
4. PB	C0Q7L6	Peptide chain release factor 3	5.91e-14	1.54e-09	1.64e-18	NA
4. PB	Q47UW3	Elongation factor G 2	4.77e-15	2.28e-15	8.63e-20	NA
4. PB	Q927I5	Elongation factor G	3.23e-14	1.40e-17	1.27e-20	NA
4. PB	Q74IG8	Peptide chain release factor 3	1.43e-07	6.56e-07	1.32e-16	NA
4. PB	A1KSN4	Peptide chain release factor 3	2.06e-12	1.16e-08	1.57e-21	NA
4. PB	A5V605	Elongation factor G	0.00e+00	1.81e-16	3.87e-18	NA
4. PB	Q47JA6	Elongation factor G	1.11e-16	1.83e-17	3.04e-17	NA
4. PB	A6LEJ3	Elongation factor G	2.22e-16	1.67e-17	1.18e-17	NA
4. PB	Q15YP4	Elongation factor G 1	1.78e-15	2.99e-17	1.62e-24	NA
4. PB	Q4AAQ6	Elongation factor G	2.55e-14	1.41e-16	5.10e-20	NA
4. PB	A1UBL0	Elongation factor G	6.66e-16	3.80e-16	5.86e-21	NA
4. PB	Q46PQ4	Elongation factor G 2	1.11e-16	4.58e-16	9.97e-20	NA
4. PB	A4W691	Peptide chain release factor 3	1.77e-09	1.72e-09	6.24e-19	NA
4. PB	B7JYV9	Peptide chain release factor 3	4.65e-07	5.61e-11	6.14e-22	NA
4. PB	B7HJ45	Elongation factor G	2.88e-14	6.58e-18	7.35e-20	NA
4. PB	F4JWP9	109 kDa U5 small nuclear ribonucleoprotein component GFL	7.58e-06	4.20e-06	1.24e-17	NA
4. PB	Q3SYU2	Elongation factor 2	2.82e-08	1.07e-11	7.93e-22	NA
4. PB	B3QR64	Elongation factor G	2.45e-14	6.18e-17	4.91e-19	NA
4. PB	Q04MH7	Elongation factor G	2.30e-14	4.52e-16	1.11e-19	NA
4. PB	A0PXU3	Elongation factor G	2.22e-16	1.49e-16	3.29e-18	NA
4. PB	B0DSK4	Elongation factor G, mitochondrial	0.00e+00	1.50e-14	3.30e-24	NA
4. PB	B2J5B0	Elongation factor G	2.22e-16	1.62e-17	4.37e-19	NA
4. PB	B4KKD5	Elongation factor G, mitochondrial	3.39e-13	9.08e-13	2.96e-21	NA
4. PB	B5Z8J0	Elongation factor G	2.22e-16	2.29e-17	3.15e-18	NA
4. PB	B4JQM7	Elongation factor G, mitochondrial	4.61e-13	1.53e-13	2.16e-21	NA
4. PB	Q160Y3	Elongation factor G	0.00e+00	2.43e-17	1.58e-18	NA
4. PB	Q5HVX6	Elongation factor G	0.00e+00	3.74e-17	2.17e-18	NA
4. PB	B2VH43	Peptide chain release factor 3	7.25e-09	3.30e-09	6.94e-17	NA
4. PB	Q7MTL1	Elongation factor G	0.00e+00	2.25e-16	4.75e-22	NA
4. PB	A6Q1M7	Elongation factor G	1.11e-16	3.01e-16	2.82e-19	NA
4. PB	A3PV95	Elongation factor G	2.31e-14	3.80e-16	5.86e-21	NA
4. PB	A2STM8	Probable translation initiation factor IF-2	6.66e-04	7.25e-12	5.15e-06	NA
4. PB	Q4A5S3	Elongation factor 4	0.00e+00	1.99e-66	0.0	NA
4. PB	A5CUB7	Elongation factor G	0.00e+00	3.85e-16	1.73e-19	NA
4. PB	B7GRY7	Elongation factor 4	0.00e+00	2.03e-59	0.0	NA
4. PB	Q8KTC1	Elongation factor G	0.00e+00	7.17e-16	2.52e-20	NA
4. PB	A1ST34	Peptide chain release factor 3	2.02e-11	2.34e-08	1.93e-20	NA
4. PB	Q87WH1	Peptide chain release factor 3	9.40e-12	1.37e-09	7.33e-19	NA
4. PB	A8EW86	Elongation factor G	1.11e-16	7.65e-18	2.41e-18	NA
4. PB	Q1BDD4	Elongation factor G	3.25e-14	3.80e-16	5.86e-21	NA
4. PB	P64022	Elongation factor G	2.33e-14	4.52e-16	1.11e-19	NA
4. PB	P68103	Elongation factor 1-alpha 1	1.71e-05	7.26e-03	4.26e-08	NA
4. PB	C4K1P6	Elongation factor G	0.00e+00	4.02e-15	2.52e-20	NA
4. PB	P13551	Elongation factor G	0.00e+00	1.95e-15	9.43e-22	NA
4. PB	Q83DC7	Peptide chain release factor 3	4.32e-12	9.72e-11	2.40e-22	NA
4. PB	Q1JL31	Peptide chain release factor 3	6.38e-10	2.26e-08	1.75e-17	NA
4. PB	B5ZC32	Elongation factor G	1.99e-14	3.17e-17	1.68e-21	NA
4. PB	Q8DXS7	Elongation factor G	1.51e-14	6.29e-16	8.84e-20	NA
4. PB	Q8R2Q4	Ribosome-releasing factor 2, mitochondrial	1.47e-13	1.63e-05	4.42e-22	NA
4. PB	Q39SN2	Elongation factor G 2	8.44e-15	6.39e-16	1.65e-21	NA
4. PB	Q66EW6	Peptide chain release factor 3	8.66e-09	1.95e-08	6.94e-17	NA
4. PB	P05197	Elongation factor 2	2.86e-08	7.83e-12	8.51e-22	NA
4. PB	Q13UU8	Elongation factor G 1	0.00e+00	9.21e-17	1.23e-18	NA
4. PB	P90519	Elongation factor 1-alpha	3.59e-06	3.59e-02	7.95e-10	NA
4. PB	Q7WRC7	Elongation factor G 1	1.11e-16	1.72e-17	2.35e-16	NA
4. PB	Q8ZJB3	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	Q5HQE4	Peptide chain release factor 3	7.53e-10	3.30e-09	1.13e-18	NA
4. PB	B1YCQ7	Probable translation initiation factor IF-2	7.91e-04	1.54e-12	3.26e-04	NA
4. PB	C5BHI4	Peptide chain release factor 3	7.67e-09	4.12e-09	1.55e-18	NA
4. PB	Q6CK29	Ribosome-releasing factor 2, mitochondrial	4.84e-12	5.19e-19	1.72e-20	NA
4. PB	Q7MI34	Peptide chain release factor 3	9.35e-13	8.40e-09	2.39e-18	NA
4. PB	P68104	Elongation factor 1-alpha 1	4.30e-06	7.26e-03	4.26e-08	NA
4. PB	B3RXR7	Translation factor GUF1 homolog, mitochondrial	0.00e+00	6.08e-26	0.0	NA
4. PB	B2G8Y0	Elongation factor G	2.24e-14	4.46e-17	1.83e-21	NA
4. PB	B4R8L3	Elongation factor G	0.00e+00	2.34e-14	2.34e-22	NA
4. PB	Q0BYB1	Elongation factor G	1.18e-14	1.84e-15	1.22e-19	NA
4. PB	A2C4U6	Elongation factor G	2.22e-16	1.17e-17	6.65e-19	NA
4. PB	Q2YB00	Elongation factor G	0.00e+00	1.13e-15	5.53e-19	NA
4. PB	Q0VRV7	Peptide chain release factor 3	9.35e-09	1.70e-10	5.98e-20	NA
4. PB	Q1J8I4	Elongation factor G	1.51e-14	1.37e-15	1.38e-19	NA
4. PB	A2CC86	Elongation factor G	2.22e-16	2.12e-17	5.07e-19	NA
4. PB	B1JBG6	Peptide chain release factor 3	5.14e-13	3.07e-09	2.91e-18	NA
4. PB	A2Q0Z0	Elongation factor 1-alpha 1	1.40e-05	6.55e-03	4.69e-08	NA
4. PB	Q6LXI2	Elongation factor 2	1.52e-09	1.04e-19	8.07e-22	NA
4. PB	Q9USZ1	Elongation factor G, mitochondrial	1.11e-16	1.98e-09	7.84e-21	NA
4. PB	O83748	Elongation factor G 1	1.11e-16	7.53e-18	8.11e-24	NA
4. PB	Q3Z983	Elongation factor G	1.02e-13	4.33e-17	1.65e-19	NA
4. PB	P46211	Elongation factor G	4.08e-13	1.92e-15	7.77e-20	NA
4. PB	Q4A8T9	Elongation factor 4	0.00e+00	5.61e-76	0.0	NA
4. PB	Q48DZ2	Peptide chain release factor 3	9.44e-12	1.13e-09	1.98e-18	NA
4. PB	B4TGZ2	Peptide chain release factor 3	1.88e-09	1.54e-09	1.64e-18	NA
4. PB	C1CIU0	Peptide chain release factor 3	1.82e-09	6.92e-07	4.84e-19	NA
4. PB	A0KQ96	Elongation factor G	1.78e-13	1.97e-16	6.70e-17	NA
4. PB	Q7VNA2	Elongation factor G	9.10e-15	9.63e-19	1.49e-18	NA
4. PB	B2VK36	Elongation factor G	0.00e+00	3.08e-18	8.96e-17	NA
4. PB	Q1AVV0	Elongation factor 4	0.00e+00	2.88e-62	0.0	NA
4. PB	Q7U4D2	Elongation factor G	2.22e-16	1.50e-17	1.08e-19	NA
4. PB	Q8KTB9	Elongation factor G	0.00e+00	2.22e-15	2.66e-20	NA
4. PB	B2IA64	Elongation factor G	4.33e-15	4.30e-14	4.39e-20	NA
4. PB	A4VI89	Peptide chain release factor 3	9.71e-12	7.30e-11	2.27e-18	NA
4. PB	B0S0I4	Elongation factor G	2.35e-14	2.90e-17	1.68e-17	NA
4. PB	P51554	Elongation factor 1-alpha	1.02e-05	1.11e-03	5.87e-12	NA
4. PB	A5DPE3	Elongation factor 1-alpha	1.07e-05	4.98e-02	5.60e-09	NA
4. PB	B1VAM2	Elongation factor G	1.05e-14	2.50e-17	9.21e-22	NA
4. PB	P02993	Elongation factor 1-alpha	4.58e-06	2.07e-03	1.66e-08	NA
4. PB	Q3KI56	Peptide chain release factor 3	3.19e-13	7.07e-10	2.86e-18	NA
4. PB	Q41011	Elongation factor 1-alpha	4.25e-06	4.48e-02	1.12e-10	NA
4. PB	Q0TMP3	Elongation factor G	1.11e-16	7.83e-17	2.07e-20	NA
4. PB	A1B023	Elongation factor G	1.11e-16	3.63e-16	1.06e-19	NA
4. PB	P13060	Eukaryotic translation elongation factor 2	4.73e-07	1.12e-12	4.02e-19	NA
4. PB	A6TZ24	Elongation factor G	2.11e-14	2.46e-17	2.34e-17	NA
4. PB	B8G1W3	Elongation factor G	3.28e-14	6.96e-16	3.56e-18	NA
4. PB	P0A7I5	Peptide chain release factor 3	7.74e-09	3.56e-08	2.23e-18	NA
4. PB	Q3SLQ2	Elongation factor G	0.00e+00	6.96e-17	3.22e-18	NA
4. PB	P09445	Elongation factor 2	2.34e-08	5.46e-12	9.88e-22	NA
4. PB	P0A3B1	50S ribosomal subunit assembly factor BipA	0.00e+00	1.93e-32	2.88e-46	NA
4. PB	Q03EB4	Elongation factor G	4.13e-14	1.89e-16	1.47e-19	NA
4. PB	A6QLJ3	Translation factor GUF1, mitochondrial	0.00e+00	3.52e-19	0.0	NA
4. PB	A9M3X0	Elongation factor G	1.11e-16	2.18e-19	7.08e-18	NA
4. PB	Q5R9V1	Elongation factor G, mitochondrial	9.50e-13	7.25e-10	1.79e-21	NA
4. PB	A9KRZ3	Elongation factor G	0.00e+00	9.91e-17	2.40e-17	NA
4. PB	Q6BPD3	Elongation factor G, mitochondrial	0.00e+00	2.27e-07	2.72e-25	NA
4. PB	Q9RXK5	Elongation factor G	0.00e+00	4.88e-17	1.88e-20	NA
4. PB	P68791	Elongation factor G	2.20e-14	2.46e-17	2.34e-17	NA
4. PB	P30767	Elongation factor G	7.22e-15	5.12e-15	5.02e-20	NA
4. PB	Q814C5	Elongation factor G	2.48e-14	6.58e-18	7.35e-20	NA
4. PB	Q5QWB4	Elongation factor G	4.30e-14	1.21e-18	2.34e-19	NA
4. PB	Q03IS1	Elongation factor G	1.19e-14	4.45e-16	8.40e-20	NA
4. PB	A2BJZ8	Probable translation initiation factor IF-2	1.22e-04	2.10e-11	1.93e-05	NA
4. PB	Q5E8B9	Elongation factor G 1	2.66e-15	2.82e-17	2.12e-18	NA
4. PB	A0RW30	Elongation factor 2	1.89e-10	3.11e-23	4.88e-24	NA
4. PB	B2IK59	Elongation factor G	2.22e-16	3.01e-16	2.18e-19	NA
4. PB	Q2LWC5	Peptide chain release factor 3	2.44e-06	1.97e-11	4.07e-19	NA
4. PB	P50257	Elongation factor 1-alpha S	3.71e-05	2.13e-04	8.59e-05	NA
4. PB	Q123W3	Elongation factor G 2	1.11e-16	3.08e-17	1.46e-18	NA
4. PB	Q8E635	Peptide chain release factor 3	6.70e-09	4.27e-08	2.09e-17	NA
4. PB	B8ZLK3	Peptide chain release factor 3	8.79e-10	1.54e-07	4.84e-19	NA
4. PB	Q0I2G9	Peptide chain release factor 3	6.29e-08	1.42e-09	4.09e-19	NA
4. PB	Q7VJ85	Elongation factor G	0.00e+00	1.06e-18	1.20e-18	NA
4. PB	Q7RJ38	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.67e-02	4.70e-71	NA
4. PB	Q74L90	Elongation factor G	2.81e-14	2.22e-17	4.96e-25	NA
4. PB	Q3J9L6	Peptide chain release factor 3	3.51e-07	1.33e-11	8.94e-23	NA
4. PB	P0CN30	Elongation factor 1-alpha	1.23e-05	3.93e-02	7.83e-12	NA
4. PB	Q87L45	Elongation factor G 1	0.00e+00	2.56e-16	9.91e-17	NA
4. PB	Q58448	Elongation factor 2	8.24e-13	3.05e-22	1.86e-22	NA
4. PB	Q7MI49	Elongation factor G 2	3.55e-15	5.25e-17	2.71e-25	NA
4. PB	Q2NEL0	Elongation factor 2	5.71e-09	1.17e-22	1.62e-17	NA
4. PB	Q8R7V1	Elongation factor G	0.00e+00	1.05e-17	1.35e-19	NA
4. PB	A4J108	Elongation factor G	3.33e-16	6.27e-17	1.95e-17	NA
4. PB	Q9LNC5	110 kDa U5 small nuclear ribonucleoprotein component CLO	8.41e-07	1.00e-05	5.98e-19	NA
4. PB	Q1HPK6	Translation elongation factor 2	1.84e-06	2.17e-13	5.19e-19	NA
4. PB	Q46WE0	Elongation factor G 1	1.11e-16	9.97e-16	4.50e-18	NA
4. PB	B3WFB1	Peptide chain release factor 3	9.99e-08	2.39e-07	1.58e-17	NA
4. PB	Q88XF3	Peptide chain release factor 3	2.80e-08	2.45e-07	5.54e-17	NA
4. PB	Q5HC12	Elongation factor G	0.00e+00	1.33e-16	9.42e-19	NA
4. PB	C4KZQ0	Elongation factor G	5.66e-15	1.94e-17	9.57e-20	NA
4. PB	B8MJJ5	Elongation factor G, mitochondrial	7.31e-14	9.24e-03	7.21e-25	NA
4. PB	Q4JT40	Elongation factor G	4.03e-14	9.07e-17	5.54e-22	NA
4. PB	A3DMS0	Probable translation initiation factor IF-2	9.46e-04	9.26e-12	2.53e-06	NA
4. PB	B0RCT0	Elongation factor 4	0.00e+00	8.82e-63	0.0	NA
4. PB	B6K6L6	Translation factor guf1, mitochondrial	0.00e+00	3.39e-27	5.75e-165	NA
4. PB	A1VEB9	Elongation factor G	0.00e+00	2.15e-17	3.10e-19	NA
4. PB	Q5R600	Ribosome-releasing factor 2, mitochondrial	1.75e-13	4.24e-06	6.44e-22	NA
4. PB	B8H414	Elongation factor G	0.00e+00	2.59e-15	8.06e-22	NA
4. PB	Q12Z93	Probable translation initiation factor IF-2	3.16e-05	3.42e-12	0.005	NA
4. PB	B5Y282	Peptide chain release factor 3	4.98e-09	8.18e-10	1.66e-18	NA
4. PB	Q6LST1	Elongation factor G 2	1.11e-16	5.66e-17	4.05e-25	NA
4. PB	Q29N77	Elongation factor G, mitochondrial	3.80e-13	3.96e-14	4.46e-21	NA
4. PB	B3MK91	Elongation factor G, mitochondrial	4.40e-13	2.81e-12	1.54e-21	NA
4. PB	A2BYN5	Elongation factor G	0.00e+00	7.76e-18	2.72e-21	NA
4. PB	A4HAG7	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.95e-07	1.25e-115	NA
4. PB	C1CC62	Elongation factor G	1.97e-14	8.16e-16	1.09e-19	NA
4. PB	Q5LY21	Elongation factor G	1.37e-14	4.45e-16	8.40e-20	NA
4. PB	Q5VTE0	Putative elongation factor 1-alpha-like 3	2.00e-05	1.11e-02	4.19e-08	NA
4. PB	Q41803	Elongation factor 1-alpha	5.26e-07	1.44e-02	2.21e-08	NA
4. PB	B4SUU6	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	B5EFP7	Elongation factor G	0.00e+00	4.72e-16	2.62e-18	NA
4. PB	B0U262	Peptide chain release factor 3	1.37e-06	5.83e-11	4.21e-20	NA
4. PB	B4RU35	Peptide chain release factor 3	2.10e-08	1.44e-09	8.73e-18	NA
4. PB	A1T4L5	Elongation factor G	4.51e-14	2.49e-16	3.99e-20	NA
4. PB	Q9V0V7	Elongation factor 1-alpha	3.53e-06	4.86e-02	3.82e-15	NA
4. PB	Q5LMR4	Elongation factor G	0.00e+00	2.39e-17	2.11e-18	NA
4. PB	A3PEZ8	Elongation factor G	2.22e-16	8.25e-18	6.99e-21	NA
4. PB	O86490	Peptide chain release factor 3	1.89e-08	3.22e-09	3.53e-18	NA
4. PB	Q721H8	Peptide chain release factor 3	2.03e-10	2.78e-08	1.60e-16	NA
4. PB	P0DA85	Elongation factor G	1.90e-14	1.37e-15	1.38e-19	NA
4. PB	A3M306	Elongation factor G	0.00e+00	2.03e-17	7.00e-19	NA
4. PB	B7IHU3	Elongation factor G	0.00e+00	1.82e-15	2.62e-20	NA
4. PB	Q0SX36	Peptide chain release factor 3	8.03e-09	6.85e-08	2.23e-18	NA
4. PB	Q29BD5	Ribosome-releasing factor 2, mitochondrial	2.17e-10	4.83e-11	3.02e-18	NA
4. PB	Q1B684	Elongation factor 4	0.00e+00	6.54e-47	0.0	NA
4. PB	P28371	Elongation factor G 1	1.69e-14	1.39e-16	7.96e-24	NA
4. PB	B1LEH8	Peptide chain release factor 3	7.33e-09	3.56e-08	2.23e-18	NA
4. PB	A8G709	Elongation factor G	3.33e-16	5.16e-18	6.43e-20	NA
4. PB	A6ZQM4	Ribosome-releasing factor 2, mitochondrial	3.92e-11	4.80e-14	4.56e-19	NA
4. PB	Q8D3H2	Elongation factor G	2.62e-14	9.02e-16	1.10e-17	NA
4. PB	O52836	Tetracycline resistance protein TetW	3.32e-11	1.71e-20	2.77e-21	NA
4. PB	Q8DCQ8	Elongation factor G	2.22e-16	6.67e-16	1.54e-17	NA
4. PB	O49169	Elongation factor 1-alpha	4.42e-07	3.83e-02	6.59e-10	NA
4. PB	A6URS1	Probable translation initiation factor IF-2	2.17e-04	5.06e-13	1.86e-06	NA
4. PB	A8YU90	Peptide chain release factor 3	1.68e-08	2.42e-07	1.16e-17	NA
4. PB	Q3YSU3	Elongation factor G	0.00e+00	7.27e-17	1.08e-18	NA
4. PB	P14081	Selenocysteine-specific elongation factor	2.00e-05	7.79e-04	7.50e-08	NA
4. PB	C1ET36	Elongation factor G	2.30e-14	3.93e-18	7.41e-20	NA
4. PB	P0A557	Elongation factor G	9.55e-15	1.22e-15	7.58e-19	NA
4. PB	A5U070	Elongation factor G	1.19e-14	1.22e-15	7.58e-19	NA
4. PB	C1L1Q9	Peptide chain release factor 3	1.94e-12	2.14e-08	1.54e-16	NA
4. PB	B2TIH2	Elongation factor G	1.11e-16	8.64e-19	3.58e-20	NA
4. PB	A4VHM7	Elongation factor G	8.77e-15	1.57e-17	1.12e-18	NA
4. PB	B1Y7G9	Elongation factor G	0.00e+00	2.19e-17	5.68e-18	NA
4. PB	P95691	Probable translation initiation factor IF-2	3.67e-04	1.00e-13	4.27e-06	NA
4. PB	A4QV78	Translation factor GUF1, mitochondrial	0.00e+00	1.70e-14	3.48e-175	NA
4. PB	B4U741	Elongation factor G	0.00e+00	1.22e-16	2.69e-20	NA
4. PB	B4RJN1	Peptide chain release factor 3	2.20e-12	4.63e-09	3.98e-21	NA
4. PB	A1W2Q4	Elongation factor G	1.11e-16	3.33e-16	2.15e-18	NA
4. PB	A3N247	Elongation factor G	7.22e-15	2.99e-17	9.11e-19	NA
4. PB	Q1LI29	Elongation factor G 1	1.11e-16	3.33e-16	5.46e-18	NA
4. PB	Q6HPR1	Elongation factor G	2.05e-14	3.93e-18	7.41e-20	NA
4. PB	A4QBG9	Elongation factor G	4.61e-14	4.46e-17	7.63e-20	NA
4. PB	Q04Y01	Elongation factor G	0.00e+00	4.02e-16	7.85e-22	NA
4. PB	Q63H93	Elongation factor G	2.38e-14	5.65e-18	7.35e-20	NA
4. PB	Q8EWZ9	Elongation factor 4	0.00e+00	1.01e-72	0.0	NA
4. PB	Q6CBI0	Ribosome-releasing factor 2, mitochondrial	1.79e-14	7.20e-18	1.26e-22	NA
4. PB	A3CLS9	Peptide chain release factor 3	1.46e-10	5.60e-08	4.61e-17	NA
4. PB	B4NAU8	Ribosome-releasing factor 2, mitochondrial	3.46e-13	3.57e-11	3.72e-23	NA
4. PB	Q5WY34	Peptide chain release factor 3	3.56e-07	2.62e-08	2.69e-20	NA
4. PB	A6VN03	Peptide chain release factor 3	2.38e-09	5.03e-09	2.22e-18	NA
4. PB	Q14JC2	Elongation factor G	2.22e-16	4.39e-16	6.40e-18	NA
4. PB	Q2IK81	Elongation factor G 2	0.00e+00	1.24e-15	1.18e-22	NA
4. PB	A8A8A3	Peptide chain release factor 3	4.50e-09	7.16e-08	2.31e-18	NA
4. PB	Q88PH8	Peptide chain release factor 3	3.10e-07	1.07e-09	2.52e-18	NA
4. PB	Q7UZY6	Elongation factor G	2.22e-16	7.20e-18	2.08e-20	NA
4. PB	A0KU03	Peptide chain release factor 3	1.14e-12	7.48e-09	5.34e-19	NA
4. PB	B1VET0	Elongation factor G	1.93e-14	7.49e-17	8.21e-21	NA
4. PB	C3PHY1	Elongation factor 4	0.00e+00	3.01e-65	0.0	NA
4. PB	Q5FUP6	Elongation factor G	0.00e+00	1.11e-16	5.08e-22	NA
4. PB	Q97BK4	Probable translation initiation factor IF-2	3.14e-04	6.21e-12	4.50e-07	NA
4. PB	B9DKV7	Elongation factor G	1.80e-14	1.57e-17	1.58e-21	NA
4. PB	A5I7K9	Elongation factor G	2.22e-16	2.46e-17	9.03e-20	NA
4. PB	P60785	Elongation factor 4	0.00e+00	2.97e-75	0.0	NA
4. PB	B2K5N5	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	A1TJ04	Elongation factor G	0.00e+00	8.27e-16	9.78e-18	NA
4. PB	Q0BKK2	Peptide chain release factor 3	1.57e-12	6.98e-09	3.20e-20	NA
4. PB	Q8NT19	Elongation factor G	2.95e-14	6.46e-17	7.99e-20	NA
4. PB	A5VL77	Peptide chain release factor 3	1.71e-07	5.12e-07	7.89e-17	NA
4. PB	A1UIU2	Elongation factor 4	0.00e+00	6.54e-47	0.0	NA
4. PB	Q7W2S3	Peptide chain release factor 3	2.24e-06	3.11e-11	4.06e-21	NA
4. PB	Q969S9	Ribosome-releasing factor 2, mitochondrial	1.11e-16	8.71e-06	5.61e-22	NA
4. PB	Q30V54	Peptide chain release factor 3	2.27e-07	1.22e-09	1.06e-19	NA
4. PB	C3LSR4	Peptide chain release factor 3	8.54e-09	2.32e-07	1.26e-18	NA
4. PB	Q48VB6	Elongation factor G	1.98e-14	1.37e-15	1.38e-19	NA
4. PB	A4SUV8	Elongation factor G	2.22e-16	4.85e-16	1.92e-14	NA
4. PB	Q4QJL3	Peptide chain release factor 3	4.17e-09	4.73e-08	8.98e-18	NA
4. PB	Q9K1I8	Elongation factor G	2.22e-16	2.97e-19	7.53e-18	NA
4. PB	P57938	Elongation factor G	1.11e-16	9.16e-18	5.53e-18	NA
4. PB	A7GK17	Elongation factor G	2.66e-14	6.28e-18	8.92e-20	NA
4. PB	B1KRQ3	Peptide chain release factor 3	6.14e-12	2.81e-08	2.41e-20	NA
4. PB	Q8XPH8	Peptide chain release factor 3	8.21e-06	5.46e-09	7.32e-22	NA
4. PB	Q55E94	Elongation factor G, mitochondrial	8.88e-16	6.26e-13	2.21e-21	NA
4. PB	A9R055	Peptide chain release factor 3	1.85e-09	1.41e-08	7.07e-17	NA
4. PB	Q9HWD2	Elongation factor G 1	0.00e+00	4.46e-17	1.68e-18	NA
4. PB	B1JL43	Peptide chain release factor 3	6.64e-09	1.95e-08	6.94e-17	NA
4. PB	A5FV42	Elongation factor G	0.00e+00	7.70e-16	1.11e-22	NA
4. PB	B2GIL1	Elongation factor G	4.75e-14	1.35e-17	3.53e-21	NA
4. PB	A9HW20	Peptide chain release factor 3	1.86e-06	1.80e-10	4.99e-21	NA
4. PB	A7FZ72	Elongation factor G	2.22e-16	2.46e-17	9.03e-20	NA
4. PB	B5YTP7	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	B0SUQ6	Elongation factor G	3.66e-15	2.99e-15	4.78e-22	NA
4. PB	Q3SK69	Peptide chain release factor 3	1.09e-08	1.43e-08	1.34e-21	NA
4. PB	A0LRL7	Elongation factor G	0.00e+00	2.77e-14	1.27e-18	NA
4. PB	B5ZAB8	Elongation factor 4	0.00e+00	2.63e-72	0.0	NA
4. PB	Q03GI2	Peptide chain release factor 3	1.91e-07	3.11e-07	1.91e-17	NA
4. PB	A4XZ93	Elongation factor G	1.04e-14	2.04e-15	1.12e-17	NA
4. PB	B8D9V0	Elongation factor G	0.00e+00	4.14e-16	3.43e-17	NA
4. PB	B2UYA7	Elongation factor G	0.00e+00	3.36e-19	3.67e-20	NA
4. PB	B3M011	Ribosome-releasing factor 2, mitochondrial	5.21e-11	7.16e-12	3.31e-19	NA
4. PB	Q6LVC1	Elongation factor G 1	1.11e-16	4.65e-16	2.23e-16	NA
4. PB	Q660H9	Elongation factor G 2	1.11e-16	1.63e-16	4.24e-19	NA
4. PB	Q5F5S3	Elongation factor G	2.22e-16	2.75e-19	7.21e-18	NA
4. PB	B5BL11	Peptide chain release factor 3	9.03e-09	1.54e-09	1.64e-18	NA
4. PB	A8MBV9	Probable translation initiation factor IF-2	1.46e-04	9.96e-13	1.48e-07	NA
4. PB	Q6A6L5	Elongation factor G	0.00e+00	5.37e-16	4.08e-20	NA
4. PB	Q5X862	Elongation factor G	6.99e-15	1.26e-17	1.75e-18	NA
4. PB	B9KFH1	Elongation factor G	0.00e+00	3.52e-17	1.02e-17	NA
4. PB	Q3A709	Peptide chain release factor 3	7.55e-06	3.90e-08	3.16e-19	NA
4. PB	Q8NN68	Elongation factor 4	0.00e+00	1.39e-63	0.0	NA
4. PB	C1AYS4	Elongation factor G	3.04e-14	1.58e-15	8.57e-20	NA
4. PB	A4XI36	Elongation factor G	0.00e+00	1.13e-17	3.18e-19	NA
4. PB	C4YJQ8	Elongation factor 2	9.53e-08	1.22e-14	1.11e-22	NA
4. PB	A5K6I6	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.11e-04	4.61e-91	NA
4. PB	Q0ADD1	Peptide chain release factor 3	5.76e-06	6.87e-13	1.33e-20	NA
4. PB	B5BGZ2	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	C0R543	Elongation factor G	0.00e+00	1.52e-16	1.19e-18	NA
4. PB	A0ALY9	Elongation factor G	3.72e-14	1.83e-17	1.30e-20	NA
4. PB	Q57918	Selenocysteine-specific elongation factor	1.19e-04	4.65e-07	6.03e-16	NA
4. PB	C1DQ00	Peptide chain release factor 3	7.75e-12	3.76e-10	2.43e-18	NA
4. PB	A2RDW3	Peptide chain release factor 3	2.56e-12	2.24e-08	1.72e-17	NA
4. PB	Q0SQE1	Elongation factor G	2.22e-16	9.76e-17	2.05e-20	NA
4. PB	B7KCH0	Peptide chain release factor 3	1.03e-06	1.64e-10	3.52e-20	NA
4. PB	P57593	Elongation factor G	0.00e+00	4.14e-16	3.43e-17	NA
4. PB	Q1MPS9	Elongation factor G	0.00e+00	4.65e-16	1.99e-18	NA
4. PB	A1JJ92	Peptide chain release factor 3	2.36e-09	8.01e-08	4.92e-17	NA
4. PB	Q4KIC9	Peptide chain release factor 3	7.46e-12	1.07e-09	2.52e-18	NA
4. PB	Q5FM92	Elongation factor G	2.96e-14	9.62e-17	3.11e-25	NA
4. PB	P74228	Elongation factor G 2	2.22e-16	3.85e-16	1.25e-17	NA
4. PB	Q5BJP6	Ribosome-releasing factor 2, mitochondrial	1.11e-16	4.64e-05	4.70e-22	NA
4. PB	Q2T0I7	Elongation factor G 1	1.95e-14	1.83e-17	9.24e-19	NA
4. PB	P9WNM8	Elongation factor G-like protein	7.77e-16	7.85e-13	0.002	NA
4. PB	B4EYV7	Elongation factor G	3.61e-14	8.50e-18	1.15e-16	NA
4. PB	Q874B9	Elongation factor 2	1.77e-08	6.86e-14	2.13e-21	NA
4. PB	Q3M7Y0	Peptide chain release factor 3	6.14e-07	1.78e-11	6.80e-20	NA
4. PB	P10126	Elongation factor 1-alpha 1	1.78e-05	8.85e-03	3.37e-08	NA
4. PB	Q9ZK24	Elongation factor G	1.11e-16	2.09e-17	7.67e-19	NA
4. PB	B8HY03	Peptide chain release factor 3	6.22e-06	7.96e-11	8.84e-22	NA
4. PB	B3EUF3	Elongation factor G	6.22e-15	2.45e-15	6.16e-19	NA
4. PB	Q664R6	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	O94316	Pre-mRNA-splicing factor cwf10	8.96e-11	2.94e-04	3.50e-16	NA
4. PB	C6A1V3	Probable translation initiation factor IF-2	1.44e-04	2.77e-11	1.62e-05	NA
4. PB	B9KL88	Elongation factor G	0.00e+00	1.17e-15	3.40e-19	NA
4. PB	P26752	Elongation factor 2	3.14e-10	1.68e-22	1.77e-21	NA
4. PB	Q3JZB5	Elongation factor G	3.49e-14	6.29e-16	8.84e-20	NA
4. PB	Q6MU82	Elongation factor G	1.11e-14	1.03e-15	1.71e-19	NA
4. PB	B1LBP3	Elongation factor G	0.00e+00	9.69e-16	1.51e-19	NA
4. PB	B4LS49	Elongation factor G, mitochondrial	3.76e-13	1.82e-13	3.59e-21	NA
4. PB	Q52360	Tetracycline resistance protein TetQ	1.11e-16	5.80e-22	7.82e-18	NA
4. PB	B4Q5D5	Elongation factor G, mitochondrial	1.16e-13	1.32e-13	8.19e-21	NA
4. PB	Q04ED6	Elongation factor G	1.62e-14	4.79e-18	1.23e-22	NA
4. PB	O51634	Elongation factor G 2	1.11e-16	2.22e-16	4.04e-20	NA
4. PB	A8EXK1	Elongation factor G	0.00e+00	2.83e-15	7.10e-21	NA
4. PB	Q96RP9	Elongation factor G, mitochondrial	4.40e-14	1.04e-09	4.36e-22	NA
4. PB	P69948	Elongation factor G	1.80e-14	1.37e-15	1.38e-19	NA
4. PB	A2RCI2	Elongation factor G	1.71e-14	8.52e-16	1.40e-19	NA
4. PB	B0VTG3	Elongation factor G	0.00e+00	4.60e-17	1.75e-19	NA
4. PB	Q65SF0	Peptide chain release factor 3	1.18e-09	7.57e-09	1.55e-18	NA
4. PB	Q5GWS9	Elongation factor G	2.33e-15	7.06e-17	2.55e-22	NA
4. PB	B2RKK1	Elongation factor 4	0.00e+00	1.28e-74	0.0	NA
4. PB	Q16S14	Elongation factor G, mitochondrial	1.55e-15	5.14e-16	1.25e-21	NA
4. PB	Q87A35	Elongation factor G	4.66e-15	4.30e-14	4.39e-20	NA
4. PB	Q82S73	Peptide chain release factor 3	1.94e-06	5.18e-12	1.49e-21	NA
4. PB	Q9FLE4	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.15e-23	0.0	NA
4. PB	A9W4P8	Elongation factor G	2.22e-16	6.29e-16	2.64e-20	NA
4. PB	Q9HXB0	Peptide chain release factor 3	6.17e-12	3.02e-10	2.07e-18	NA
4. PB	B5Z4Q6	Peptide chain release factor 3	1.17e-13	3.56e-08	2.23e-18	NA
4. PB	C5Z3W1	Translation factor GUF1 homolog, mitochondrial	0.00e+00	7.03e-20	0.0	NA
4. PB	Q65PB0	Elongation factor G	2.95e-14	5.07e-16	5.52e-21	NA
4. PB	P66021	Peptide chain release factor 3	5.89e-09	2.26e-08	1.75e-17	NA
4. PB	B0C6Z1	Peptide chain release factor 3	9.41e-07	8.06e-11	5.66e-21	NA
4. PB	Q90835	Elongation factor 1-alpha 1	4.00e-06	6.27e-03	1.81e-08	NA
4. PB	A8A8D3	Probable translation initiation factor IF-2	9.40e-04	5.60e-12	2.69e-04	NA
4. PB	Q89AC9	50S ribosomal subunit assembly factor BipA	1.33e-15	1.92e-28	6.94e-31	NA
4. PB	Q01372	Elongation factor 1-alpha	8.37e-06	1.54e-02	9.92e-10	NA
4. PB	Q2KTQ5	Peptide chain release factor 3	5.86e-06	3.21e-10	2.17e-21	NA
4. PB	Q1CCT8	Elongation factor G	1.11e-16	5.32e-18	5.99e-17	NA
4. PB	P53893	Ribosome assembly protein 1	1.63e-02	1.14e-06	8.98e-16	NA
4. PB	Q4A703	Elongation factor G	3.22e-15	2.03e-17	6.75e-21	NA
4. PB	Q0VSL8	Elongation factor G	4.55e-15	3.44e-15	6.18e-20	NA
4. PB	Q5QXU1	Peptide chain release factor 3	5.59e-12	1.27e-08	1.06e-18	NA
4. PB	P0CT31	Elongation factor 1-alpha	9.39e-06	1.08e-03	1.42e-09	NA
4. PB	Q1ISC5	Elongation factor G	0.00e+00	4.81e-17	1.80e-19	NA
4. PB	B2ISJ9	Elongation factor G	2.16e-14	5.69e-16	1.09e-19	NA
4. PB	Q83NI1	Elongation factor 4	0.00e+00	2.06e-68	0.0	NA
4. PB	Q55002	Oxytetracycline resistance protein	5.55e-16	6.48e-18	1.03e-18	NA
4. PB	Q8G5B6	Elongation factor G	1.39e-14	4.88e-17	6.42e-19	NA
4. PB	Q9A3K4	Elongation factor G	0.00e+00	2.59e-15	8.06e-22	NA
4. PB	C5CC67	Elongation factor G	4.46e-14	2.25e-16	3.49e-20	NA
4. PB	Q5YZZ7	Elongation factor 4	0.00e+00	3.44e-60	0.0	NA
4. PB	A8Z6I6	Elongation factor G	0.00e+00	1.97e-16	5.45e-19	NA
4. PB	A3MYA2	Peptide chain release factor 3	1.53e-09	3.62e-09	1.39e-17	NA
4. PB	A5G9T7	Peptide chain release factor 3	1.02e-05	9.88e-09	3.78e-17	NA
4. PB	Q1IX68	Elongation factor G	9.10e-15	2.29e-17	1.70e-21	NA
4. PB	Q9I244	Elongation factor G 2	4.33e-15	3.96e-16	4.22e-20	NA
4. PB	Q04BM6	Peptide chain release factor 3	3.34e-12	5.85e-08	3.01e-19	NA
4. PB	Q5VQ69	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.03e-24	0.0	NA
4. PB	A4TGY6	Elongation factor G	1.09e-14	5.32e-18	5.99e-17	NA
4. PB	Q23716	Elongation factor 2	1.37e-08	1.44e-12	1.70e-20	NA
4. PB	B5RUN4	Ribosome-releasing factor 2, mitochondrial	1.08e-09	2.14e-13	2.13e-18	NA
4. PB	B8NDZ1	Ribosome-releasing factor 2, mitochondrial	1.30e-05	1.19e-10	2.19e-18	NA
4. PB	Q1JAY1	Peptide chain release factor 3	3.07e-12	2.26e-08	1.75e-17	NA
4. PB	B2I6P5	Peptide chain release factor 3	8.12e-08	7.48e-11	4.17e-20	NA
4. PB	Q7Z2Z2	Elongation factor-like GTPase 1	2.51e-02	2.36e-05	1.68e-25	NA
4. PB	P68789	Elongation factor G	2.38e-14	2.46e-17	2.34e-17	NA
4. PB	A7GJ77	Elongation factor G	1.09e-14	1.88e-17	8.95e-20	NA
4. PB	Q9ASR1	Elongation factor 2	9.44e-13	3.82e-13	1.05e-22	NA
4. PB	B5RH09	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	P09757	Tetracycline resistance protein TetM	2.44e-15	3.26e-19	2.72e-18	NA
4. PB	Q660Y4	Elongation factor G 1	0.00e+00	3.69e-19	1.91e-23	NA
4. PB	A3Q2A6	Elongation factor 4	0.00e+00	6.54e-47	0.0	NA
4. PB	B8DN94	Elongation factor G	0.00e+00	5.14e-16	4.37e-19	NA
4. PB	B0UHX2	Elongation factor G	4.44e-15	1.33e-16	4.07e-20	NA
4. PB	P80868	Elongation factor G	2.79e-14	7.93e-16	1.02e-20	NA
4. PB	Q5A0M4	Elongation factor 2	2.14e-08	1.25e-14	1.13e-22	NA
4. PB	Q18FT0	Probable translation initiation factor IF-2	6.77e-05	2.92e-11	0.016	NA
4. PB	A6TWI5	Elongation factor G	1.11e-16	1.80e-17	2.23e-18	NA
4. PB	A6Q241	Elongation factor 4	0.00e+00	3.46e-68	0.0	NA
4. PB	Q605A9	Elongation factor G 2	0.00e+00	8.37e-18	4.27e-20	NA
4. PB	Q88XY8	Elongation factor G	8.77e-15	4.58e-16	1.92e-21	NA
4. PB	Q8FNA3	Elongation factor 4	0.00e+00	5.95e-63	0.0	NA
4. PB	B8E6N9	Peptide chain release factor 3	5.04e-12	1.43e-08	1.32e-18	NA
4. PB	B5FA93	Peptide chain release factor 3	1.31e-12	8.79e-10	1.83e-19	NA
4. PB	Q5ZYP6	Elongation factor G	0.00e+00	1.03e-17	1.93e-18	NA
4. PB	Q3ILP5	Elongation factor G 1	1.30e-13	1.01e-16	2.39e-19	NA
4. PB	Q839G9	Elongation factor G	1.11e-16	9.34e-17	4.87e-20	NA
4. PB	Q2S204	Peptide chain release factor 3	8.27e-06	3.03e-09	1.80e-15	NA
4. PB	B3P8M3	Ribosome-releasing factor 2, mitochondrial	1.41e-14	3.72e-13	1.06e-18	NA
4. PB	B6YWH3	Probable translation initiation factor IF-2	2.03e-04	6.98e-12	6.35e-07	NA
4. PB	Q62HK4	Elongation factor G 1	1.11e-16	1.94e-17	8.31e-19	NA
4. PB	B9M7Q2	Peptide chain release factor 3	2.07e-06	1.32e-08	3.68e-17	NA
4. PB	A2SLG0	Elongation factor G	0.00e+00	1.35e-17	5.40e-16	NA
4. PB	Q1H4P0	Elongation factor G	0.00e+00	6.58e-18	3.81e-18	NA
4. PB	B8D852	Elongation factor G	0.00e+00	4.14e-16	3.43e-17	NA
4. PB	B8ZUS2	Elongation factor 4	0.00e+00	1.62e-38	0.0	NA
4. PB	Q8CPR1	Peptide chain release factor 3	1.30e-08	3.30e-09	1.13e-18	NA
4. PB	P43927	Selenocysteine-specific elongation factor	1.57e-04	3.44e-04	1.57e-08	NA
4. PB	A5IM80	Elongation factor G	0.00e+00	9.97e-16	1.47e-19	NA
4. PB	B5VN01	Elongation factor G, mitochondrial	1.11e-13	1.39e-09	5.01e-24	NA
4. PB	Q3A9R2	Elongation factor G	3.01e-14	2.95e-17	3.27e-19	NA
4. PB	Q10W80	Elongation factor G 2	0.00e+00	7.31e-18	1.17e-23	NA
4. PB	Q7VA04	Elongation factor G	0.00e+00	3.08e-17	6.42e-19	NA
4. PB	C0M937	Elongation factor G	1.64e-14	1.31e-15	1.37e-19	NA
4. PB	B2A4D6	Elongation factor G	0.00e+00	4.02e-16	1.28e-20	NA
4. PB	Q4K530	Elongation factor G	8.99e-15	1.31e-16	4.50e-18	NA
4. PB	Q4URD6	Elongation factor G	1.89e-15	8.30e-17	3.57e-22	NA
4. PB	Q89A56	Peptide chain release factor 3	2.98e-08	4.10e-11	5.58e-19	NA
4. PB	Q08425	Tetracycline resistance protein TetQ	1.11e-16	4.18e-22	2.92e-17	NA
4. PB	A4FZQ3	Probable translation initiation factor IF-2	9.37e-05	2.44e-14	2.19e-05	NA
4. PB	O50565	Elongation factor G	1.11e-16	2.90e-17	4.08e-17	NA
4. PB	B0TQ95	Peptide chain release factor 3	8.06e-13	8.47e-08	4.52e-21	NA
4. PB	B8H8S3	Elongation factor 4	0.00e+00	2.43e-59	0.0	NA
4. PB	A5N4P4	Elongation factor G	0.00e+00	5.25e-17	1.77e-20	NA
4. PB	A0PM41	Elongation factor G	4.65e-14	2.25e-15	1.47e-20	NA
4. PB	A4XBP9	Elongation factor G	2.55e-14	6.37e-17	4.46e-19	NA
4. PB	A3D7J9	Peptide chain release factor 3	1.00e-12	9.66e-09	1.31e-18	NA
4. PB	P41745	Elongation factor 1-alpha	1.10e-05	3.53e-02	1.60e-07	NA
4. PB	Q90705	Elongation factor 2	3.11e-08	1.45e-11	7.93e-22	NA
4. PB	Q7VJZ1	Elongation factor 4	0.00e+00	1.13e-71	0.0	NA
4. PB	B8ZSC2	Elongation factor G	3.46e-14	5.12e-15	5.02e-20	NA
4. PB	B7VBK5	Peptide chain release factor 3	6.40e-12	3.02e-10	2.07e-18	NA
4. PB	Q8PNS6	Elongation factor G	9.99e-15	2.69e-17	2.62e-22	NA
4. PB	B7MTC0	Peptide chain release factor 3	6.82e-09	3.56e-08	2.23e-18	NA
4. PB	P13550	Elongation factor G	2.22e-16	4.74e-17	4.83e-18	NA
4. PB	Q8G603	Elongation factor 4	0.00e+00	3.13e-59	0.0	NA
4. PB	B1HMZ1	Elongation factor G	1.88e-14	4.11e-18	3.90e-20	NA
4. PB	Q9X1Y4	Elongation factor G-like protein	2.86e-14	1.41e-15	1.46e-08	NA
4. PB	Q0BSG5	Elongation factor G	1.89e-15	1.74e-15	4.20e-22	NA
4. PB	Q97SE4	Peptide chain release factor 3	1.61e-09	2.61e-07	4.09e-19	NA
4. PB	A7NR66	Elongation factor G	6.33e-15	2.80e-16	5.24e-19	NA
4. PB	Q8DBT6	Peptide chain release factor 3	7.41e-09	1.55e-08	2.33e-18	NA
4. PB	Q57J26	Elongation factor G	1.11e-16	5.19e-19	1.66e-17	NA
4. PB	A9VP74	Elongation factor G	2.07e-14	4.44e-18	6.85e-20	NA
4. PB	B1KSM8	Elongation factor G	7.33e-15	4.50e-18	7.64e-20	NA
4. PB	P40911	Elongation factor 1-alpha	3.65e-06	1.73e-02	2.36e-09	NA
4. PB	Q7UX15	Elongation factor 4 1	0.00e+00	2.16e-62	0.0	NA
4. PB	Q9JVH7	Peptide chain release factor 3	1.83e-12	6.74e-09	3.34e-22	NA
4. PB	Q8E3E7	Elongation factor G	1.68e-14	6.86e-16	9.07e-20	NA
4. PB	B7NDU8	Elongation factor G	1.11e-16	8.25e-19	1.13e-17	NA
4. PB	Q034X8	Elongation factor G	3.35e-14	2.42e-16	2.52e-20	NA
4. PB	B0KQD8	Peptide chain release factor 3	9.31e-12	1.09e-09	2.57e-18	NA
4. PB	A8F0P0	Elongation factor G	0.00e+00	1.10e-15	2.74e-20	NA
4. PB	A4T1R3	Elongation factor G	1.11e-16	2.13e-15	4.37e-21	NA
4. PB	B1IS45	Peptide chain release factor 3	1.12e-13	7.16e-08	2.31e-18	NA
4. PB	B5E1P9	Peptide chain release factor 3	NA	2.47e-07	5.59e-19	NA
4. PB	B1MW21	Elongation factor G	6.04e-14	5.83e-17	1.87e-21	NA
4. PB	Q67JU0	Elongation factor G	2.98e-14	3.43e-18	3.65e-20	NA
4. PB	Q2S909	Elongation factor G 1	3.33e-15	2.43e-17	3.52e-19	NA
4. PB	Q7NAV3	Elongation factor G	9.55e-15	2.49e-18	1.21e-21	NA
4. PB	Q9YIC0	Elongation factor 1-alpha	1.41e-05	8.46e-04	3.19e-08	NA
4. PB	B1VGK6	Elongation factor 4	0.00e+00	1.06e-64	0.0	NA
4. PB	P0A3B3	50S ribosomal subunit assembly factor BipA	0.00e+00	1.93e-32	2.88e-46	NA
4. PB	F4K410	Putative elongation factor TypA-like SVR3, chloroplastic	0.00e+00	2.64e-07	1.58e-34	NA
4. PB	Q057A1	Elongation factor G	1.11e-16	4.83e-15	3.21e-14	NA
4. PB	P0A1H4	Elongation factor G	0.00e+00	5.19e-19	1.66e-17	NA
4. PB	B4TU33	Peptide chain release factor 3	9.14e-09	1.54e-09	1.64e-18	NA
4. PB	Q046C7	Elongation factor G	3.02e-14	6.66e-17	1.60e-25	NA
4. PB	B8B2R1	Translation factor GUF1 homolog, mitochondrial	0.00e+00	1.60e-21	0.0	NA
4. PB	Q07KL5	Elongation factor G	2.22e-16	1.70e-16	1.30e-20	NA
4. PB	A3LWR2	Ribosome-releasing factor 2, mitochondrial	3.64e-10	9.62e-12	5.80e-22	NA
4. PB	A1RXH6	Probable translation initiation factor IF-2	8.81e-04	4.10e-10	1.07e-05	NA
4. PB	A7RR04	Elongation factor G, mitochondrial	2.22e-16	1.65e-11	9.33e-24	NA
4. PB	A5UBE8	Peptide chain release factor 3	7.55e-09	3.01e-08	9.22e-18	NA
4. PB	Q5XB97	Peptide chain release factor 3	5.93e-12	2.71e-08	1.81e-17	NA
4. PB	P72533	Tetracycline resistance protein TetO	4.00e-15	3.36e-19	7.09e-20	NA
4. PB	Q1QN33	Elongation factor G	0.00e+00	8.18e-17	1.45e-19	NA
4. PB	O26359	Probable translation initiation factor IF-2	1.16e-04	4.43e-13	9.47e-05	NA
4. PB	B0WGM1	Elongation factor G, mitochondrial	4.42e-13	4.26e-15	1.37e-21	NA
4. PB	A1AJU2	Peptide chain release factor 3	4.67e-09	9.34e-07	2.60e-18	NA
4. PB	Q6AJD2	Peptide chain release factor 3	1.60e-06	3.72e-10	6.87e-20	NA
4. PB	Q980Q8	Probable translation initiation factor IF-2	1.16e-04	1.03e-11	1.22e-05	NA
4. PB	Q110K2	Peptide chain release factor 3	4.39e-06	2.37e-12	4.89e-20	NA
4. PB	A4TQJ9	Peptide chain release factor 3	8.58e-09	1.41e-08	7.07e-17	NA
4. PB	A8AQM8	Elongation factor G	1.11e-16	1.89e-18	1.14e-17	NA
4. PB	Q46455	Selenocysteine-specific elongation factor	2.81e-06	4.50e-05	2.45e-11	NA
4. PB	Q2JUX5	Elongation factor G	3.33e-16	4.45e-19	8.47e-18	NA
4. PB	Q39Z86	Peptide chain release factor 3	4.30e-07	1.68e-08	1.10e-18	NA
4. PB	Q18CF4	Elongation factor G	0.00e+00	3.85e-16	6.98e-19	NA
4. PB	A9S3D3	Translation factor GUF1 homolog, mitochondrial	0.00e+00	6.48e-18	0.0	NA
4. PB	Q8K948	Elongation factor G	0.00e+00	2.64e-16	2.88e-17	NA
4. PB	B9W9T4	Elongation factor G, mitochondrial	6.66e-16	1.29e-08	1.12e-23	NA
4. PB	C7ZA26	Translation factor GUF1, mitochondrial	0.00e+00	1.03e-36	4.97e-174	NA
4. PB	B4RQX2	Elongation factor G	1.11e-16	2.75e-19	7.21e-18	NA
4. PB	B8ZKU0	Elongation factor G	1.98e-14	2.49e-16	1.04e-19	NA
4. PB	A8LC59	Elongation factor G	6.44e-14	7.17e-17	2.83e-18	NA
4. PB	Q8PU78	Probable translation initiation factor IF-2	1.63e-04	3.25e-13	6.52e-05	NA
4. PB	Q5R8Z3	Elongation factor 2	2.48e-08	9.14e-12	9.54e-22	NA
4. PB	B3L3C9	Translation factor GUF1 homolog, mitochondrial	0.00e+00	2.44e-02	1.21e-135	NA
4. PB	Q0HMD9	Elongation factor G 2	0.00e+00	1.18e-18	1.16e-23	NA
4. PB	C1AL17	Elongation factor G	4.21e-14	1.22e-15	7.58e-19	NA
4. PB	Q8EX19	Elongation factor G	1.67e-15	1.04e-16	7.97e-22	NA
4. PB	A5IRJ6	Peptide chain release factor 3	1.14e-08	2.96e-09	3.29e-18	NA
4. PB	B2TZQ6	Peptide chain release factor 3	1.56e-12	7.16e-08	2.31e-18	NA
4. PB	Q15029	116 kDa U5 small nuclear ribonucleoprotein component	8.05e-06	1.26e-05	1.30e-19	NA
4. PB	Q6MJ13	Elongation factor G 1	4.40e-13	1.72e-15	7.00e-19	NA
4. PB	P17507	Elongation factor 1-alpha, oocyte form	9.38e-06	3.65e-03	8.89e-09	NA
4. PB	A1RH82	Peptide chain release factor 3	5.19e-12	1.84e-08	1.09e-18	NA
4. PB	A4XQE4	Peptide chain release factor 3	3.90e-13	7.89e-10	2.12e-19	NA
4. PB	P64023	Elongation factor G	1.95e-14	4.52e-16	1.11e-19	NA
4. PB	Q2HEK0	Elongation factor G, mitochondrial	1.78e-15	4.70e-02	4.45e-22	NA
4. PB	B8HD12	Elongation factor G	1.11e-16	5.94e-16	8.46e-21	NA
4. PB	Q47CH1	Peptide chain release factor 3	1.15e-05	3.95e-10	8.85e-21	NA
4. PB	Q01520	Elongation factor 1-alpha	4.30e-06	2.06e-02	8.77e-10	NA
4. PB	Q6KHP1	Elongation factor 4	0.00e+00	9.98e-71	0.0	NA
4. PB	A1VA24	Peptide chain release factor 3	6.64e-08	1.14e-07	3.79e-19	NA
4. PB	Q8Z0U8	Peptide chain release factor 3	4.04e-14	1.23e-09	1.63e-18	NA
4. PB	P62631	Elongation factor 1-alpha 2	2.47e-06	5.60e-03	5.92e-09	NA
4. PB	Q8DVV4	Elongation factor G	2.14e-14	4.26e-16	9.22e-21	NA
4. PB	P44910	50S ribosomal subunit assembly factor BipA	8.88e-16	2.70e-30	6.35e-39	NA
4. PB	C1CXH0	Elongation factor G	0.00e+00	1.97e-16	2.19e-21	NA
4. PB	Q3A834	Elongation factor G 1	0.00e+00	1.35e-15	3.98e-17	NA
4. PB	Q46497	Selenocysteine-specific elongation factor	1.14e-04	2.97e-05	8.50e-07	NA
4. PB	Q5P409	Peptide chain release factor 3	3.41e-07	5.11e-08	3.11e-24	NA
4. PB	Q4DZ91	Translation factor GUF1 homolog 2, mitochondrial	0.00e+00	1.01e-16	4.17e-116	NA
4. PB	A0L5X0	Elongation factor G	1.11e-16	2.03e-17	3.78e-18	NA
4. PB	B9L7K0	Elongation factor G	0.00e+00	2.06e-16	3.37e-19	NA
4. PB	Q1JG54	Peptide chain release factor 3	5.63e-09	2.09e-08	1.23e-17	NA
4. PB	B0BWA2	Elongation factor G	0.00e+00	3.91e-15	2.48e-20	NA
4. PB	Q2SU24	Elongation factor G 2	2.22e-16	5.74e-17	9.66e-17	NA
4. PB	P0A6M8	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	Q1RHC3	Elongation factor G	0.00e+00	1.27e-16	1.18e-19	NA
4. PB	B8DUL6	Elongation factor 4	0.00e+00	2.29e-58	0.0	NA
4. PB	A4WVL1	Elongation factor G	0.00e+00	1.55e-15	3.81e-19	NA
4. PB	A5B4D2	Translation factor GUF1 homolog, chloroplastic	NA	2.20e-18	0.0	NA
4. PB	Q4ZMP1	Elongation factor G	6.66e-15	1.13e-15	3.15e-19	NA
4. PB	A6U0C5	Peptide chain release factor 3	1.56e-09	2.96e-09	3.29e-18	NA
4. PB	Q40034	Elongation factor 1-alpha	4.53e-07	2.88e-02	1.96e-08	NA
4. PB	A7TFN8	Elongation factor G, mitochondrial	1.14e-13	1.20e-03	1.49e-25	NA
4. PB	C1FMV4	Elongation factor G	2.22e-16	4.50e-18	7.64e-20	NA
4. PB	Q1Q8P1	Elongation factor G	0.00e+00	4.21e-17	8.90e-18	NA
4. PB	Q54807	Tetracycline resistance protein TetM from transposon Tn5251	1.22e-15	1.21e-18	2.49e-18	NA
4. PB	Q72I01	Elongation factor G	8.33e-15	1.98e-15	6.01e-22	NA
4. PB	Q2FU48	Probable translation initiation factor IF-2	3.16e-04	2.26e-13	1.97e-05	NA
4. PB	Q88QN8	Elongation factor G 1	0.00e+00	1.89e-16	2.83e-18	NA
4. PB	Q2RFP4	Elongation factor G	0.00e+00	1.52e-16	1.86e-18	NA
4. PB	Q5E7H2	Elongation factor G 2	2.22e-16	7.06e-17	8.42e-23	NA
4. PB	A9MN39	Elongation factor G	1.11e-16	4.38e-19	1.74e-17	NA
4. PB	B4PMC6	Ribosome-releasing factor 2, mitochondrial	5.10e-14	2.26e-13	1.52e-19	NA
4. PB	B2ILY0	Peptide chain release factor 3	1.45e-09	1.99e-07	4.59e-19	NA
4. PB	Q4JWS1	Elongation factor 4	0.00e+00	8.87e-64	0.0	NA
4. PB	Q8TV06	Probable translation initiation factor IF-2	1.76e-04	1.78e-11	0.001	NA
4. PB	Q4FQG5	Elongation factor G	0.00e+00	1.10e-16	8.16e-18	NA
4. PB	Q4L3K8	Elongation factor G	2.02e-14	2.06e-17	3.08e-20	NA
4. PB	B4HY41	Elongation factor G, mitochondrial	4.10e-13	1.32e-13	8.19e-21	NA
4. PB	Q8ZX20	Probable translation initiation factor IF-2	7.72e-04	3.23e-11	9.30e-07	NA
4. PB	Q7M8H5	Elongation factor 4	0.00e+00	6.87e-76	0.0	NA
4. PB	A7EVV9	Elongation factor G, mitochondrial	1.11e-16	1.43e-03	2.82e-21	NA
4. PB	Q1GP96	Elongation factor G	0.00e+00	1.65e-15	2.57e-18	NA
4. PB	A5DB27	Ribosome-releasing factor 2, mitochondrial	2.65e-12	1.14e-14	7.78e-20	NA
4. PB	Q754C8	Elongation factor 2	2.07e-08	1.40e-14	4.85e-21	NA
4. PB	Q8N442	Translation factor GUF1, mitochondrial	0.00e+00	2.41e-18	0.0	NA
4. PB	A6V0K2	Peptide chain release factor 3	5.44e-12	2.34e-10	2.35e-18	NA
4. PB	A5F904	Peptide chain release factor 3	8.01e-09	2.88e-07	1.24e-18	NA
4. PB	B6Q1T9	Ribosome-releasing factor 2, mitochondrial	3.72e-09	1.16e-07	1.66e-16	NA
4. PB	Q8XRM7	Elongation factor G 2	0.00e+00	1.29e-16	1.07e-18	NA
4. PB	B0BC74	Elongation factor G	0.00e+00	1.13e-15	2.30e-17	NA
4. PB	Q5BB57	Ribosome-releasing factor 2, mitochondrial	9.20e-07	1.64e-10	2.68e-19	NA
4. PB	Q1GK42	Elongation factor G	2.22e-16	1.28e-17	2.65e-18	NA
4. PB	Q73SD2	Elongation factor G	5.55e-16	5.14e-16	1.50e-20	NA
4. PB	B9DYA6	Elongation factor G	0.00e+00	5.25e-17	1.77e-20	NA
4. PB	Q59P53	Translation factor GUF1, mitochondrial	0.00e+00	1.51e-30	0.0	NA
4. PB	B7NLP5	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	A1AVJ7	Elongation factor G	0.00e+00	8.97e-15	1.73e-20	NA
4. PB	C1CPU9	Peptide chain release factor 3	6.02e-10	1.54e-07	4.84e-19	NA
4. PB	Q38VL2	Peptide chain release factor 3	1.09e-09	3.18e-07	4.56e-17	NA
4. PB	Q6F823	Peptide chain release factor 3	1.68e-12	6.42e-10	4.95e-18	NA
4. PB	P32324	Elongation factor 2	2.36e-08	1.27e-13	2.18e-21	NA
4. PB	B0TC53	Elongation factor G	0.00e+00	2.12e-16	7.46e-19	NA
4. PB	Q754I9	Ribosome-releasing factor 2, mitochondrial	4.85e-12	5.12e-12	3.70e-21	NA
4. PB	A3CQM2	Elongation factor G	1.85e-14	5.86e-16	9.58e-20	NA
4. PB	Q03Q83	Peptide chain release factor 3	2.45e-12	2.97e-08	7.68e-17	NA
4. PB	Q21M89	Elongation factor G 1	4.00e-15	5.66e-17	4.36e-19	NA
4. PB	Q82T70	Elongation factor G	0.00e+00	6.09e-17	5.65e-18	NA
4. PB	Q7VTD5	Elongation factor G	0.00e+00	1.46e-17	7.70e-17	NA
4. PB	A8LM45	Elongation factor G	1.11e-16	4.02e-17	9.50e-19	NA
4. PB	A2RP72	Elongation factor G	0.00e+00	2.95e-15	2.75e-19	NA
4. PB	P29520	Elongation factor 1-alpha	1.01e-05	4.43e-03	7.41e-08	NA
4. PB	A8AYN4	Peptide chain release factor 3	2.04e-10	1.70e-07	7.17e-19	NA
4. PB	Q3YU19	Peptide chain release factor 3	1.15e-13	6.19e-08	2.31e-18	NA
4. PB	B8I5N7	Elongation factor G	0.00e+00	6.19e-18	6.41e-18	NA
4. PB	C1CCK2	Peptide chain release factor 3	1.37e-11	1.54e-07	4.84e-19	NA
4. PB	Q2NZY2	Elongation factor G	9.21e-15	7.06e-17	2.55e-22	NA
4. PB	Q0SFF3	Elongation factor G	0.00e+00	1.55e-15	8.35e-20	NA
4. PB	P9WK97	Elongation factor 4	0.00e+00	1.46e-36	0.0	NA
4. PB	Q48712	Tetracycline resistance protein TetS	7.79e-13	1.30e-19	4.76e-20	NA
4. PB	Q12JZ0	Elongation factor G 2	0.00e+00	1.37e-17	7.32e-24	NA
4. PB	Q06193	Elongation factor 2	4.88e-08	2.09e-13	9.16e-23	NA
4. PB	B9DUR6	Peptide chain release factor 3	5.56e-10	2.74e-08	7.92e-17	NA
4. PB	Q031X0	Peptide chain release factor 3	1.13e-07	9.43e-09	2.38e-20	NA
4. PB	B1L7Q0	Elongation factor 2	8.39e-10	2.30e-23	8.48e-26	NA
4. PB	Q3IHI5	Peptide chain release factor 3	1.03e-08	1.22e-09	3.61e-17	NA
4. PB	Q3MDM4	Elongation factor G	2.22e-16	4.74e-17	2.65e-19	NA
4. PB	Q31IY5	Elongation factor G	1.59e-13	4.53e-17	2.59e-15	NA
4. PB	Q3YWT2	Elongation factor G	0.00e+00	4.73e-19	1.14e-17	NA
4. PB	P17786	Elongation factor 1-alpha	4.08e-06	3.12e-02	3.46e-09	NA
4. PB	B1XSP8	Elongation factor G	1.11e-16	1.45e-16	9.08e-15	NA
4. PB	B7JKB6	Elongation factor G	NA	4.24e-18	7.54e-20	NA
4. PB	O23755	Elongation factor 2	1.66e-08	8.89e-14	2.42e-22	NA
4. PB	Q3KLR3	Elongation factor G	0.00e+00	9.97e-16	1.60e-17	NA
4. PB	A1WHC2	Elongation factor G	0.00e+00	2.50e-17	1.03e-16	NA
4. PB	Q8DV91	Peptide chain release factor 3	1.25e-10	4.96e-07	6.69e-17	NA
4. PB	A8H733	Peptide chain release factor 3	7.12e-13	4.04e-08	4.89e-20	NA
4. PB	B7IT16	Elongation factor G	2.68e-14	1.50e-17	7.54e-20	NA
4. PB	Q0AIJ8	Elongation factor G	0.00e+00	5.66e-17	1.19e-17	NA
4. PB	A3DIZ9	Elongation factor G	1.87e-14	9.73e-18	1.42e-17	NA
4. PB	Q73IX7	Elongation factor G	0.00e+00	1.52e-16	1.19e-18	NA
4. PB	Q487B0	Peptide chain release factor 3	3.80e-12	8.37e-08	1.30e-20	NA
4. PB	A5IYS0	Elongation factor 4	0.00e+00	2.48e-72	0.0	NA
4. PB	B0TWY6	Peptide chain release factor 3	4.63e-09	6.28e-09	8.35e-21	NA
4. PB	Q71V39	Elongation factor 1-alpha 2	1.29e-05	5.36e-03	7.30e-09	NA
4. PB	B5ELX6	Elongation factor G	0.00e+00	2.36e-17	3.82e-18	NA
4. PB	Q39KH0	Elongation factor G 1	3.33e-16	2.18e-16	2.29e-16	NA
4. PB	Q38UQ9	Elongation factor G	3.85e-14	2.53e-16	8.25e-22	NA
4. PB	Q9ZLZ3	50S ribosomal subunit assembly factor BipA	5.04e-14	3.52e-30	4.08e-40	NA
4. PB	A4Y9B3	Peptide chain release factor 3	4.77e-12	6.05e-08	1.28e-18	NA
4. PB	P39883	Peptide chain release factor 3	1.23e-06	1.66e-09	1.47e-19	NA
4. PB	C1DAR4	Elongation factor G	1.11e-16	6.20e-16	4.11e-16	NA
4. PB	B9KD01	Elongation factor 4	0.00e+00	2.65e-75	0.0	NA
4. PB	A5WGL0	Elongation factor G	1.11e-16	3.03e-17	5.27e-18	NA
4. PB	Q037T6	Peptide chain release factor 3	1.11e-07	2.15e-07	1.54e-17	NA
4. PB	Q31KM4	Peptide chain release factor 3	1.33e-06	1.10e-08	2.69e-22	NA
4. PB	Q5HIC8	Elongation factor G	2.36e-14	2.46e-17	2.34e-17	NA
4. PB	Q04C17	Elongation factor G	6.77e-15	8.30e-17	2.45e-23	NA
4. PB	Q3BQQ3	Peptide chain release factor 3	3.34e-06	1.07e-10	2.09e-19	NA
4. PB	Q041Z5	Peptide chain release factor 3	1.84e-07	1.49e-07	1.16e-16	NA
4. PB	A0RQI0	Elongation factor G	2.22e-16	8.18e-17	3.95e-18	NA
4. PB	B6I2Q6	Peptide chain release factor 3	7.18e-09	7.16e-08	2.31e-18	NA
4. PB	Q39Y09	Elongation factor G 1	0.00e+00	9.76e-17	3.85e-18	NA
4. PB	Q875Z2	Elongation factor 2	2.41e-08	5.97e-15	1.44e-20	NA
5. P	P35149	Stage IV sporulation protein A	5.86e-03	4.63e-02	NA	NA
5. P	Q81SW4	Stage IV sporulation protein A	6.03e-03	3.28e-03	NA	NA
5. P	Q182W3	Stage IV sporulation protein A	9.30e-03	3.59e-02	NA	NA
7. B	P26843	Elongation factor 4 (Fragment)	7.77e-16	NA	1.65e-52	NA
7. B	C4Z5N7	Translation initiation factor IF-2	2.19e-04	NA	2.05e-19	NA
7. B	Q889X3	Elongation factor Tu	2.30e-07	NA	5.94e-14	NA
7. B	Q8DI42	Elongation factor Tu	1.33e-06	NA	3.84e-12	NA
7. B	P14864	Elongation factor 1-alpha	1.31e-05	NA	8.96e-10	NA
7. B	Q4FNM9	Translation initiation factor IF-2	4.06e-05	NA	4.67e-12	NA
7. B	A0KUJ9	GTPase Der	4.38e-03	NA	1.09e-04	NA
7. B	B7UGV7	GTPase Der	2.56e-03	NA	1.05e-04	NA
7. B	P0DA83	Elongation factor Tu	2.05e-07	NA	8.56e-12	NA
7. B	A4FWE9	Elongation factor 1-alpha	2.26e-06	NA	1.56e-13	NA
7. B	B5Z3B3	Sulfate adenylyltransferase subunit 1	5.05e-06	NA	1.93e-10	NA
7. B	P17197	Elongation factor 1-alpha	3.21e-06	NA	2.53e-14	NA
7. B	Q3ZJ24	Elongation factor Tu, chloroplastic	7.75e-07	NA	2.55e-09	NA
7. B	A7GRE3	Translation initiation factor IF-2	3.50e-06	NA	2.04e-15	NA
7. B	B1IGF6	Elongation factor Tu	2.51e-07	NA	7.05e-17	NA
7. B	A9KZX1	Translation initiation factor IF-2	3.20e-04	NA	3.75e-18	NA
7. B	Q91YJ5	Translation initiation factor IF-2, mitochondrial	3.58e-05	NA	1.35e-14	NA
7. B	Q7VA05	Elongation factor Tu	1.01e-06	NA	3.83e-17	NA
7. B	Q5FJN6	Translation initiation factor IF-2	1.48e-04	NA	3.73e-16	NA
7. B	A4SHU2	Elongation factor Tu	1.61e-07	NA	1.44e-11	NA
7. B	A2CI56	Elongation factor Tu, chloroplastic	8.97e-07	NA	2.20e-10	NA
7. B	Q0HLG1	Translation initiation factor IF-2	3.37e-04	NA	1.10e-18	NA
7. B	Q664R7	Elongation factor Tu 2	2.13e-07	NA	2.23e-12	NA
7. B	B8D9U9	Elongation factor Tu	2.05e-07	NA	1.24e-10	NA
7. B	C1D890	Sulfate adenylyltransferase subunit 1	1.72e-04	NA	1.79e-08	NA
7. B	Q1XDN0	Translation initiation factor IF-2, chloroplastic	5.74e-05	NA	3.53e-15	NA
7. B	A1WHC3	Elongation factor Tu	1.68e-07	NA	2.79e-14	NA
7. B	A9A9U3	Elongation factor 1-alpha	2.74e-06	NA	7.85e-14	NA
7. B	B1KRR0	Translation initiation factor IF-2	2.44e-04	NA	4.72e-15	NA
7. B	Q0I0A7	Elongation factor Tu 2	2.46e-07	NA	8.81e-16	NA
7. B	Q6MDN0	Elongation factor Tu	2.80e-07	NA	1.12e-16	NA
7. B	Q67P86	Translation initiation factor IF-2	1.13e-03	NA	2.10e-12	NA
7. B	Q8FF59	GTPase Der	8.42e-03	NA	1.07e-04	NA
7. B	A8MFA8	Translation initiation factor IF-2	4.95e-05	NA	4.48e-16	NA
7. B	Q8ETY4	Elongation factor Tu	1.68e-07	NA	2.13e-11	NA
7. B	Q27140	Elongation factor 1-alpha 2	4.59e-06	NA	1.73e-09	NA
7. B	Q4L6I0	GTPase Der	7.47e-03	NA	0.039	NA
7. B	Q03QT5	Translation initiation factor IF-2	1.95e-04	NA	1.91e-15	NA
7. B	C5BSJ5	Sulfate adenylyltransferase subunit 1	4.37e-06	NA	4.97e-10	NA
7. B	Q1IIT3	Translation initiation factor IF-2	7.61e-04	NA	1.42e-07	NA
7. B	Q1BRT3	Elongation factor Tu	1.78e-07	NA	6.70e-16	NA
7. B	B4E7L1	Translation initiation factor IF-2	5.66e-04	NA	2.92e-18	NA
7. B	Q9PKU0	Translation initiation factor IF-2	2.40e-04	NA	1.12e-11	NA
7. B	A9MP36	Translation initiation factor IF-2	4.94e-04	NA	3.83e-13	NA
7. B	A6WRG8	Translation initiation factor IF-2	3.27e-04	NA	3.75e-18	NA
7. B	A7I3V0	Translation initiation factor IF-2	1.75e-04	NA	9.04e-16	NA
7. B	Q6LXI1	Elongation factor 1-alpha	1.90e-06	NA	4.76e-13	NA
7. B	Q9ZF22	Translation initiation factor IF-2	4.12e-04	NA	1.41e-12	NA
7. B	A9M1D5	Translation initiation factor IF-2	6.04e-04	NA	1.20e-15	NA
7. B	A1TJ05	Elongation factor Tu	1.74e-07	NA	1.38e-14	NA
7. B	Q59QD6	Elongation factor 1-alpha 2	1.58e-05	NA	7.22e-09	NA
7. B	A4YBY5	Elongation factor Tu	2.47e-07	NA	1.04e-15	NA
7. B	P42439	Elongation factor Tu	1.61e-07	NA	2.90e-12	NA
7. B	P50371	Elongation factor Tu, chloroplastic	1.20e-06	NA	6.71e-13	NA
7. B	Q66F60	Translation initiation factor IF-2	5.09e-04	NA	1.65e-12	NA
7. B	Q88DV7	Translation initiation factor IF-2	4.17e-04	NA	1.13e-18	NA
7. B	A0T0K6	Elongation factor Tu, chloroplastic	1.22e-06	NA	7.39e-10	NA
7. B	Q822I4	Elongation factor Tu	2.37e-07	NA	1.95e-16	NA
7. B	Q0K5Z9	Elongation factor Tu	1.69e-07	NA	4.32e-15	NA
7. B	Q8PC59	Elongation factor Tu-A	2.06e-07	NA	2.74e-14	NA
7. B	Q1C1T4	Elongation factor Tu 2	2.00e-07	NA	2.46e-12	NA
7. B	Q7U8L9	Translation initiation factor IF-2	1.32e-05	NA	2.09e-14	NA
7. B	A4TRI3	Translation initiation factor IF-2	5.14e-04	NA	1.65e-12	NA
7. B	A8GPF2	Elongation factor Tu	3.11e-07	NA	1.35e-16	NA
7. B	Q3A4A7	Translation initiation factor IF-2	2.27e-04	NA	3.43e-13	NA
7. B	Q6AJY4	Translation initiation factor IF-2	2.31e-04	NA	3.20e-12	NA
7. B	Q5JDL3	Translation initiation factor 2 subunit gamma	2.48e-08	NA	2.75e-18	NA
7. B	Q89AF5	Translation initiation factor IF-2	4.71e-04	NA	2.65e-15	NA
7. B	P50372	Elongation factor Tu, chloroplastic	9.90e-07	NA	3.54e-11	NA
7. B	Q1WU83	Elongation factor Tu	1.71e-07	NA	4.51e-14	NA
7. B	Q54XP6	Eukaryotic translation initiation factor 5B	2.36e-03	NA	2.02e-07	NA
7. B	A9N2D8	Sulfate adenylyltransferase subunit 1	1.25e-06	NA	3.90e-10	NA
7. B	A2C4U5	Elongation factor Tu	1.09e-06	NA	2.23e-18	NA
7. B	Q8EQU1	Translation initiation factor IF-2	7.87e-05	NA	2.77e-15	NA
7. B	A5CXX6	Translation initiation factor IF-2	2.35e-04	NA	4.33e-13	NA
7. B	B8D7V3	Sulfate adenylyltransferase subunit 1	1.99e-06	NA	1.52e-10	NA
7. B	P04766	Translation initiation factor IF-2	3.23e-04	NA	3.35e-14	NA
7. B	Q5PNI6	GTPase Der	1.01e-02	NA	5.01e-05	NA
7. B	B7M7L5	GTPase Der	6.77e-03	NA	1.06e-04	NA
7. B	C1CSB0	Elongation factor Tu	2.32e-07	NA	3.06e-12	NA
7. B	B5BEY8	Sulfate adenylyltransferase subunit 1	1.46e-06	NA	2.45e-10	NA
7. B	Q1ACI3	Elongation factor Tu, chloroplastic	1.13e-06	NA	5.89e-13	NA
7. B	Q65ZX2	Translation initiation factor IF-2	1.58e-04	NA	9.63e-14	NA
7. B	Q1GAQ0	Elongation factor Tu	2.09e-07	NA	3.33e-16	NA
7. B	A5UYI1	Elongation factor Tu 2	2.52e-07	NA	3.18e-13	NA
7. B	A8EWD7	Translation initiation factor IF-2	7.61e-04	NA	7.97e-13	NA
7. B	Q492B2	Elongation factor Tu	2.08e-07	NA	4.36e-13	NA
7. B	O58822	Probable translation initiation factor IF-2	1.53e-03	NA	0.025	NA
7. B	A5F926	Translation initiation factor IF-2	5.28e-04	NA	6.45e-13	NA
7. B	A5CEN6	Translation initiation factor IF-2	9.42e-05	NA	1.50e-12	NA
7. B	B0TWR3	Translation initiation factor IF-2	2.64e-04	NA	2.13e-12	NA
7. B	Q0SN31	Elongation factor Tu	1.16e-07	NA	1.21e-13	NA
7. B	B0TX03	Elongation factor Tu	1.83e-07	NA	4.90e-13	NA
7. B	O33594	Elongation factor Tu	1.50e-07	NA	1.92e-11	NA
7. B	P0CE48	Elongation factor Tu 2	3.32e-07	NA	3.43e-12	NA
7. B	Q5FGX3	Translation initiation factor IF-2	6.79e-05	NA	2.35e-13	NA
7. B	A5WBS5	Translation initiation factor IF-2	4.61e-04	NA	3.22e-17	NA
7. B	P48862	Elongation factor G (Fragment)	1.48e-02	NA	1.30e-04	NA
7. B	Q04PT6	Elongation factor Tu	2.53e-07	NA	8.54e-10	NA
7. B	A1WVD6	Elongation factor Tu 2	1.60e-07	NA	4.34e-16	NA
7. B	P56893	Sulfate adenylyltransferase subunit 1	1.06e-05	NA	7.25e-10	NA
7. B	Q6LVC0	Elongation factor Tu 1	2.47e-07	NA	9.22e-16	NA
7. B	A4VPP0	Translation initiation factor IF-2	3.45e-04	NA	4.15e-18	NA
7. B	A4VHL6	Elongation factor Tu 1	2.31e-07	NA	1.74e-14	NA
7. B	Q7NVN5	Sulfate adenylyltransferase subunit 1	1.66e-06	NA	1.80e-08	NA
7. B	A7ZPV4	GTPase Der	1.05e-02	NA	1.06e-04	NA
7. B	Q2LQA3	Elongation factor Tu	2.88e-07	NA	3.68e-13	NA
7. B	Q1CUA6	Translation initiation factor IF-2	6.57e-04	NA	3.56e-15	NA
7. B	P0A559	Elongation factor Tu	2.06e-07	NA	1.57e-13	NA
7. B	A4IJI7	Elongation factor Tu	1.57e-07	NA	2.85e-15	NA
7. B	Q6CZW6	Elongation factor Tu	2.30e-07	NA	4.64e-12	NA
7. B	Q49V58	Elongation factor Tu	1.59e-07	NA	8.75e-15	NA
7. B	Q2LWU6	Translation initiation factor IF-2	2.55e-04	NA	2.39e-09	NA
7. B	Q2SML3	Translation initiation factor IF-2	3.48e-04	NA	9.46e-18	NA
7. B	Q2RFP5	Elongation factor Tu	1.95e-07	NA	5.76e-13	NA
7. B	O31297	Elongation factor Tu	2.86e-07	NA	1.24e-10	NA
7. B	Q3AQ22	GTPase Der	4.06e-02	NA	0.019	NA
7. B	A8AWA0	Elongation factor Tu	2.43e-07	NA	5.85e-13	NA
7. B	O13354	Eukaryotic peptide chain release factor GTP-binding subunit	2.05e-05	NA	8.27e-06	NA
7. B	Q2YAZ9	Elongation factor Tu	1.92e-07	NA	9.42e-14	NA
7. B	Q8K9H1	Translation initiation factor IF-2	5.03e-04	NA	3.08e-15	NA
7. B	Q3YV04	Elongation factor Tu 2	3.25e-07	NA	3.43e-12	NA
7. B	Q8DD27	Elongation factor Tu 1	1.97e-07	NA	4.96e-15	NA
7. B	A5N4N1	Elongation factor Tu	2.00e-07	NA	2.08e-16	NA
7. B	A4XI37	Elongation factor Tu	2.02e-07	NA	5.03e-16	NA
7. B	A3PEZ7	Elongation factor Tu	9.54e-07	NA	1.38e-17	NA
7. B	B2FN90	Translation initiation factor IF-2	1.96e-04	NA	5.93e-16	NA
7. B	P0A3A9	Elongation factor Tu	1.74e-07	NA	3.77e-17	NA
7. B	B1ZDQ8	Translation initiation factor IF-2	7.48e-05	NA	2.85e-10	NA
7. B	Q03LX0	Elongation factor Tu	2.23e-07	NA	2.28e-13	NA
7. B	P42474	Elongation factor Tu	1.85e-07	NA	5.21e-14	NA
7. B	P0DB84	Translation initiation factor IF-2	4.44e-04	NA	2.88e-12	NA
7. B	A8F982	Elongation factor Tu	1.40e-07	NA	1.99e-13	NA
7. B	B2SF94	GTPase Der	1.05e-02	NA	1.12e-04	NA
7. B	B3PI96	Translation initiation factor IF-2	4.57e-04	NA	7.17e-17	NA
7. B	Q5UYS2	Translation initiation factor 2 subunit gamma	5.43e-08	NA	1.92e-06	NA
7. B	P32186	Elongation factor 1-alpha	3.59e-06	NA	1.28e-08	NA
7. B	Q7MNE7	GTPase Der	1.03e-02	NA	2.51e-04	NA
7. B	Q1RHL9	Elongation factor Tu	1.65e-07	NA	3.91e-14	NA
7. B	A3Q980	Elongation factor Tu 2	2.13e-07	NA	2.94e-15	NA
7. B	Q2K9N2	Elongation factor Tu 1	5.97e-08	NA	7.74e-13	NA
7. B	P65134	Translation initiation factor IF-2	1.13e-04	NA	1.47e-14	NA
7. B	A7GZK6	Elongation factor Tu	2.42e-07	NA	1.16e-17	NA
7. B	Q48UK5	Elongation factor Tu	1.99e-07	NA	8.56e-12	NA
7. B	Q2YSB3	Elongation factor Tu	1.48e-07	NA	1.96e-13	NA
7. B	Q482T9	Translation initiation factor IF-2	2.48e-04	NA	1.09e-15	NA
7. B	A6YG72	Elongation factor Tu, chloroplastic	1.07e-06	NA	5.83e-08	NA
7. B	C3K2X8	Elongation factor Tu	2.90e-07	NA	5.66e-13	NA
7. B	Q9SHI1	Translation initiation factor IF-2, chloroplastic	3.69e-04	NA	2.92e-09	NA
7. B	Q1G9P9	Translation initiation factor IF-2	1.41e-04	NA	1.72e-14	NA
7. B	Q5WT36	Translation initiation factor IF-2	2.71e-04	NA	8.39e-16	NA
7. B	A0L5V8	Elongation factor Tu	1.63e-07	NA	4.42e-14	NA
7. B	Q877T5	Elongation factor Tu	1.89e-07	NA	5.30e-16	NA
7. B	P57997	Translation initiation factor IF-2, chloroplastic	NA	NA	9.77e-12	NA
7. B	Q9Z8M1	Translation initiation factor IF-2	3.04e-04	NA	4.26e-11	NA
7. B	C1A6Q3	Elongation factor Tu	7.98e-07	NA	1.34e-07	NA
7. B	Q63H92	Elongation factor Tu	1.60e-07	NA	9.92e-13	NA
7. B	A5GVG4	Translation initiation factor IF-2	5.90e-04	NA	5.98e-14	NA
7. B	Q5F797	Translation initiation factor IF-2	5.39e-04	NA	8.60e-17	NA
7. B	P64030	Elongation factor Tu	2.67e-07	NA	3.06e-12	NA
7. B	Q8DF02	GTPase Der	6.99e-03	NA	3.08e-04	NA
7. B	Q5HGG2	Translation initiation factor IF-2	1.14e-04	NA	1.45e-14	NA
7. B	Q4UWA2	Translation initiation factor IF-2	2.35e-04	NA	4.47e-12	NA
7. B	Q7VQM3	Translation initiation factor IF-2	5.96e-04	NA	3.04e-13	NA
7. B	Q0ANN1	Elongation factor Tu	1.67e-07	NA	3.29e-14	NA
7. B	Q5JFZ4	Elongation factor 1-alpha	2.04e-06	NA	1.19e-15	NA
7. B	C1FSU2	GTPase Der	7.62e-03	NA	1.75e-04	NA
7. B	Q7TTF9	Elongation factor Tu	2.13e-07	NA	1.28e-12	NA
7. B	Q9Z0N1	Eukaryotic translation initiation factor 2 subunit 3, X-linked	6.99e-10	NA	7.92e-04	NA
7. B	P99152	Elongation factor Tu	1.50e-07	NA	1.96e-13	NA
7. B	B7J241	Elongation factor Tu	1.21e-07	NA	5.17e-13	NA
7. B	Q3ILP4	Elongation factor Tu 1	2.16e-07	NA	4.60e-13	NA
7. B	B8E9T1	GTPase Der	1.05e-02	NA	1.26e-04	NA
7. B	Q3A6R2	Elongation factor Tu 1	1.96e-07	NA	5.51e-12	NA
7. B	A5UZQ2	Translation initiation factor IF-2	4.77e-05	NA	1.50e-15	NA
7. B	Q7UMZ0	Elongation factor Tu	7.47e-07	NA	3.63e-10	NA
7. B	O50274	Bifunctional enzyme CysN/CysC	2.83e-04	NA	1.50e-10	NA
7. B	B9M1G0	Translation initiation factor IF-2	2.04e-04	NA	1.86e-12	NA
7. B	Q5FFE6	Elongation factor Tu	1.82e-07	NA	2.52e-09	NA
7. B	C1AYS3	Elongation factor Tu	1.95e-07	NA	1.23e-13	NA
7. B	P25698	Elongation factor 1-alpha	4.01e-06	NA	1.43e-09	NA
7. B	A4XBP8	Elongation factor Tu	1.82e-07	NA	3.72e-09	NA
7. B	O59410	Translation initiation factor 2 subunit gamma	3.20e-07	NA	5.26e-12	NA
7. B	Q6AXM7	HBS1-like protein	3.68e-05	NA	2.56e-12	NA
7. B	Q03033	Elongation factor 1-alpha	4.08e-06	NA	8.02e-10	NA
7. B	B7IHU4	Elongation factor Tu	2.23e-07	NA	2.45e-15	NA
7. B	A6LHS1	Translation initiation factor IF-2	2.72e-04	NA	8.60e-10	NA
7. B	P0A6N2	Elongation factor Tu	3.17e-07	NA	3.43e-12	NA
7. B	C0PZ54	Translation initiation factor IF-2	4.98e-04	NA	3.79e-13	NA
7. B	A5E866	Translation initiation factor IF-2	1.63e-04	NA	3.22e-13	NA
7. B	Q06J54	Elongation factor Tu, chloroplastic	1.03e-06	NA	2.57e-11	NA
7. B	P29521	Elongation factor 1-alpha	3.23e-06	NA	7.31e-09	NA
7. B	Q7NY13	Translation initiation factor IF-2	6.03e-04	NA	4.82e-16	NA
7. B	Q6FZC0	Elongation factor Tu 1	6.04e-08	NA	9.10e-13	NA
7. B	A5N842	Translation initiation factor IF-2	2.98e-05	NA	4.77e-15	NA
7. B	A6UQ14	Elongation factor 1-alpha	1.74e-06	NA	9.73e-14	NA
7. B	A7NEC7	Elongation factor Tu	1.63e-07	NA	4.86e-14	NA
7. B	Q9RTG5	Translation initiation factor IF-2	1.06e-05	NA	6.49e-12	NA
7. B	Q74CT3	Translation initiation factor IF-2	2.21e-04	NA	3.01e-13	NA
7. B	A9AAA4	Translation initiation factor 2 subunit gamma	2.83e-08	NA	3.00e-09	NA
7. B	A5F578	Sulfate adenylyltransferase subunit 1	2.73e-06	NA	3.05e-09	NA
7. B	A7X1Q1	Translation initiation factor IF-2	1.11e-04	NA	1.47e-14	NA
7. B	A0LXQ1	Translation initiation factor IF-2	2.65e-04	NA	2.11e-13	NA
7. B	Q2NC10	Translation initiation factor IF-2	6.95e-05	NA	3.36e-10	NA
7. B	B5BAY9	GTPase Der	1.92e-02	NA	5.01e-05	NA
7. B	B7UJ63	Translation initiation factor IF-2	2.45e-04	NA	2.11e-13	NA
7. B	B1IQV3	Translation initiation factor IF-2	2.43e-04	NA	2.11e-13	NA
7. B	A9KBM1	Translation initiation factor IF-2	7.94e-05	NA	6.99e-15	NA
7. B	P84316	Elongation factor 1-alpha (Fragment)	2.19e-06	NA	1.25e-06	NA
7. B	P18906	Elongation factor Tu	1.96e-07	NA	1.10e-19	NA
7. B	Q3KMS4	Translation initiation factor IF-2	2.39e-04	NA	6.85e-12	NA
7. B	A7NAB1	GTPase Der	1.37e-02	NA	1.98e-04	NA
7. B	Q5YPG4	Elongation factor Tu	2.12e-07	NA	4.99e-15	NA
7. B	Q4QMW6	Elongation factor Tu 1	2.24e-07	NA	6.19e-13	NA
7. B	B7NT95	Sulfate adenylyltransferase subunit 1	1.00e-06	NA	2.13e-10	NA
7. B	Q9ZF28	Translation initiation factor IF-2	5.20e-04	NA	1.30e-17	NA
7. B	A1S462	Translation initiation factor IF-2	4.89e-04	NA	1.85e-18	NA
7. B	Q3ZXX3	Elongation factor Tu	1.19e-06	NA	6.36e-13	NA
7. B	B7K834	Elongation factor Tu	1.31e-06	NA	1.74e-11	NA
7. B	Q2Y7W2	Translation initiation factor IF-2	1.87e-04	NA	3.22e-18	NA
7. B	B3DT29	Elongation factor Tu	1.76e-07	NA	5.73e-13	NA
7. B	A5IYA9	Elongation factor Tu	4.74e-07	NA	2.72e-14	NA
7. B	Q4FQG6	Elongation factor Tu	1.86e-07	NA	4.04e-11	NA
7. B	B4UHG0	Translation initiation factor IF-2	2.90e-04	NA	6.14e-10	NA
7. B	P18668	Elongation factor Tu	1.10e-06	NA	2.86e-12	NA
7. B	Q8YEB3	Translation initiation factor IF-2	2.81e-04	NA	1.97e-13	NA
7. B	O59683	Translation initiation factor IF-2, mitochondrial	3.15e-05	NA	4.55e-10	NA
7. B	O63930	Elongation factor Tu, chloroplastic (Fragment)	5.60e-07	NA	6.64e-06	NA
7. B	Q3ZXU3	Translation initiation factor IF-2	4.09e-06	NA	7.11e-17	NA
7. B	Q1AU14	Elongation factor Tu	2.50e-07	NA	1.45e-14	NA
7. B	Q3IYN5	Translation initiation factor IF-2	8.91e-05	NA	4.43e-13	NA
7. B	Q826Z7	Elongation factor Tu 2	6.00e-08	NA	4.52e-14	NA
7. B	Q11HA6	Elongation factor Tu	6.02e-08	NA	1.17e-13	NA
7. B	O59153	Elongation factor 1-alpha	5.44e-07	NA	1.73e-15	NA
7. B	B7I3R9	Translation initiation factor IF-2	4.49e-04	NA	2.19e-14	NA
7. B	B1IVA7	Elongation factor Tu 2	3.31e-07	NA	3.43e-12	NA
7. B	Q8PC51	Elongation factor Tu-B	2.04e-07	NA	2.72e-14	NA
7. B	Q11PK5	Translation initiation factor IF-2	9.43e-05	NA	9.23e-11	NA
7. B	A4J0Z5	Elongation factor Tu	2.38e-07	NA	2.06e-14	NA
7. B	B6I1P3	Translation initiation factor IF-2	4.77e-04	NA	2.11e-13	NA
7. B	Q1GP97	Elongation factor Tu	1.61e-07	NA	1.67e-13	NA
7. B	B2GIL2	Elongation factor Tu	1.80e-07	NA	3.93e-19	NA
7. B	B2VE93	GTPase Der	5.64e-03	NA	6.16e-06	NA
7. B	Q21SF0	Elongation factor Tu 1	1.93e-07	NA	1.70e-15	NA
7. B	Q0TPR7	Translation initiation factor IF-2	5.09e-05	NA	1.60e-13	NA
7. B	P57458	Translation initiation factor IF-2	4.31e-04	NA	7.67e-16	NA
7. B	P56292	Elongation factor Tu, chloroplastic	1.06e-06	NA	1.97e-10	NA
7. B	Q4A9G1	Elongation factor Tu	1.26e-07	NA	1.45e-15	NA
7. B	B7N6Y1	Sulfate adenylyltransferase subunit 1	1.55e-06	NA	2.03e-10	NA
7. B	P17889	Translation initiation factor IF-2	4.95e-05	NA	1.34e-15	NA
7. B	Q5LES3	Sulfate adenylyltransferase subunit 1	3.18e-04	NA	1.95e-07	NA
7. B	Q8ZMF5	Sulfate adenylyltransferase subunit 1	1.22e-06	NA	3.39e-10	NA
7. B	P26184	Elongation factor Tu	1.76e-07	NA	2.62e-14	NA
7. B	A0Q534	GTPase Der	1.27e-02	NA	1.77e-04	NA
7. B	C5CLW3	Translation initiation factor IF-2	6.55e-04	NA	1.32e-19	NA
7. B	Q4ZNR2	Translation initiation factor IF-2	3.98e-04	NA	1.31e-19	NA
7. B	A0M5P1	GTPase Der	2.67e-03	NA	0.049	NA
7. B	A8G708	Elongation factor Tu	9.77e-07	NA	1.33e-17	NA
7. B	B0JSE0	Elongation factor Tu	1.04e-06	NA	2.62e-12	NA
7. B	A6WQP3	GTPase Der	1.13e-02	NA	1.26e-04	NA
7. B	P0A3K7	Translation initiation factor IF-2	6.99e-04	NA	2.15e-13	NA
7. B	Q5L890	Elongation factor Tu	1.53e-07	NA	6.79e-19	NA
7. B	Q2JFH8	Elongation factor Tu	1.77e-07	NA	3.71e-12	NA
7. B	B0U1Q8	Translation initiation factor IF-2	4.84e-04	NA	4.03e-13	NA
7. B	Q0HXR5	Translation initiation factor IF-2	2.13e-04	NA	1.10e-18	NA
7. B	A0KNE3	Translation initiation factor IF-2	5.25e-04	NA	6.02e-18	NA
7. B	A7HBL7	Elongation factor Tu	1.90e-07	NA	4.36e-17	NA
7. B	Q33451	Elongation factor Tu, apicoplast	2.89e-07	NA	1.13e-12	NA
7. B	O96719	Eukaryotic translation initiation factor 2 subunit gamma	1.23e-07	NA	2.53e-06	NA
7. B	A7MQE1	Translation initiation factor IF-2	2.68e-04	NA	6.43e-15	NA
7. B	P14634	Elongation factor Tu, plastid	1.07e-06	NA	3.65e-11	NA
7. B	Q895J8	Translation initiation factor IF-2	1.66e-04	NA	1.68e-11	NA
7. B	P0A705	Translation initiation factor IF-2	4.76e-04	NA	2.11e-13	NA
7. B	Q62GK3	Elongation factor Tu	1.63e-07	NA	1.18e-16	NA
7. B	A2RM37	Translation initiation factor IF-2	8.06e-04	NA	7.20e-15	NA
7. B	B5FGJ9	Sulfate adenylyltransferase subunit 1	2.50e-06	NA	3.09e-09	NA
7. B	A0PXT1	Elongation factor Tu	1.98e-07	NA	1.63e-17	NA
7. B	B5F6T8	Translation initiation factor IF-2	5.04e-04	NA	3.79e-13	NA
7. B	P13552	Elongation factor Tu	1.51e-06	NA	2.40e-13	NA
7. B	A9KWW9	GTPase Der	2.01e-02	NA	1.26e-04	NA
7. B	A1RRJ3	Elongation factor 1-alpha	3.27e-06	NA	4.68e-13	NA
7. B	Q12SW1	Elongation factor Tu	2.44e-07	NA	1.15e-15	NA
7. B	A4FWW9	Translation initiation factor 2 subunit gamma	3.68e-08	NA	1.60e-09	NA
7. B	A4SRG8	Sulfate adenylyltransferase subunit 1	2.27e-06	NA	8.71e-10	NA
7. B	Q47JA5	Elongation factor Tu	1.97e-07	NA	1.81e-11	NA
7. B	B0TLI8	GTPase Der	1.75e-02	NA	0.001	NA
7. B	A4WVL0	Elongation factor Tu	7.43e-08	NA	1.37e-16	NA
7. B	A7H9F3	Translation initiation factor IF-2	3.45e-04	NA	1.96e-10	NA
7. B	O33581	Sulfate adenylyltransferase subunit 1	5.82e-06	NA	1.04e-09	NA
7. B	A6W5T5	Elongation factor Tu	1.73e-07	NA	4.99e-13	NA
7. B	A9KW88	Elongation factor Tu 1	2.43e-07	NA	2.91e-13	NA
7. B	A3MRT8	Elongation factor Tu	1.70e-07	NA	1.18e-16	NA
7. B	B4RMZ3	Translation initiation factor IF-2	5.30e-04	NA	8.91e-17	NA
7. B	Q7U4D1	Elongation factor Tu	1.04e-06	NA	1.16e-18	NA
7. B	B7L0X9	Sulfate adenylyltransferase subunit 1	2.77e-06	NA	1.18e-08	NA
7. B	Q21C31	Translation initiation factor IF-2	1.23e-04	NA	1.90e-11	NA
7. B	A0M3Z6	Elongation factor Tu	2.60e-07	NA	1.71e-12	NA
7. B	Q9JTB5	Translation initiation factor IF-2	6.28e-04	NA	8.24e-16	NA
7. B	O27132	Elongation factor 1-alpha	1.68e-06	NA	1.19e-13	NA
7. B	Q0AF46	Elongation factor Tu 2	1.95e-07	NA	1.83e-13	NA
7. B	A4XL70	Translation initiation factor IF-2	1.34e-04	NA	2.13e-16	NA
7. B	Q1BDD3	Elongation factor Tu	2.03e-07	NA	1.18e-14	NA
7. B	A1V3N4	Translation initiation factor IF-2	5.74e-04	NA	1.58e-17	NA
7. B	A5V604	Elongation factor Tu	1.62e-07	NA	3.29e-15	NA
7. B	A1AX82	Elongation factor Tu 2	1.83e-07	NA	1.38e-14	NA
7. B	A5GW14	Elongation factor Tu	1.11e-06	NA	2.43e-17	NA
7. B	B8HD11	Elongation factor Tu	1.89e-07	NA	1.13e-18	NA
7. B	B0SUQ7	Elongation factor Tu 1	1.51e-07	NA	1.37e-13	NA
7. B	Q8Z3H7	Translation initiation factor IF-2	5.05e-04	NA	3.89e-13	NA
7. B	Q1JMR3	Elongation factor Tu	2.00e-07	NA	8.56e-12	NA
7. B	B2SVK3	Translation initiation factor IF-2	2.53e-04	NA	3.40e-12	NA
7. B	Q2HJN9	Elongation factor 1-alpha 4	3.64e-06	NA	2.94e-07	NA
7. B	Q1QS64	Translation initiation factor IF-2	1.22e-04	NA	3.07e-13	NA
7. B	Q3YS01	Translation initiation factor IF-2	7.22e-05	NA	9.20e-12	NA
7. B	Q8D240	Elongation factor Tu	1.73e-07	NA	3.08e-12	NA
7. B	B4SQS0	Translation initiation factor IF-2	2.01e-04	NA	6.59e-16	NA
7. B	A5EX84	Elongation factor Tu	2.46e-07	NA	8.89e-15	NA
7. B	Q11BC8	Translation initiation factor IF-2	1.38e-04	NA	4.26e-13	NA
7. B	A2S2L1	Translation initiation factor IF-2	5.72e-04	NA	1.58e-17	NA
7. B	P72689	Translation initiation factor IF-2	3.57e-04	NA	5.09e-18	NA
7. B	Q8Y7F6	Translation initiation factor IF-2	3.69e-04	NA	7.89e-18	NA
7. B	A3NEI1	Elongation factor Tu	1.66e-07	NA	1.18e-16	NA
7. B	A4QBH0	Elongation factor Tu	1.62e-07	NA	3.14e-12	NA
7. B	A4SNZ8	GTPase Der	5.46e-03	NA	0.002	NA
7. B	A9HF18	Translation initiation factor IF-2	2.28e-04	NA	4.59e-10	NA
7. B	Q20EU5	Elongation factor Tu, chloroplastic	7.26e-07	NA	3.04e-12	NA
7. B	C5BPV9	Translation initiation factor IF-2	5.15e-04	NA	7.88e-15	NA
7. B	Q7MYY7	Translation initiation factor IF-2	5.43e-04	NA	3.93e-13	NA
7. B	A3MZC1	GTPase Der	1.37e-02	NA	0.001	NA
7. B	B8CKH3	Translation initiation factor IF-2	5.55e-04	NA	1.15e-14	NA
7. B	Q5XD49	Elongation factor Tu	2.05e-07	NA	8.56e-12	NA
7. B	P42481	Elongation factor Tu	1.66e-07	NA	2.26e-17	NA
7. B	Q8AAP9	Sulfate adenylyltransferase subunit 1	5.86e-04	NA	9.32e-07	NA
7. B	B0T2B5	Elongation factor Tu 2	1.56e-07	NA	2.17e-13	NA
7. B	B0B7N8	Elongation factor Tu	2.16e-07	NA	1.71e-16	NA
7. B	P49411	Elongation factor Tu, mitochondrial	5.43e-07	NA	2.62e-13	NA
7. B	A7ZUJ2	Elongation factor Tu 2	2.19e-07	NA	2.89e-12	NA
7. B	Q9W074	Protein HBS1	3.96e-05	NA	2.34e-11	NA
7. B	B0R6Y7	Translation initiation factor 2 subunit gamma	8.16e-08	NA	2.12e-06	NA
7. B	B1YP36	Translation initiation factor IF-2	5.71e-04	NA	1.75e-18	NA
7. B	B1XI63	Elongation factor Tu	1.09e-06	NA	1.57e-09	NA
7. B	Q89WA9	Translation initiation factor IF-2	1.48e-04	NA	6.87e-13	NA
7. B	Q72NX3	Translation initiation factor IF-2	2.07e-04	NA	6.25e-13	NA
7. B	A1AV99	Translation initiation factor IF-2	1.79e-04	NA	2.28e-13	NA
7. B	Q14GT5	GTPase Der	7.32e-03	NA	1.10e-04	NA
7. B	Q73H85	Elongation factor Tu 2	5.85e-08	NA	1.29e-13	NA
7. B	Q254H4	Translation initiation factor IF-2	2.32e-04	NA	6.36e-11	NA
7. B	Q57AA0	Translation initiation factor IF-2	2.75e-04	NA	2.02e-13	NA
7. B	A3MJW4	Translation initiation factor IF-2	5.73e-04	NA	1.58e-17	NA
7. B	Q5X1C3	Translation initiation factor IF-2	2.74e-04	NA	9.81e-16	NA
7. B	Q9ZCZ8	Translation initiation factor IF-2	2.63e-04	NA	3.35e-13	NA
7. B	Q47UU9	Elongation factor Tu	2.22e-07	NA	4.53e-15	NA
7. B	Q7N9B1	Elongation factor Tu 1	1.82e-07	NA	2.69e-13	NA
7. B	B5QW22	Sulfate adenylyltransferase subunit 1	2.62e-06	NA	3.13e-10	NA
7. B	A3D6V5	GTPase Der	6.28e-03	NA	1.27e-04	NA
7. B	A5UHC1	Elongation factor Tu	2.16e-07	NA	5.36e-13	NA
7. B	Q73NP6	Translation initiation factor IF-2	1.94e-04	NA	2.25e-12	NA
7. B	Q2K9L8	Elongation factor Tu 2	4.75e-07	NA	7.45e-13	NA
7. B	C9WPN6	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	7.10e-10	NA	0.001	NA
7. B	A9R5A3	Translation initiation factor IF-2	4.91e-04	NA	1.63e-12	NA
7. B	Q99QM0	Elongation factor Tu	1.46e-07	NA	7.56e-13	NA
7. B	Q1MN39	Translation initiation factor IF-2	2.37e-04	NA	2.36e-14	NA
7. B	A8AD75	GTPase Der	1.16e-02	NA	1.19e-04	NA
7. B	B9MQH1	Elongation factor Tu	2.04e-07	NA	7.70e-17	NA
7. B	B1J2A9	Translation initiation factor IF-2	3.91e-04	NA	6.29e-18	NA
7. B	P46198	Translation initiation factor IF-2, mitochondrial	2.72e-05	NA	4.21e-14	NA
7. B	A3M1F6	Elongation factor Tu	1.58e-07	NA	1.00e-13	NA
7. B	O50293	Elongation factor Tu	1.52e-07	NA	7.85e-16	NA
7. B	A8F2E9	Elongation factor Tu	1.73e-07	NA	2.01e-17	NA
7. B	A1V8A5	Elongation factor Tu	1.74e-07	NA	1.18e-16	NA
7. B	B3PXE3	Translation initiation factor IF-2	2.30e-04	NA	1.80e-13	NA
7. B	P72231	Elongation factor Tu	1.80e-07	NA	3.02e-11	NA
7. B	A7MKI5	Elongation factor Tu	2.16e-07	NA	3.55e-12	NA
7. B	Q54HB2	Elongation factor Tu, mitochondrial	3.05e-07	NA	4.05e-16	NA
7. B	B2TZI0	Sulfate adenylyltransferase subunit 1	1.74e-06	NA	2.11e-10	NA
7. B	A7NR65	Elongation factor Tu 1	3.03e-07	NA	4.74e-14	NA
7. B	Q981F7	Elongation factor Tu	5.92e-08	NA	1.34e-12	NA
7. B	A8FT74	GTPase Der	2.23e-02	NA	5.79e-05	NA
7. B	P50373	Elongation factor Tu, chloroplastic	1.12e-06	NA	5.14e-10	NA
7. B	Q1CEL3	Translation initiation factor IF-2	5.36e-04	NA	1.65e-12	NA
7. B	A0T100	Elongation factor Tu, chloroplastic	2.41e-07	NA	1.27e-10	NA
7. B	Q15VB8	Sulfate adenylyltransferase subunit 1	3.71e-06	NA	2.50e-09	NA
7. B	Q72NF9	Elongation factor Tu	2.95e-07	NA	1.42e-10	NA
7. B	A5IHU7	Translation initiation factor IF-2	2.63e-04	NA	1.20e-15	NA
7. B	Q5P334	Elongation factor Tu	1.73e-07	NA	2.67e-12	NA
7. B	Q2JMD7	Translation initiation factor IF-2	6.96e-04	NA	1.17e-16	NA
7. B	A7GZZ3	Translation initiation factor IF-2	1.69e-04	NA	4.36e-14	NA
7. B	P19457	Elongation factor Tu, chloroplastic	1.38e-06	NA	3.58e-14	NA
7. B	Q6FF97	Elongation factor Tu	1.73e-07	NA	1.69e-12	NA
7. B	B9E8Q0	Elongation factor Tu	1.48e-07	NA	1.65e-13	NA
7. B	C5BQ44	Elongation factor Tu	2.41e-07	NA	1.47e-17	NA
7. B	Q3SKX1	Translation initiation factor IF-2	4.09e-04	NA	6.05e-17	NA
7. B	B7LWK4	Sulfate adenylyltransferase subunit 1	1.92e-06	NA	4.32e-10	NA
7. B	Q3K1U4	Elongation factor Tu	2.32e-07	NA	7.35e-12	NA
7. B	C3L7B4	Translation initiation factor IF-2	4.26e-06	NA	6.03e-15	NA
7. B	Q0P3M7	Elongation factor Tu, chloroplastic	7.07e-08	NA	1.67e-08	NA
7. B	Q5HP70	GTPase Der	4.90e-03	NA	0.006	NA
7. B	Q9ZM46	Translation initiation factor IF-2	7.38e-04	NA	2.80e-15	NA
7. B	Q7V5M4	Translation initiation factor IF-2	1.43e-03	NA	6.34e-14	NA
7. B	A6VGE8	Translation initiation factor 2 subunit gamma	4.27e-08	NA	1.61e-09	NA
7. B	Q0SFF4	Elongation factor Tu	1.93e-07	NA	1.23e-13	NA
7. B	Q9Z9A7	Elongation factor Tu	2.07e-07	NA	1.23e-16	NA
7. B	A5GIP0	Elongation factor Tu	1.01e-06	NA	8.96e-19	NA
7. B	B5Z8K3	Elongation factor Tu	2.32e-07	NA	8.37e-17	NA
7. B	C6DKK3	Translation initiation factor IF-2	5.02e-04	NA	7.00e-14	NA
7. B	Q2KHZ2	HBS1-like protein	4.67e-05	NA	1.81e-12	NA
7. B	Q02WY9	Elongation factor Tu	2.98e-07	NA	8.04e-16	NA
7. B	Q6LM69	Sulfate adenylyltransferase subunit 1	2.28e-06	NA	3.40e-11	NA
7. B	Q14JU2	Elongation factor Tu	1.79e-07	NA	7.63e-14	NA
7. B	Q6LXY6	Translation initiation factor 2 subunit gamma	2.37e-08	NA	3.78e-10	NA
7. B	Q2NS44	GTPase Der	1.37e-02	NA	6.22e-04	NA
7. B	Q0BKB8	Elongation factor Tu	1.68e-07	NA	4.86e-14	NA
7. B	A9WFP3	Elongation factor Tu	1.48e-06	NA	1.23e-15	NA
7. B	Q4A7E2	Translation initiation factor IF-2	1.29e-05	NA	4.94e-13	NA
7. B	C4LAG3	Sulfate adenylyltransferase subunit 1	1.98e-06	NA	5.30e-10	NA
7. B	A4SJR5	Translation initiation factor IF-2	6.22e-04	NA	3.95e-17	NA
7. B	A5EWY9	Translation initiation factor IF-2	2.43e-05	NA	1.01e-15	NA
7. B	P33166	Elongation factor Tu	1.45e-07	NA	3.73e-14	NA
7. B	Q48RU8	Translation initiation factor IF-2	4.68e-04	NA	2.88e-12	NA
7. B	Q87WQ5	Translation initiation factor IF-2	3.83e-04	NA	1.43e-19	NA
7. B	B1IPW0	Elongation factor Tu 1	3.20e-07	NA	3.13e-12	NA
7. B	A9KWA0	Elongation factor Tu 2	2.58e-07	NA	2.39e-13	NA
7. B	A5U9R1	Elongation factor Tu	2.13e-07	NA	5.36e-13	NA
7. B	Q15V72	Translation initiation factor IF-2	3.68e-04	NA	9.29e-15	NA
7. B	B4TTW5	Sulfate adenylyltransferase subunit 1	2.22e-06	NA	3.63e-10	NA
7. B	B0RU96	Elongation factor Tu 2	2.07e-07	NA	2.74e-14	NA
7. B	C1CF71	Elongation factor Tu	2.68e-07	NA	3.06e-12	NA
7. B	B4U3U1	Elongation factor Tu	2.79e-07	NA	1.01e-11	NA
7. B	Q09130	Eukaryotic translation initiation factor 2 subunit gamma	4.19e-08	NA	4.71e-05	NA
7. B	Q04FQ4	Elongation factor Tu	2.22e-07	NA	5.90e-16	NA
7. B	P57873	Translation initiation factor IF-2	3.47e-04	NA	9.62e-15	NA
7. B	Q64ZR4	Translation initiation factor IF-2	3.56e-04	NA	2.03e-11	NA
7. B	A5DN78	Elongation factor Tu, mitochondrial	3.86e-07	NA	1.83e-16	NA
7. B	A6QGG8	Translation initiation factor IF-2	1.11e-04	NA	1.45e-14	NA
7. B	A7MJ69	Sulfate adenylyltransferase subunit 1	1.93e-06	NA	4.46e-11	NA
7. B	Q8FEJ1	Sulfate adenylyltransferase subunit 1	3.30e-06	NA	2.22e-10	NA
7. B	B8GP02	Translation initiation factor IF-2	1.11e-04	NA	5.46e-17	NA
7. B	P86934	Elongation factor 1-alpha 1	3.36e-07	NA	8.56e-12	NA
7. B	A1B002	Elongation factor Tu	7.28e-08	NA	9.30e-17	NA
7. B	Q7VJ74	Elongation factor Tu	1.73e-07	NA	7.31e-15	NA
7. B	Q8ZAN8	Elongation factor Tu-B	2.01e-07	NA	2.46e-12	NA
7. B	Q47D94	Translation initiation factor IF-2	3.98e-04	NA	5.87e-17	NA
7. B	P42477	Elongation factor Tu	2.30e-07	NA	1.36e-18	NA
7. B	Q1LSK8	Translation initiation factor IF-2	4.67e-04	NA	2.76e-13	NA
7. B	P64024	Elongation factor Tu	7.18e-08	NA	1.07e-13	NA
7. B	A4TS36	Elongation factor Tu 2	2.09e-07	NA	2.46e-12	NA
7. B	Q8XGZ0	Elongation factor Tu	1.68e-07	NA	1.49e-16	NA
7. B	A6X0A2	Elongation factor Tu	5.83e-08	NA	2.72e-14	NA
7. B	Q5PAJ5	Translation initiation factor IF-2	9.39e-05	NA	3.18e-13	NA
7. B	A4Y8T6	GTPase Der	8.50e-03	NA	7.91e-05	NA
7. B	P18311	Translation initiation factor IF-2	2.84e-04	NA	3.58e-14	NA
7. B	Q8KTA3	Elongation factor Tu	2.11e-07	NA	2.89e-16	NA
7. B	Q2SU25	Elongation factor Tu	1.68e-07	NA	1.18e-16	NA
7. B	Q7WHG2	Translation initiation factor IF-2	7.81e-05	NA	2.18e-18	NA
7. B	A5CW32	Elongation factor Tu	2.08e-07	NA	3.40e-13	NA
7. B	B4SCE7	Translation initiation factor IF-2	2.28e-04	NA	1.44e-11	NA
7. B	O29325	Elongation factor 1-alpha	1.52e-06	NA	5.04e-18	NA
7. B	A6TWI4	Elongation factor Tu 1	2.88e-07	NA	5.09e-08	NA
7. B	P14963	Elongation factor 1-alpha	8.14e-06	NA	3.26e-11	NA
7. B	Q8E0H1	Elongation factor Tu	2.31e-07	NA	6.85e-12	NA
7. B	B0BB83	Translation initiation factor IF-2	2.35e-04	NA	7.29e-12	NA
7. B	Q9PIZ1	Translation initiation factor IF-2	2.55e-04	NA	7.13e-12	NA
7. B	B5Z0Y0	GTPase Der	4.48e-03	NA	1.06e-04	NA
7. B	Q1R0H7	Elongation factor Tu	2.06e-07	NA	8.18e-15	NA
7. B	A6U842	Elongation factor Tu	6.03e-08	NA	9.53e-14	NA
7. B	B1XCS7	Sulfate adenylyltransferase subunit 1	7.09e-06	NA	2.13e-10	NA
7. B	Q5LMR5	Elongation factor Tu	8.00e-08	NA	7.65e-16	NA
7. B	Q7N702	GTPase Der	6.51e-03	NA	1.75e-04	NA
7. B	Q8R7T8	Elongation factor Tu-B	1.85e-07	NA	2.97e-13	NA
7. B	P84315	Elongation factor 1-alpha (Fragment)	2.23e-06	NA	1.25e-06	NA
7. B	Q5HAY9	GTPase Era	1.87e-03	NA	0.040	NA
7. B	P58002	Translation initiation factor IF-2	2.57e-04	NA	2.03e-14	NA
7. B	Q8Z470	Sulfate adenylyltransferase subunit 1	1.30e-06	NA	3.86e-10	NA
7. B	Q5NG10	Sulfate adenylyltransferase subunit 1	3.12e-05	NA	1.83e-08	NA
7. B	Q5GSU2	Elongation factor Tu 1	7.10e-08	NA	6.88e-14	NA
7. B	B1I462	GTPase Der	1.09e-02	NA	0.003	NA
7. B	C0PXB1	Sulfate adenylyltransferase subunit 1	1.95e-06	NA	3.16e-10	NA
7. B	P57966	Elongation factor Tu-B	2.11e-07	NA	2.69e-13	NA
7. B	B8D851	Elongation factor Tu	2.05e-07	NA	1.24e-10	NA
7. B	Q46IW4	Elongation factor Tu	1.00e-06	NA	1.95e-18	NA
7. B	Q979T1	Elongation factor 1-alpha	3.58e-06	NA	3.87e-16	NA
7. B	Q2N9A8	Elongation factor Tu	1.61e-07	NA	2.23e-14	NA
7. B	B3QY22	Elongation factor Tu	1.85e-07	NA	3.77e-20	NA
7. B	B9DPF5	Translation initiation factor IF-2	1.12e-04	NA	6.36e-17	NA
7. B	C1EP35	Translation initiation factor IF-2	3.60e-06	NA	2.93e-15	NA
7. B	A1W8Z4	Translation initiation factor IF-2	5.19e-04	NA	2.94e-15	NA
7. B	A6QB12	Sulfate adenylyltransferase subunit 1	9.82e-06	NA	6.63e-07	NA
7. B	O42820	Elongation factor 1-alpha	8.89e-06	NA	4.07e-09	NA
7. B	P34825	Elongation factor 1-alpha	3.68e-06	NA	1.40e-09	NA
7. B	A4SY78	Translation initiation factor IF-2	4.55e-04	NA	3.04e-17	NA
7. B	Q57H76	Elongation factor Tu	2.19e-07	NA	2.37e-12	NA
7. B	Q9PGR3	Translation initiation factor IF-2	2.01e-04	NA	3.76e-13	NA
7. B	Q5E7L5	Translation initiation factor IF-2	5.03e-04	NA	1.07e-12	NA
7. B	B1ZPC5	Elongation factor Tu	3.35e-06	NA	1.10e-12	NA
7. B	A3PNL2	Translation initiation factor IF-2	8.90e-05	NA	4.10e-13	NA
7. B	Q04GN0	Translation initiation factor IF-2	2.21e-04	NA	1.75e-18	NA
7. B	Q9ZF25	Translation initiation factor IF-2	2.49e-04	NA	1.27e-17	NA
7. B	Q3KM40	Elongation factor Tu	2.22e-07	NA	2.48e-16	NA
7. B	A1AG73	Translation initiation factor IF-2	4.92e-04	NA	2.11e-13	NA
7. B	B5XKI1	Elongation factor Tu	2.04e-07	NA	1.36e-12	NA
7. B	P95724	Elongation factor Tu	1.54e-07	NA	3.42e-16	NA
7. B	C1C881	Elongation factor Tu	2.35e-07	NA	3.06e-12	NA
7. B	B7M076	Translation initiation factor IF-2	2.46e-04	NA	2.11e-13	NA
7. B	Q0HKV5	GTPase Der	9.83e-03	NA	1.09e-04	NA
7. B	A9KNW4	Translation initiation factor IF-2	8.17e-04	NA	3.36e-17	NA
7. B	Q8KT99	Elongation factor Tu	1.85e-07	NA	9.98e-17	NA
7. B	Q0AUH8	Elongation factor Tu 1	1.94e-07	NA	1.47e-14	NA
7. B	Q0I7K2	Translation initiation factor IF-2	1.15e-03	NA	7.34e-16	NA
7. B	Q8FXT2	Translation initiation factor IF-2	4.84e-05	NA	2.15e-13	NA
7. B	Q3Z7S9	Elongation factor Tu	1.66e-07	NA	7.53e-13	NA
7. B	A8H740	Translation initiation factor IF-2	5.44e-04	NA	2.81e-15	NA
7. B	Q5NFD2	GTPase Der	1.39e-02	NA	1.10e-04	NA
7. B	Q0BJ48	Elongation factor Tu	1.73e-07	NA	6.70e-16	NA
7. B	A0RHI4	Translation initiation factor IF-2	2.86e-06	NA	2.93e-15	NA
7. B	P0A706	Translation initiation factor IF-2	2.48e-04	NA	2.11e-13	NA
7. B	Q0SQC8	Elongation factor Tu	1.88e-07	NA	9.39e-14	NA
7. B	A2SLF9	Elongation factor Tu	1.78e-07	NA	1.21e-14	NA
7. B	B5REN6	Translation initiation factor IF-2	5.27e-04	NA	3.48e-13	NA
7. B	Q7URR0	Translation initiation factor IF-2	4.57e-04	NA	1.74e-07	NA
7. B	B0VLU2	Translation initiation factor IF-2	2.12e-04	NA	2.59e-14	NA
7. B	A7ZQJ5	Sulfate adenylyltransferase subunit 1	2.23e-06	NA	2.07e-10	NA
7. B	Q1H4Q1	Elongation factor Tu 1	1.77e-07	NA	8.70e-17	NA
7. B	Q8EK81	Elongation factor Tu 1	2.11e-07	NA	1.17e-15	NA
7. B	B4RYQ8	Elongation factor Tu	2.47e-07	NA	8.10e-13	NA
7. B	A2C4P1	Translation initiation factor IF-2	2.68e-03	NA	7.68e-14	NA
7. B	O50340	Elongation factor Tu	2.30e-07	NA	2.13e-13	NA
7. B	A8ZU05	GTPase Der	4.33e-03	NA	0.004	NA
7. B	Q8DVP9	Translation initiation factor IF-2	3.64e-04	NA	2.05e-13	NA
7. B	C5BES7	GTPase Der	7.06e-03	NA	5.30e-05	NA
7. B	Q1R5Y2	Elongation factor Tu 1	3.39e-07	NA	3.13e-12	NA
7. B	Q3IMM5	Translation initiation factor 2 subunit gamma	7.40e-08	NA	3.38e-09	NA
7. B	Q6MD64	Translation initiation factor IF-2	2.52e-04	NA	8.59e-08	NA
7. B	A4SUU7	Elongation factor Tu	1.58e-07	NA	4.77e-17	NA
7. B	Q8E1H3	Translation initiation factor IF-2	7.08e-04	NA	2.49e-13	NA
7. B	P9WNN1	Elongation factor Tu	2.16e-07	NA	1.57e-13	NA
7. B	Q99YG1	Translation initiation factor IF-2	8.08e-04	NA	2.88e-12	NA
7. B	Q9Z9L6	Elongation factor Tu	2.12e-07	NA	7.45e-14	NA
7. B	Q74JL6	GTPase Der	6.75e-03	NA	8.57e-05	NA
7. B	A4TGY7	Elongation factor Tu 1	2.23e-07	NA	2.23e-12	NA
7. B	B5Z6E6	Translation initiation factor IF-2	5.15e-04	NA	4.88e-15	NA
7. B	Q1JHV6	Elongation factor Tu	2.08e-07	NA	8.56e-12	NA
7. B	O31301	Elongation factor Tu (Fragment)	1.42e-08	NA	7.35e-10	NA
7. B	P0CT55	Elongation factor 1-alpha-B/C	4.75e-06	NA	6.57e-08	NA
7. B	Q140U6	Translation initiation factor IF-2	6.53e-04	NA	8.91e-17	NA
7. B	Q160Y4	Elongation factor Tu	7.12e-08	NA	1.46e-15	NA
7. B	C0Q9Y7	Elongation factor Tu	2.02e-07	NA	3.49e-10	NA
7. B	Q085U2	GTPase Der	1.47e-02	NA	7.08e-04	NA
7. B	Q02T82	Elongation factor Tu	1.82e-07	NA	3.95e-13	NA
7. B	A9WPV8	Translation initiation factor IF-2	5.75e-04	NA	1.21e-11	NA
7. B	A7FNN8	Elongation factor Tu 2	2.07e-07	NA	2.23e-12	NA
7. B	A1B587	Translation initiation factor IF-2	9.28e-05	NA	5.62e-12	NA
7. B	C4LC41	GTPase Der	8.74e-03	NA	1.31e-05	NA
7. B	Q1DAM6	Translation initiation factor IF-2	4.79e-04	NA	4.39e-11	NA
7. B	B1XV89	Translation initiation factor IF-2	4.54e-04	NA	1.86e-17	NA
7. B	C5CGR6	Elongation factor Tu	3.07e-07	NA	1.99e-14	NA
7. B	A9MHG0	Elongation factor Tu	2.05e-07	NA	2.37e-12	NA
7. B	Q57770	Elongation factor 1-alpha	2.13e-06	NA	4.98e-16	NA
7. B	Q3IJ53	Translation initiation factor IF-2	5.55e-04	NA	5.08e-14	NA
7. B	Q8UH69	Sulfate adenylyltransferase subunit 1	4.27e-06	NA	6.32e-09	NA
7. B	A5CUB6	Elongation factor Tu	1.80e-07	NA	6.21e-14	NA
7. B	Q5R4B3	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	4.97e-06	NA	3.74e-10	NA
7. B	A6UTL4	Translation initiation factor 2 subunit gamma	3.16e-08	NA	4.30e-09	NA
7. B	P9WNM5	Bifunctional enzyme CysN/CysC	5.51e-04	NA	6.30e-06	NA
7. B	Q3K5X4	Elongation factor Tu	2.65e-07	NA	1.17e-13	NA
7. B	A5D5I8	Elongation factor Tu 2	2.28e-07	NA	1.75e-17	NA
7. B	Q85FT7	Elongation factor Tu, chloroplastic	1.07e-06	NA	1.80e-13	NA
7. B	Q6N4Q4	Elongation factor Tu	1.75e-07	NA	1.41e-14	NA
7. B	B7VJU2	GTPase Der	1.78e-02	NA	3.62e-05	NA
7. B	P57812	GTPase Der	4.18e-03	NA	0.005	NA
7. B	B2T381	Translation initiation factor IF-2	6.34e-04	NA	2.57e-17	NA
7. B	P42473	Elongation factor Tu	1.66e-07	NA	1.74e-15	NA
7. B	B7HLE6	Translation initiation factor IF-2	3.54e-06	NA	2.18e-15	NA
7. B	A5I4V0	GTPase Der	6.65e-03	NA	2.89e-04	NA
7. B	Q9ZT91	Elongation factor Tu, mitochondrial	3.70e-07	NA	1.93e-11	NA
7. B	Q3JCW1	GTPase Der	8.68e-03	NA	0.003	NA
7. B	Q8NL22	Elongation factor Tu	2.08e-07	NA	2.31e-14	NA
7. B	A0KRL0	Elongation factor Tu	2.07e-07	NA	3.88e-17	NA
7. B	A7NID1	Translation initiation factor IF-2	5.61e-05	NA	3.80e-15	NA
7. B	Q9HLA7	Translation initiation factor 2 subunit gamma	4.27e-08	NA	2.42e-10	NA
7. B	Q823F2	Translation initiation factor IF-2	2.34e-04	NA	3.48e-12	NA
7. B	P86939	Elongation factor 1-alpha 2	4.44e-06	NA	8.56e-12	NA
7. B	C3LJ80	Elongation factor Tu	1.57e-07	NA	9.92e-13	NA
7. B	P33165	Elongation factor Tu	1.53e-07	NA	6.79e-19	NA
7. B	Q8I335	Translation factor GUF1 homolog, mitochondrial	0.00e+00	NA	1.11e-66	NA
7. B	A7FLY2	Sulfate adenylyltransferase subunit 1	1.58e-06	NA	1.54e-09	NA
7. B	Q2VZV0	Translation initiation factor IF-2	1.08e-04	NA	3.82e-14	NA
7. B	A8FYS0	Translation initiation factor IF-2	5.30e-04	NA	7.29e-15	NA
7. B	A2BT70	Translation initiation factor IF-2	6.78e-04	NA	3.21e-14	NA
7. B	Q9Y700	Elongation factor Tu, mitochondrial	2.85e-07	NA	6.83e-19	NA
7. B	A4G7S7	Translation initiation factor IF-2	4.83e-04	NA	6.27e-18	NA
7. B	B2I726	Translation initiation factor IF-2	4.91e-04	NA	3.83e-13	NA
7. B	B1IWF0	GTPase Der	8.58e-03	NA	1.06e-04	NA
7. B	P52978	Bifunctional enzyme NodQ	1.61e-04	NA	1.10e-10	NA
7. B	A6L030	Translation initiation factor IF-2	3.44e-04	NA	1.78e-12	NA
7. B	Q3YYB1	Sulfate adenylyltransferase subunit 1	1.87e-06	NA	2.13e-10	NA
7. B	O93729	Elongation factor 1-alpha	2.81e-06	NA	1.07e-13	NA
7. B	Q9ZF31	Translation initiation factor IF-2	5.01e-04	NA	3.79e-13	NA
7. B	A5FIJ9	Elongation factor Tu	2.08e-07	NA	5.93e-15	NA
7. B	Q5NQ65	Elongation factor Tu	1.69e-07	NA	1.88e-15	NA
7. B	Q123F6	Elongation factor Tu	1.79e-07	NA	7.63e-15	NA
7. B	Q21M86	Elongation factor Tu	2.74e-07	NA	3.90e-15	NA
7. B	B7H115	Translation initiation factor IF-2	2.10e-04	NA	2.19e-14	NA
7. B	Q0I0B9	Elongation factor Tu 1	2.06e-07	NA	1.87e-17	NA
7. B	Q1D776	Elongation factor Tu 2	1.89e-07	NA	3.32e-15	NA
7. B	Q1IHG6	Elongation factor Tu	1.49e-07	NA	3.11e-17	NA
7. B	B0RRB4	Translation initiation factor IF-2	2.60e-04	NA	4.13e-12	NA
7. B	A7Z4T4	Translation initiation factor IF-2	4.97e-05	NA	2.36e-15	NA
7. B	Q08046	Elongation factor 1-alpha (Fragment)	3.83e-06	NA	1.41e-07	NA
7. B	A2RMT1	Elongation factor Tu	3.02e-07	NA	8.04e-16	NA
7. B	Q58657	Translation initiation factor 2 subunit gamma	9.68e-09	NA	4.05e-08	NA
7. B	B7JUP5	Elongation factor Tu	1.21e-06	NA	6.70e-14	NA
7. B	A1RXW9	Elongation factor 1-alpha	4.59e-06	NA	3.86e-20	NA
7. B	Q38W81	Translation initiation factor IF-2	4.29e-04	NA	1.96e-16	NA
7. B	B1WQY4	Elongation factor Tu	1.16e-06	NA	2.78e-13	NA
7. B	B8JFY6	Translation initiation factor IF-2	3.00e-04	NA	5.79e-10	NA
7. B	Q927I6	Elongation factor Tu	2.45e-07	NA	7.04e-15	NA
7. B	A7MZE5	GTPase Der	1.14e-02	NA	1.28e-04	NA
7. B	A7GJ76	Elongation factor Tu	2.39e-07	NA	7.05e-17	NA
7. B	B1Z7C0	Sulfate adenylyltransferase subunit 1	2.36e-06	NA	9.64e-09	NA
7. B	A9ISD9	Elongation factor Tu	6.22e-08	NA	2.74e-16	NA
7. B	Q0HNV1	Elongation factor Tu 1	1.94e-07	NA	1.87e-17	NA
7. B	P0CT54	Elongation factor 1-alpha-B	3.51e-06	NA	6.57e-08	NA
7. B	Q18EY5	Elongation factor 1-alpha	2.46e-06	NA	1.54e-21	NA
7. B	A1USC1	Elongation factor Tu 1	5.90e-08	NA	2.28e-13	NA
7. B	A4IW10	Translation initiation factor IF-2	2.85e-04	NA	3.04e-13	NA
7. B	Q318N5	Elongation factor Tu	9.87e-07	NA	2.01e-17	NA
7. B	B7KIU2	Translation initiation factor IF-2	1.17e-03	NA	3.85e-14	NA
7. B	A6GWV8	Translation initiation factor IF-2	9.57e-05	NA	1.98e-14	NA
7. B	B9JB95	Sulfate adenylyltransferase subunit 1	7.90e-06	NA	6.64e-10	NA
7. B	Q3SSW8	Elongation factor Tu	1.85e-07	NA	1.06e-14	NA
7. B	B7JKB7	Elongation factor Tu	1.68e-07	NA	9.92e-13	NA
7. B	Q877L9	Elongation factor Tu	1.66e-07	NA	2.04e-15	NA
7. B	Q1H4N9	Elongation factor Tu 2	1.81e-07	NA	2.59e-17	NA
7. B	Q9TJQ8	Elongation factor Tu, plastid	1.29e-06	NA	3.68e-12	NA
7. B	Q2KHU8	Eukaryotic translation initiation factor 2 subunit 3	7.31e-10	NA	7.99e-04	NA
7. B	A6Q1L5	Elongation factor Tu	2.29e-07	NA	1.67e-18	NA
7. B	Q88QP8	Elongation factor Tu-A	2.75e-07	NA	1.78e-13	NA
7. B	Q3SWP9	Translation initiation factor IF-2	1.23e-04	NA	8.74e-13	NA
7. B	A0K3L0	Elongation factor Tu	1.79e-07	NA	6.70e-16	NA
7. B	Q925Y6	Elongation factor Tu	6.42e-08	NA	9.53e-14	NA
7. B	B2RHM9	Translation initiation factor IF-2	2.84e-04	NA	3.22e-13	NA
7. B	A2RFQ4	Elongation factor Tu	2.15e-07	NA	8.56e-12	NA
7. B	A8EYF4	Translation initiation factor IF-2	1.11e-04	NA	3.66e-13	NA
7. B	B0BUR2	Elongation factor Tu	1.88e-07	NA	4.57e-17	NA
7. B	Q14HG2	Sulfate adenylyltransferase subunit 1	3.19e-06	NA	1.83e-08	NA
7. B	Q18CE4	Elongation factor Tu	2.17e-07	NA	1.28e-13	NA
7. B	Q6D9A5	Translation initiation factor IF-2	5.46e-04	NA	3.92e-14	NA
7. B	A0KTZ6	Translation initiation factor IF-2	3.49e-04	NA	6.20e-19	NA
7. B	Q15R60	GTPase Der	2.38e-02	NA	3.05e-06	NA
7. B	A4VTQ7	Elongation factor Tu	2.44e-07	NA	1.31e-12	NA
7. B	Q83JC4	Elongation factor Tu	3.38e-07	NA	3.13e-12	NA
7. B	Q1R7U0	Sulfate adenylyltransferase subunit 1	2.09e-06	NA	2.22e-10	NA
7. B	Q255F3	Elongation factor Tu	2.33e-07	NA	2.48e-16	NA
7. B	O83861	Translation initiation factor IF-2	3.46e-04	NA	1.77e-08	NA
7. B	Q057A2	Elongation factor Tu	2.66e-07	NA	7.34e-13	NA
7. B	P42476	Elongation factor Tu	1.90e-07	NA	3.64e-15	NA
7. B	Q5NZS1	Translation initiation factor IF-2	4.91e-04	NA	2.27e-18	NA
7. B	A8GKK1	Elongation factor Tu 2	2.19e-07	NA	1.36e-12	NA
7. B	A9KRZ4	Elongation factor Tu	2.62e-07	NA	5.29e-16	NA
7. B	A1JS52	Elongation factor Tu 2	2.62e-07	NA	1.11e-11	NA
7. B	B6J6B1	Translation initiation factor IF-2	7.66e-05	NA	4.65e-15	NA
7. B	Q5QYB3	GTPase Der	1.87e-02	NA	0.006	NA
7. B	Q05FI3	Elongation factor Tu	1.73e-07	NA	1.11e-15	NA
7. B	A8YUS2	Elongation factor Tu	2.57e-07	NA	7.52e-14	NA
7. B	C4K3F0	Translation initiation factor IF-2	1.73e-04	NA	3.09e-13	NA
7. B	A1U600	Translation initiation factor IF-2	3.08e-04	NA	4.82e-18	NA
7. B	Q5FFN4	GTPase Era	1.36e-03	NA	0.043	NA
7. B	A1JJT0	Sulfate adenylyltransferase subunit 1	2.58e-06	NA	6.50e-11	NA
7. B	P48864	Elongation factor Tu	2.37e-07	NA	5.08e-12	NA
7. B	Q6KID8	Translation initiation factor IF-2	7.03e-06	NA	3.29e-11	NA
7. B	Q8EK70	Elongation factor Tu 2	2.56e-07	NA	1.37e-15	NA
7. B	A1VIP8	Elongation factor Tu	1.73e-07	NA	8.23e-14	NA
7. B	P81795	Eukaryotic translation initiation factor 2 subunit 3, X-linked	6.66e-10	NA	7.78e-04	NA
7. B	Q32CH9	Sulfate adenylyltransferase subunit 1	1.90e-06	NA	2.14e-10	NA
7. B	A6VKH7	Elongation factor Tu	2.06e-07	NA	3.71e-13	NA
7. B	B7N0V3	Translation initiation factor IF-2	4.92e-04	NA	2.05e-13	NA
7. B	P57939	Elongation factor Tu-A	3.02e-07	NA	2.30e-13	NA
7. B	P50062	Elongation factor Tu	1.20e-07	NA	5.17e-13	NA
7. B	A7HWP7	Elongation factor Tu	1.54e-07	NA	2.49e-14	NA
7. B	Q5HAS0	Elongation factor Tu	2.05e-07	NA	2.52e-09	NA
7. B	Q5R6Y0	HBS1-like protein	4.24e-05	NA	1.44e-12	NA
7. B	Q8KHX9	Elongation factor Tu	6.35e-08	NA	1.01e-12	NA
7. B	Q83GT8	Translation initiation factor IF-2	7.82e-05	NA	4.90e-15	NA
7. B	Q0W8G2	Elongation factor 1-alpha	4.08e-06	NA	5.33e-20	NA
7. B	B9KFF9	Elongation factor Tu	2.44e-07	NA	6.31e-17	NA
7. B	A2BYM0	Translation initiation factor IF-2	3.31e-04	NA	2.07e-14	NA
7. B	Q2NJ20	Elongation factor Tu	2.28e-07	NA	2.13e-13	NA
7. B	A1KV51	Translation initiation factor IF-2	6.06e-04	NA	4.30e-16	NA
7. B	Q2A1M0	Elongation factor Tu	1.67e-07	NA	4.86e-14	NA
7. B	A1UBL1	Elongation factor Tu	2.07e-07	NA	1.18e-14	NA
7. B	B1JLY0	Translation initiation factor IF-2	5.08e-04	NA	1.65e-12	NA
7. B	Q7M7X5	Translation initiation factor IF-2	2.56e-04	NA	4.83e-16	NA
7. B	A3PV96	Elongation factor Tu	2.22e-07	NA	1.18e-14	NA
7. B	Q4MYA4	Elongation factor Tu, apicoplast	1.35e-06	NA	1.95e-14	NA
7. B	B9DVB7	Translation initiation factor IF-2	8.02e-04	NA	5.25e-12	NA
7. B	Q7YZN9	Eukaryotic peptide chain release factor GTP-binding subunit	4.36e-05	NA	6.99e-06	NA
7. B	P46199	Translation initiation factor IF-2, mitochondrial	2.30e-05	NA	5.93e-16	NA
7. B	Q65QG6	Elongation factor Tu	2.03e-07	NA	2.28e-13	NA
7. B	B4TJ06	Translation initiation factor IF-2	4.99e-04	NA	3.79e-13	NA
7. B	Q7M7F1	Elongation factor Tu	1.64e-07	NA	2.10e-13	NA
7. B	A0ALY8	Elongation factor Tu	1.98e-07	NA	4.01e-14	NA
7. B	Q68WI4	Translation initiation factor IF-2	2.53e-04	NA	7.89e-13	NA
7. B	A6GYU7	Elongation factor Tu	2.07e-07	NA	6.02e-14	NA
7. B	Q2SVG8	Translation initiation factor IF-2	2.72e-04	NA	8.46e-18	NA
7. B	Q5PEH2	Sulfate adenylyltransferase subunit 1	1.35e-06	NA	2.45e-10	NA
7. B	B3EH93	Elongation factor Tu	1.70e-07	NA	2.56e-12	NA
7. B	P42479	Elongation factor Tu	1.64e-07	NA	6.72e-15	NA
7. B	B5RCY8	GTPase Der	8.33e-03	NA	4.14e-05	NA
7. B	C6E2Q0	Translation initiation factor IF-2	3.30e-04	NA	1.46e-13	NA
7. B	Q39H30	Translation initiation factor IF-2	5.66e-04	NA	1.64e-18	NA
7. B	B1K0M0	Translation initiation factor IF-2	5.74e-04	NA	3.10e-18	NA
7. B	A0RQZ4	Translation initiation factor IF-2	9.57e-05	NA	1.77e-13	NA
7. B	A5I7K8	Elongation factor Tu	2.65e-07	NA	7.05e-17	NA
7. B	Q8P1W4	Elongation factor Tu	1.94e-07	NA	1.36e-12	NA
7. B	B7VJH7	Translation initiation factor IF-2	5.20e-04	NA	2.27e-12	NA
7. B	Q1IX70	Elongation factor Tu	2.64e-07	NA	1.26e-10	NA
7. B	Q1J5B4	Translation initiation factor IF-2	4.77e-04	NA	3.06e-12	NA
7. B	Q6HPR0	Elongation factor Tu	1.60e-07	NA	9.92e-13	NA
7. B	Q1QSZ0	Translation initiation factor IF-2	3.75e-04	NA	6.39e-17	NA
7. B	A7WYX6	Elongation factor Tu	1.55e-07	NA	1.96e-13	NA
7. B	A8A779	Elongation factor Tu 2	3.27e-07	NA	3.43e-12	NA
7. B	A6MW28	Elongation factor Tu, chloroplastic	1.02e-06	NA	2.21e-12	NA
7. B	A8A3N0	Sulfate adenylyltransferase subunit 1	1.60e-06	NA	2.18e-10	NA
7. B	A8FJU1	Translation initiation factor IF-2	1.30e-04	NA	5.14e-12	NA
7. B	Q0BUQ2	Elongation factor Tu	1.76e-07	NA	1.37e-16	NA
7. B	B4EZS9	GTPase Der	8.72e-03	NA	5.60e-04	NA
7. B	Q5FKF4	GTPase Der	8.08e-03	NA	0.004	NA
7. B	C1ET37	Elongation factor Tu	1.59e-07	NA	9.92e-13	NA
7. B	A4VZZ3	Elongation factor Tu	2.71e-07	NA	1.31e-12	NA
7. B	Q9HGI4	Eukaryotic peptide chain release factor GTP-binding subunit	1.20e-04	NA	1.31e-05	NA
7. B	Q6MJ00	Elongation factor Tu	1.66e-07	NA	1.74e-12	NA
7. B	B2JKT4	Translation initiation factor IF-2	5.57e-04	NA	1.55e-17	NA
7. B	Q8UJ51	Translation initiation factor IF-2	2.27e-04	NA	2.10e-13	NA
7. B	O36041	Eukaryotic translation initiation factor 2 subunit gamma (Fragment)	2.84e-09	NA	4.52e-05	NA
7. B	B0SQH4	Translation initiation factor IF-2	1.87e-04	NA	1.27e-14	NA
7. B	B8GIQ3	Elongation factor 1-alpha	2.94e-06	NA	1.05e-19	NA
7. B	B0TC54	Elongation factor Tu	1.98e-07	NA	6.20e-15	NA
7. B	P55875	Translation initiation factor IF-2	4.44e-04	NA	1.28e-12	NA
7. B	A1S204	Elongation factor Tu	2.39e-07	NA	5.53e-15	NA
7. B	A4G9U0	Elongation factor Tu	2.06e-07	NA	1.01e-13	NA
7. B	Q11Q98	Elongation factor Tu	1.57e-07	NA	1.63e-16	NA
7. B	P46280	Elongation factor Tu, chloroplastic	2.41e-06	NA	4.75e-12	NA
7. B	Q3YX73	Translation initiation factor IF-2	2.46e-04	NA	2.16e-13	NA
7. B	A8LQ56	Translation initiation factor IF-2	1.08e-04	NA	9.94e-10	NA
7. B	P42471	Elongation factor Tu	1.82e-07	NA	2.89e-14	NA
7. B	Q21KS9	GTPase Der	1.02e-02	NA	0.025	NA
7. B	A7Z0N5	Elongation factor Tu	1.56e-07	NA	2.98e-14	NA
7. B	A4WD89	GTPase Der	4.10e-03	NA	1.52e-04	NA
7. B	Q1BWS7	Translation initiation factor IF-2	5.61e-04	NA	2.99e-18	NA
7. B	A9BHA7	Elongation factor Tu	2.74e-07	NA	1.17e-15	NA
7. B	A1KB29	Elongation factor Tu	1.73e-07	NA	5.04e-12	NA
7. B	B1JDV4	GTPase Der	4.87e-03	NA	0.009	NA
7. B	Q7VRP0	Elongation factor Tu	2.40e-07	NA	1.74e-12	NA
7. B	P49462	Elongation factor Tu, chloroplastic	2.82e-07	NA	8.59e-10	NA
7. B	Q1JAC1	Translation initiation factor IF-2	2.69e-04	NA	2.88e-12	NA
7. B	Q4URC5	Elongation factor Tu 2	2.06e-07	NA	2.74e-14	NA
7. B	P17196	Elongation factor 1-alpha	6.26e-06	NA	9.19e-23	NA
7. B	Q7MYE8	Elongation factor Tu 2	1.91e-07	NA	3.99e-13	NA
7. B	A7I3U7	Elongation factor Tu	2.43e-07	NA	3.26e-14	NA
7. B	Q43364	Elongation factor TuB, chloroplastic	2.67e-06	NA	3.58e-09	NA
7. B	Q04AY6	GTPase Der	6.18e-03	NA	1.60e-04	NA
7. B	P60339	Elongation factor Tu-B	1.84e-07	NA	1.13e-15	NA
7. B	B1LQ72	Sulfate adenylyltransferase subunit 1	7.90e-07	NA	2.13e-10	NA
7. B	C5A5P4	Elongation factor 1-alpha	2.02e-06	NA	6.07e-16	NA
7. B	A2S7F9	Elongation factor Tu	1.63e-07	NA	1.18e-16	NA
7. B	Q8GTY0	Elongation factor 1-alpha 4	3.42e-06	NA	1.46e-10	NA
7. B	Q03MB1	GTPase Der	6.19e-03	NA	0.028	NA
7. B	Q4A7K0	Elongation factor Tu	6.83e-07	NA	1.46e-15	NA
7. B	Q2A1G8	Translation initiation factor IF-2	2.70e-04	NA	2.39e-13	NA
7. B	A1R8U9	Elongation factor Tu	2.04e-07	NA	1.14e-17	NA
7. B	P43926	Elongation factor Tu	2.84e-07	NA	5.36e-13	NA
7. B	Q7MPF2	Sulfate adenylyltransferase subunit 1	2.29e-06	NA	4.18e-09	NA
7. B	Q9HM89	Elongation factor 1-alpha	2.49e-06	NA	6.57e-21	NA
7. B	Q5ZZV6	Translation initiation factor IF-2	1.44e-05	NA	5.25e-13	NA
7. B	A8EZL8	Elongation factor Tu	1.90e-07	NA	7.95e-17	NA
7. B	P18905	Elongation factor Tu, chloroplastic	1.24e-06	NA	2.38e-07	NA
7. B	Q2RMS0	Translation initiation factor IF-2	1.18e-04	NA	4.48e-13	NA
7. B	Q48D34	Elongation factor Tu	2.31e-07	NA	2.79e-12	NA
7. B	P05453	Eukaryotic peptide chain release factor GTP-binding subunit	1.48e-05	NA	0.002	NA
7. B	Q6AP73	Elongation factor Tu 2	2.21e-07	NA	1.64e-16	NA
7. B	Q2RQV8	Elongation factor Tu 1	1.50e-07	NA	7.56e-13	NA
7. B	Q04B37	Elongation factor Tu	1.89e-07	NA	3.33e-16	NA
7. B	A3D7K6	Translation initiation factor IF-2	3.40e-04	NA	3.75e-18	NA
7. B	A9N732	Translation initiation factor IF-2	5.02e-04	NA	3.79e-13	NA
7. B	A1QZR2	Elongation factor Tu	1.82e-07	NA	4.56e-12	NA
7. B	C0QVZ4	Elongation factor Tu	7.21e-07	NA	2.56e-12	NA
7. B	Q67JU1	Elongation factor Tu	1.61e-07	NA	1.23e-14	NA
7. B	Q21IS6	Sulfate adenylyltransferase subunit 1	2.47e-06	NA	5.06e-09	NA
7. B	A6UPK8	Translation initiation factor 2 subunit gamma	2.77e-08	NA	5.32e-09	NA
7. B	P25166	Elongation factor 1-alpha	2.50e-06	NA	2.24e-11	NA
7. B	Q2G0N0	Elongation factor Tu	1.53e-07	NA	1.96e-13	NA
7. B	B5XSX4	Translation initiation factor IF-2	5.25e-04	NA	1.67e-14	NA
7. B	P0A1H5	Elongation factor Tu	2.05e-07	NA	2.37e-12	NA
7. B	P33169	Elongation factor Tu	2.71e-07	NA	1.04e-15	NA
7. B	Q66FQ9	Elongation factor Tu 1	1.96e-07	NA	2.46e-12	NA
7. B	Q5L627	Translation initiation factor IF-2	2.12e-04	NA	2.31e-11	NA
7. B	Q0TCC0	Elongation factor Tu 1	3.28e-07	NA	3.13e-12	NA
7. B	Q5ZMS3	Eukaryotic translation initiation factor 2 subunit 3	6.93e-10	NA	0.007	NA
7. B	Q04N79	Elongation factor Tu	2.54e-07	NA	3.06e-12	NA
7. B	B6IZ61	Translation initiation factor IF-2	7.87e-05	NA	4.61e-15	NA
7. B	Q18BH4	Translation initiation factor IF-2	1.71e-05	NA	3.77e-12	NA
7. B	Q0SM50	Translation initiation factor IF-2	8.11e-05	NA	3.90e-14	NA
7. B	B0R8C3	Elongation factor 1-alpha	2.14e-06	NA	6.57e-21	NA
7. B	O21245	Elongation factor Tu, mitochondrial	2.04e-07	NA	6.93e-15	NA
7. B	Q89J82	Elongation factor Tu	1.62e-07	NA	2.97e-13	NA
7. B	A6UF29	Translation initiation factor IF-2	1.64e-04	NA	4.09e-14	NA
7. B	P23568	Elongation factor Tu	1.44e-07	NA	4.34e-19	NA
7. B	B2S0H9	Elongation factor Tu	1.59e-07	NA	1.68e-13	NA
7. B	Q8CQ81	Elongation factor Tu	1.63e-07	NA	2.81e-15	NA
7. B	B8GTN1	GTPase Der	1.27e-02	NA	0.016	NA
7. B	A3CP09	Elongation factor Tu	2.50e-07	NA	4.88e-12	NA
7. B	Q5WFU2	Translation initiation factor IF-2	7.28e-05	NA	2.09e-13	NA
7. B	A1WLI3	Translation initiation factor IF-2	6.72e-04	NA	5.16e-17	NA
7. B	A9ABD5	Translation initiation factor IF-2	5.63e-04	NA	1.08e-17	NA
7. B	Q88VE0	Elongation factor Tu	2.47e-07	NA	1.63e-13	NA
7. B	Q6NCN5	Translation initiation factor IF-2	1.32e-04	NA	4.49e-13	NA
7. B	Q9XD38	Elongation factor Tu	2.17e-07	NA	1.42e-10	NA
7. B	Q0SY20	Elongation factor Tu 2	3.15e-07	NA	3.43e-12	NA
7. B	A5WGK9	Elongation factor Tu 1	1.84e-07	NA	1.64e-16	NA
7. B	B8CW72	Translation initiation factor IF-2	3.05e-05	NA	1.56e-15	NA
7. B	O84098	Translation initiation factor IF-2	2.30e-04	NA	6.85e-12	NA
7. B	A1VG83	Translation initiation factor IF-2	1.06e-03	NA	3.64e-10	NA
7. B	A5F3K0	Elongation factor Tu	2.49e-07	NA	1.53e-16	NA
7. B	Q877P8	Elongation factor Tu	1.65e-07	NA	5.78e-13	NA
7. B	P44536	GTPase Der	7.74e-03	NA	0.004	NA
7. B	Q3AZB7	Translation initiation factor IF-2	1.84e-03	NA	6.11e-17	NA
7. B	Q2II78	Elongation factor Tu	1.86e-07	NA	3.82e-12	NA
7. B	B0SSH9	Elongation factor Tu	2.12e-07	NA	9.21e-14	NA
7. B	Q38WR7	Elongation factor Tu	1.79e-07	NA	3.48e-20	NA
7. B	O31298	Elongation factor Tu	2.14e-07	NA	1.27e-10	NA
7. B	P50068	Elongation factor Tu	1.56e-07	NA	4.02e-20	NA
7. B	B8CKR5	GTPase Der	9.95e-03	NA	2.36e-04	NA
7. B	Q9ZK19	Elongation factor Tu	9.51e-07	NA	4.03e-15	NA
7. B	Q5GWR8	Elongation factor Tu	1.79e-07	NA	6.78e-15	NA
7. B	A0KQ95	Elongation factor Tu	2.17e-07	NA	9.60e-13	NA
7. B	Q1XDK1	Elongation factor Tu, chloroplastic	1.06e-06	NA	6.00e-13	NA
7. B	Q5L5H6	Elongation factor Tu	2.31e-07	NA	2.48e-16	NA
7. B	Q71WB9	Elongation factor Tu	1.80e-07	NA	4.01e-14	NA
7. B	A9ETD1	Elongation factor Tu	5.82e-07	NA	2.56e-15	NA
7. B	Q15NP2	Elongation factor Tu	2.02e-07	NA	4.52e-12	NA
7. B	A7ZSL4	Elongation factor Tu 1	3.21e-07	NA	3.13e-12	NA
7. B	Q2GD83	Elongation factor Tu	1.46e-06	NA	2.03e-11	NA
7. B	A9NAK7	Elongation factor Tu	2.19e-07	NA	1.83e-14	NA
7. B	Q6GBT9	Elongation factor Tu	1.57e-07	NA	1.96e-13	NA
7. B	A3DBA0	Elongation factor Tu 2	2.50e-07	NA	2.39e-13	NA
7. B	A6TEI7	Translation initiation factor IF-2	5.11e-04	NA	1.75e-14	NA
7. B	B5FI13	Translation initiation factor IF-2	2.31e-04	NA	3.79e-13	NA
7. B	P64029	Elongation factor Tu	1.53e-07	NA	1.96e-13	NA
7. B	Q73IX6	Elongation factor Tu 1	6.60e-08	NA	1.36e-13	NA
7. B	Q16D38	Translation initiation factor IF-2	1.14e-04	NA	2.90e-13	NA
7. B	B7IUH1	Translation initiation factor IF-2	3.38e-06	NA	2.51e-15	NA
7. B	A6U7A9	GTPase Era	1.53e-03	NA	0.001	NA
7. B	Q8XFP8	Elongation factor Tu	1.96e-07	NA	9.39e-14	NA
7. B	B3QZH5	Elongation factor Tu	1.85e-07	NA	7.80e-14	NA
7. B	Q5SHN6	Elongation factor Tu-A	1.85e-07	NA	3.83e-15	NA
7. B	P64028	Elongation factor Tu	1.53e-07	NA	1.96e-13	NA
7. B	Q8KTA1	Elongation factor Tu	1.85e-07	NA	2.10e-16	NA
7. B	P42478	Elongation factor Tu (Fragment)	1.23e-07	NA	1.27e-14	NA
7. B	Q4KIF6	Translation initiation factor IF-2	3.81e-04	NA	3.00e-20	NA
7. B	B6YQ44	Translation initiation factor IF-2	2.12e-04	NA	1.55e-07	NA
7. B	Q2KDZ5	Translation initiation factor IF-2	2.15e-04	NA	2.16e-13	NA
7. B	P0A3K6	Translation initiation factor IF-2	9.08e-04	NA	2.15e-13	NA
7. B	Q28UW7	Elongation factor Tu	7.28e-08	NA	5.24e-17	NA
7. B	P33168	Elongation factor Tu	2.24e-07	NA	7.02e-10	NA
7. B	C0QHM2	Translation initiation factor IF-2	3.91e-04	NA	1.22e-11	NA
7. B	Q3BRP5	Translation initiation factor IF-2	5.71e-04	NA	2.10e-11	NA
7. B	B0T167	Translation initiation factor IF-2	1.30e-04	NA	1.31e-11	NA
7. B	Q2YM08	Elongation factor Tu	6.66e-08	NA	1.07e-13	NA
7. B	Q83JX8	Sulfate adenylyltransferase subunit 1	8.85e-07	NA	1.82e-10	NA
7. B	Q5NID9	Elongation factor Tu	1.77e-07	NA	7.63e-14	NA
7. B	B7MZ52	Sulfate adenylyltransferase subunit 1	1.58e-06	NA	2.13e-10	NA
7. B	B7MHZ6	GTPase Der	8.53e-03	NA	1.01e-04	NA
7. B	B8CWY9	GTPase Der	9.88e-03	NA	0.002	NA
7. B	Q5JGR9	Probable translation initiation factor IF-2	1.40e-02	NA	0.017	NA
7. B	Q0AYI8	Translation initiation factor IF-2	3.22e-04	NA	8.22e-15	NA
7. B	P23637	Eukaryotic peptide chain release factor GTP-binding subunit	1.76e-04	NA	1.03e-05	NA
7. B	A7H4R3	Elongation factor Tu	2.14e-07	NA	8.68e-17	NA
7. B	P28604	Bifunctional enzyme NodQ	2.33e-04	NA	1.08e-06	NA
7. B	Q5HX30	Translation initiation factor IF-2	1.25e-04	NA	7.58e-12	NA
7. B	A4W5A0	Elongation factor Tu	2.32e-07	NA	2.73e-13	NA
7. B	A1JIW9	Translation initiation factor IF-2	5.17e-04	NA	2.81e-14	NA
7. B	Q2L2G6	Elongation factor Tu	1.65e-07	NA	2.47e-16	NA
7. B	A7ZC69	Translation initiation factor IF-2	1.46e-04	NA	2.87e-13	NA
7. B	Q8W4H7	Elongation factor 1-alpha 2	3.68e-06	NA	1.46e-10	NA
7. B	Q2GKQ2	Translation initiation factor IF-2	7.81e-05	NA	4.24e-12	NA
7. B	A4XYE0	Translation initiation factor IF-2	3.40e-04	NA	2.84e-16	NA
7. B	Q5ZRV4	Translation initiation factor IF-2	2.76e-04	NA	1.22e-15	NA
7. B	P75022	Elongation factor Tu	6.54e-08	NA	1.22e-12	NA
7. B	A3MV69	Elongation factor 1-alpha	3.22e-06	NA	5.12e-14	NA
7. B	Q3A9P8	Elongation factor Tu 2	2.23e-07	NA	2.82e-14	NA
7. B	Q8G5B7	Elongation factor Tu	1.65e-07	NA	5.73e-13	NA
7. B	Q3J8Q0	Elongation factor Tu	1.91e-07	NA	1.01e-14	NA
7. B	A1USL2	Elongation factor Tu 2	6.32e-08	NA	2.36e-13	NA
7. B	Q9KP20	Sulfate adenylyltransferase subunit 1	1.73e-06	NA	2.80e-09	NA
7. B	A9MF24	Sulfate adenylyltransferase subunit 1	2.77e-06	NA	1.83e-10	NA
7. B	A3NUL0	Translation initiation factor IF-2	5.77e-04	NA	1.50e-17	NA
7. B	Q0VSL7	Elongation factor Tu	1.67e-07	NA	3.38e-14	NA
7. B	Q5GS99	Translation initiation factor IF-2	9.96e-05	NA	2.16e-11	NA
7. B	A6QEK0	Elongation factor Tu	1.52e-07	NA	1.96e-13	NA
7. B	Q1GDV0	Elongation factor Tu	7.49e-08	NA	3.20e-15	NA
7. B	Q8CP62	GTPase Der	5.18e-03	NA	0.006	NA
7. B	B3EFB1	Translation initiation factor IF-2	1.81e-04	NA	2.22e-12	NA
7. B	C1AL18	Elongation factor Tu	1.96e-07	NA	1.57e-13	NA
7. B	Q3Z7U3	Translation initiation factor IF-2	4.32e-05	NA	2.06e-16	NA
7. B	B7NQW0	GTPase Der	7.75e-03	NA	1.07e-04	NA
7. B	Q0SZX8	Elongation factor Tu 1	2.10e-07	NA	3.34e-12	NA
7. B	Q6B8Y0	Elongation factor Tu, chloroplastic	1.04e-06	NA	1.53e-10	NA
7. B	Q47LJ1	Elongation factor Tu	1.84e-07	NA	3.26e-15	NA
7. B	Q57710	Probable translation initiation factor IF-2	7.86e-03	NA	0.004	NA
7. B	Q978W8	Translation initiation factor 2 subunit gamma	2.68e-08	NA	5.81e-10	NA
7. B	Q2P0X1	Translation initiation factor IF-2	2.49e-04	NA	3.17e-12	NA
7. B	P29541	Elongation factor G (Fragment)	3.61e-07	NA	0.028	NA
7. B	A8Z5T8	Elongation factor Tu	2.29e-07	NA	1.74e-13	NA
7. B	Q7MH43	Elongation factor Tu 1	2.12e-07	NA	5.65e-16	NA
7. B	A4Y9C0	Translation initiation factor IF-2	4.70e-04	NA	1.14e-18	NA
7. B	Q4A9A2	Translation initiation factor IF-2	6.53e-06	NA	5.25e-13	NA
7. B	A1ST45	Translation initiation factor IF-2	1.96e-04	NA	1.71e-17	NA
7. B	A1K7B9	Translation initiation factor IF-2	2.32e-04	NA	3.26e-19	NA
7. B	Q1QUF9	Sulfate adenylyltransferase subunit 1	1.89e-06	NA	6.39e-09	NA
7. B	B5F415	Sulfate adenylyltransferase subunit 1	1.14e-06	NA	3.63e-10	NA
7. B	B9K884	Elongation factor Tu	3.07e-07	NA	2.52e-13	NA
7. B	Q74MI6	Elongation factor 1-alpha	2.52e-06	NA	7.29e-08	NA
7. B	P0CN33	Elongation factor G, mitochondrial	1.30e-13	NA	3.33e-19	NA
7. B	Q9HNK9	Translation initiation factor 2 subunit gamma	7.90e-08	NA	2.12e-06	NA
7. B	Q43467	Elongation factor Tu, chloroplastic	2.83e-06	NA	1.81e-08	NA
7. B	Q5WZL4	Elongation factor Tu	1.58e-07	NA	3.06e-11	NA
7. B	Q63PZ6	Elongation factor Tu	1.66e-07	NA	1.18e-16	NA
7. B	A3P0B5	Elongation factor Tu	1.76e-07	NA	1.18e-16	NA
7. B	Q81VT2	Elongation factor Tu	1.60e-07	NA	9.92e-13	NA
7. B	Q31VV0	Elongation factor Tu	3.21e-07	NA	3.13e-12	NA
7. B	B7VKY2	Sulfate adenylyltransferase subunit 1	2.48e-06	NA	1.24e-09	NA
7. B	Q57LJ0	GTPase Der	1.20e-02	NA	5.23e-05	NA
7. B	A8M531	Elongation factor Tu	1.77e-07	NA	5.03e-09	NA
7. B	C4ZB99	Elongation factor Tu	2.28e-07	NA	8.10e-14	NA
7. B	A6H103	GTPase Der	2.78e-03	NA	0.006	NA
7. B	Q13EL8	Translation initiation factor IF-2	1.27e-04	NA	8.73e-13	NA
7. B	Q2SSW8	Elongation factor Tu	2.26e-07	NA	3.22e-18	NA
7. B	B2TJ55	Translation initiation factor IF-2	2.03e-04	NA	1.17e-13	NA
7. B	P0A1H6	Elongation factor Tu	2.14e-07	NA	2.37e-12	NA
7. B	A6VU29	Translation initiation factor IF-2	3.13e-04	NA	4.71e-15	NA
7. B	Q0VSS1	Translation initiation factor IF-2	2.10e-04	NA	4.15e-13	NA
7. B	B0RB36	Elongation factor Tu	1.84e-07	NA	3.82e-14	NA
7. B	Q2EEV7	Elongation factor Tu, plastid	1.06e-06	NA	1.27e-13	NA
7. B	P64031	Elongation factor Tu	2.35e-07	NA	3.06e-12	NA
7. B	P31018	Elongation factor 1-alpha	2.44e-06	NA	2.60e-10	NA
7. B	Q086H2	Translation initiation factor IF-2	3.28e-04	NA	7.02e-18	NA
7. B	Q7VM29	GTPase Der	2.57e-02	NA	0.009	NA
7. B	Q6FF40	Translation initiation factor IF-2	4.37e-04	NA	2.65e-15	NA
7. B	P55972	Translation initiation factor IF-2	6.80e-04	NA	3.50e-15	NA
7. B	A0Q6F0	Sulfate adenylyltransferase subunit 1	9.21e-06	NA	1.55e-08	NA
7. B	Q2KXY7	Translation initiation factor IF-2	8.46e-04	NA	2.54e-17	NA
7. B	Q5GXU9	Translation initiation factor IF-2	2.44e-04	NA	3.17e-12	NA
7. B	Q5FTY1	Elongation factor Tu	1.71e-07	NA	3.18e-15	NA
7. B	A8MLC4	Elongation factor Tu	2.20e-07	NA	1.55e-13	NA
7. B	A3DA74	Elongation factor Tu 1	2.08e-07	NA	2.39e-13	NA
7. B	Q2NW23	Translation initiation factor IF-2	5.09e-04	NA	2.49e-14	NA
7. B	B3ETZ7	Elongation factor Tu	2.17e-07	NA	6.74e-19	NA
7. B	P13537	Elongation factor Tu	2.45e-07	NA	1.54e-14	NA
7. B	A0KP35	Sulfate adenylyltransferase subunit 1	1.15e-06	NA	1.62e-10	NA
7. B	Q62KK9	Translation initiation factor IF-2	5.63e-04	NA	1.58e-17	NA
7. B	C3K259	Translation initiation factor IF-2	3.78e-04	NA	4.70e-19	NA
7. B	A9VP75	Elongation factor Tu	2.00e-07	NA	5.94e-13	NA
7. B	Q605B0	Elongation factor Tu	1.66e-07	NA	8.46e-17	NA
7. B	Q8FS84	Elongation factor Tu	1.56e-07	NA	1.28e-11	NA
7. B	A8A317	GTPase Der	8.66e-03	NA	1.06e-04	NA
7. B	B2UUW8	Elongation factor Tu	2.49e-07	NA	1.34e-16	NA
7. B	Q5FKR8	Elongation factor Tu	2.80e-07	NA	6.06e-14	NA
7. B	A6Q6H4	Elongation factor Tu	3.60e-07	NA	4.81e-14	NA
7. B	O07309	Bifunctional enzyme NodQ	2.15e-04	NA	1.12e-08	NA
7. B	Q12QI1	Translation initiation factor IF-2	3.49e-04	NA	1.17e-15	NA
7. B	A5CCL4	Elongation factor Tu 2	1.44e-07	NA	7.38e-18	NA
7. B	P17746	Elongation factor Tu, chloroplastic	3.19e-07	NA	1.81e-08	NA
7. B	A4YWC7	GTPase Era	1.37e-03	NA	0.029	NA
7. B	C1D8X2	Translation initiation factor IF-2	5.67e-04	NA	4.97e-19	NA
7. B	P40175	Elongation factor Tu-3	4.37e-07	NA	8.18e-15	NA
7. B	B0BQZ3	Elongation factor Tu	2.70e-07	NA	2.60e-12	NA
7. B	B8D9G2	Translation initiation factor IF-2	3.07e-04	NA	7.67e-16	NA
7. B	P0DB85	Translation initiation factor IF-2	8.28e-04	NA	2.88e-12	NA
7. B	A4SCQ7	Elongation factor Tu	2.23e-07	NA	1.12e-12	NA
7. B	A8GT71	Elongation factor Tu	1.84e-07	NA	4.57e-17	NA
7. B	B5RPI0	Elongation factor Tu	1.37e-07	NA	9.64e-14	NA
7. B	A3DJ00	Elongation factor Tu	2.25e-07	NA	1.83e-14	NA
7. B	Q6NJD5	Elongation factor Tu	1.70e-07	NA	1.72e-12	NA
7. B	Q7MI09	Translation initiation factor IF-2	5.43e-04	NA	1.02e-12	NA
7. B	Q8U152	Elongation factor 1-alpha	2.48e-07	NA	2.76e-14	NA
7. B	P42482	Elongation factor Tu	1.70e-07	NA	8.38e-18	NA
7. B	Q5NQ27	Translation initiation factor IF-2	3.17e-04	NA	4.66e-12	NA
7. B	A3QGU5	Translation initiation factor IF-2	4.91e-04	NA	1.94e-15	NA
7. B	A5I4J3	Translation initiation factor IF-2	4.10e-05	NA	3.45e-17	NA
7. B	Q042T5	Elongation factor Tu	2.68e-07	NA	4.34e-16	NA
7. B	B9DRL9	Elongation factor Tu	2.07e-07	NA	1.67e-12	NA
7. B	B3E156	Elongation factor Tu	1.87e-07	NA	4.36e-12	NA
7. B	Q0TCU1	Translation initiation factor IF-2	4.98e-04	NA	2.11e-13	NA
7. B	B4SSW8	GTPase Der	5.70e-03	NA	0.010	NA
7. B	B8FCY5	Translation initiation factor IF-2	8.22e-04	NA	4.46e-09	NA
7. B	Q9Y9C1	Translation initiation factor 2 subunit gamma	4.64e-08	NA	4.07e-09	NA
7. B	A4YSJ0	Elongation factor Tu	1.73e-07	NA	2.40e-12	NA
7. B	B7LHN3	Translation initiation factor IF-2	2.50e-04	NA	2.11e-13	NA
7. B	B9EBE9	Translation initiation factor IF-2	1.67e-04	NA	4.83e-15	NA
7. B	Q6G0P2	Translation initiation factor IF-2	1.28e-04	NA	5.49e-14	NA
7. B	Q2NZX1	Elongation factor Tu	1.72e-07	NA	6.78e-15	NA
7. B	G0S8G9	Eukaryotic translation initiation factor 5B	2.68e-03	NA	1.46e-07	NA
7. B	B0JU67	Translation initiation factor IF-2	4.84e-04	NA	4.91e-17	NA
7. B	B2RL52	Elongation factor Tu	1.80e-07	NA	1.44e-18	NA
7. B	Q3B6G3	Elongation factor Tu	1.81e-07	NA	2.20e-12	NA
7. B	Q73F98	Elongation factor Tu	1.64e-07	NA	1.08e-12	NA
7. B	Q980A5	Translation initiation factor 2 subunit gamma	6.52e-08	NA	6.85e-10	NA
7. B	C3LT16	GTPase Der	1.07e-02	NA	1.30e-05	NA
7. B	B6YVG2	Elongation factor 1-alpha	2.38e-06	NA	3.75e-15	NA
7. B	Q01698	Elongation factor Tu	1.90e-07	NA	4.23e-15	NA
7. B	A2C6Q5	Translation initiation factor IF-2	6.51e-04	NA	7.60e-14	NA
7. B	Q6A6L7	Elongation factor Tu	1.66e-07	NA	6.62e-17	NA
7. B	Q1CC07	Translation initiation factor IF-2	4.85e-04	NA	8.15e-13	NA
7. B	C5BFB7	Translation initiation factor IF-2	5.84e-04	NA	1.36e-16	NA
7. B	Q1MPT8	Elongation factor Tu	2.12e-07	NA	4.69e-13	NA
7. B	P52854	Elongation factor Tu	3.20e-06	NA	2.66e-12	NA
7. B	Q9HGI8	Eukaryotic peptide chain release factor GTP-binding subunit	2.02e-05	NA	4.43e-07	NA
7. B	Q2G2D0	Translation initiation factor IF-2	1.13e-04	NA	1.45e-14	NA
7. B	Q47WC5	GTPase Der	1.13e-02	NA	4.64e-05	NA
7. B	B1XAY6	GTPase Der	6.39e-03	NA	1.06e-04	NA
7. B	Q7UZZ9	Translation initiation factor IF-2	3.36e-04	NA	2.26e-14	NA
7. B	A0B7D6	Elongation factor 1-alpha	3.53e-06	NA	1.18e-17	NA
7. B	C4ZSQ9	Translation initiation factor IF-2	2.36e-04	NA	2.11e-13	NA
7. B	Q8DE73	Sulfate adenylyltransferase subunit 1	5.37e-07	NA	3.73e-09	NA
7. B	Q2FRI3	Elongation factor 1-alpha	1.85e-06	NA	3.96e-14	NA
7. B	A1RGX5	Translation initiation factor IF-2	4.80e-04	NA	1.14e-18	NA
7. B	A4WW80	Translation initiation factor IF-2	9.87e-05	NA	1.93e-13	NA
7. B	Q3MDM5	Elongation factor Tu	1.15e-06	NA	4.76e-12	NA
7. B	B3QQI2	Translation initiation factor IF-2	1.72e-04	NA	4.47e-13	NA
7. B	Q1JKH1	Translation initiation factor IF-2	4.67e-04	NA	2.88e-12	NA
7. B	A3DE44	Translation initiation factor IF-2	2.16e-04	NA	6.58e-19	NA
7. B	P51257	Translation initiation factor IF-2, chloroplastic	8.70e-05	NA	9.71e-10	NA
7. B	Q66EC7	Sulfate adenylyltransferase subunit 1	1.84e-06	NA	1.54e-09	NA
7. B	O51741	Translation initiation factor IF-2	4.19e-04	NA	1.07e-13	NA
7. B	P17745	Elongation factor Tu, chloroplastic	2.33e-06	NA	3.70e-10	NA
7. B	Q118Z2	Elongation factor Tu	1.15e-06	NA	3.42e-12	NA
7. B	P84172	Elongation factor Tu, mitochondrial (Fragment)	3.52e-13	NA	1.80e-08	NA
7. B	Q25820	Elongation factor Tu, apicoplast	4.99e-07	NA	1.03e-06	NA
7. B	Q31LL9	Translation initiation factor IF-2	2.96e-04	NA	1.18e-15	NA
7. B	A7ZCN0	Elongation factor Tu	2.43e-07	NA	3.17e-16	NA
7. B	Q5HPS2	Translation initiation factor IF-2	1.31e-04	NA	6.34e-15	NA
7. B	A3Q968	Elongation factor Tu 1	2.16e-07	NA	4.03e-15	NA
7. B	P72483	Elongation factor Tu	2.80e-07	NA	3.41e-12	NA
7. B	B7MKM5	Sulfate adenylyltransferase subunit 1	3.02e-06	NA	2.22e-10	NA
7. B	A3DMQ1	Elongation factor 1-alpha	6.73e-06	NA	3.08e-21	NA
7. B	Q5LWL4	Translation initiation factor IF-2	1.03e-04	NA	1.14e-12	NA
7. B	B0BY61	Translation initiation factor IF-2	2.58e-04	NA	1.45e-11	NA
7. B	P09953	Elongation factor Tu	2.23e-07	NA	2.57e-17	NA
7. B	A8MAJ1	Elongation factor 1-alpha	1.77e-06	NA	2.38e-18	NA
7. B	A1WVC4	Elongation factor Tu 1	1.66e-07	NA	4.14e-16	NA
7. B	C6DBH0	GTPase Der	1.80e-02	NA	0.001	NA
7. B	B5ZC31	Elongation factor Tu	1.59e-07	NA	5.87e-20	NA
7. B	P0CD71	Elongation factor Tu	2.20e-07	NA	2.48e-16	NA
7. B	P0A3B0	Elongation factor Tu	1.85e-07	NA	3.77e-17	NA
7. B	Q87S12	GTPase Der	1.34e-02	NA	1.84e-04	NA
7. B	Q7N8L0	Sulfate adenylyltransferase subunit 1	2.73e-06	NA	2.33e-10	NA
7. B	B1KWK7	Translation initiation factor IF-2	4.01e-05	NA	3.42e-17	NA
7. B	C0ZIH6	Elongation factor Tu	1.80e-07	NA	5.46e-18	NA
7. B	A1VNU2	Translation initiation factor IF-2	6.78e-04	NA	4.34e-15	NA
7. B	B7H1K5	Elongation factor Tu	1.77e-07	NA	1.00e-13	NA
7. B	P33170	Elongation factor Tu	2.15e-07	NA	4.42e-12	NA
7. B	Q1GCH2	Translation initiation factor IF-2	1.03e-04	NA	2.12e-13	NA
7. B	B7MYE6	GTPase Der	8.85e-03	NA	1.01e-04	NA
7. B	P0DA82	Elongation factor Tu	2.11e-07	NA	8.56e-12	NA
7. B	Q9CEI0	Elongation factor Tu	2.99e-07	NA	8.04e-16	NA
7. B	A9H3R7	Elongation factor Tu	1.72e-07	NA	1.41e-16	NA
7. B	Q8NWZ1	Translation initiation factor IF-2	1.10e-04	NA	1.42e-14	NA
7. B	A6TRK7	Translation initiation factor IF-2	2.93e-05	NA	1.26e-16	NA
7. B	Q21RV6	Elongation factor Tu 2	1.78e-07	NA	1.75e-15	NA
7. B	B5QZV8	Translation initiation factor IF-2	4.98e-04	NA	3.79e-13	NA
7. B	A0Q0Q7	Translation initiation factor IF-2	4.08e-05	NA	1.47e-13	NA
7. B	Q6FZL2	Elongation factor Tu 2	6.32e-08	NA	5.97e-13	NA
7. B	Q18KI6	Translation initiation factor 2 subunit gamma	1.15e-07	NA	1.14e-08	NA
7. B	A1W2Q5	Elongation factor Tu 1	1.99e-07	NA	5.29e-14	NA
7. B	Q8A463	Elongation factor Tu	1.58e-07	NA	5.84e-17	NA
7. B	Q98BI8	Translation initiation factor IF-2	1.44e-04	NA	4.46e-13	NA
7. B	C3P9Q3	Elongation factor Tu	1.70e-07	NA	9.92e-13	NA
7. B	A1KGG5	Elongation factor Tu	2.08e-07	NA	1.57e-13	NA
7. B	A7HZ93	Translation initiation factor IF-2	1.65e-04	NA	8.85e-14	NA
7. B	B2IIJ7	Translation initiation factor IF-2	4.60e-04	NA	2.12e-10	NA
7. B	P84318	Elongation factor 1-alpha (Fragment)	2.29e-06	NA	1.25e-06	NA
7. B	Q2FJ92	Elongation factor Tu	1.56e-07	NA	1.96e-13	NA
7. B	Q600B6	Elongation factor Tu	1.34e-07	NA	1.46e-15	NA
7. B	Q97EH5	Elongation factor Tu	2.30e-07	NA	1.08e-14	NA
7. B	B0SAF6	Elongation factor Tu	2.14e-07	NA	9.21e-14	NA
7. B	A6UZH4	Elongation factor Tu	1.79e-07	NA	3.95e-13	NA
7. B	P47388	Translation initiation factor IF-2	5.15e-05	NA	2.52e-13	NA
7. B	Q32BG5	Translation initiation factor IF-2	4.93e-04	NA	2.07e-13	NA
7. B	B1IIN2	GTPase Der	1.04e-02	NA	1.99e-04	NA
7. B	A0LIH6	Elongation factor Tu	2.29e-07	NA	1.70e-13	NA
7. B	A7MXE4	Elongation factor Tu	2.31e-07	NA	7.79e-15	NA
7. B	Q6LU45	GTPase Der	1.11e-02	NA	7.96e-05	NA
7. B	A6TEX7	Elongation factor Tu	2.20e-07	NA	1.56e-12	NA
7. B	B1KLB1	GTPase Der	8.46e-03	NA	3.66e-05	NA
7. B	A1A0T1	Elongation factor Tu	1.68e-07	NA	3.82e-12	NA
7. B	Q7V500	Elongation factor Tu	1.09e-06	NA	4.31e-17	NA
7. B	Q82DQ0	Elongation factor Tu 1	1.63e-07	NA	3.79e-14	NA
7. B	P42480	Elongation factor Tu	1.90e-07	NA	2.32e-18	NA
7. B	B0TZQ0	GTPase Der	3.44e-03	NA	1.04e-04	NA
7. B	P9WNN0	Elongation factor Tu	2.05e-07	NA	1.57e-13	NA
7. B	Q6D280	GTPase Der	1.37e-02	NA	3.22e-04	NA
7. B	Q9ZEU3	Elongation factor Tu	1.88e-07	NA	2.08e-13	NA
7. B	A8A4Y4	Translation initiation factor IF-2	2.14e-04	NA	2.11e-13	NA
7. B	Q1KVS9	Elongation factor Tu, chloroplastic	2.96e-07	NA	2.85e-10	NA
7. B	Q1WUF4	Translation initiation factor IF-2	1.98e-04	NA	2.42e-15	NA
7. B	Q05D44	Eukaryotic translation initiation factor 5B	3.45e-03	NA	1.01e-04	NA
7. B	B1AJG3	Elongation factor Tu	1.61e-07	NA	4.02e-20	NA
7. B	B2UAA3	Translation initiation factor IF-2	5.69e-04	NA	9.91e-18	NA
7. B	P30768	Elongation factor Tu	1.85e-07	NA	9.21e-13	NA
7. B	Q4JT41	Elongation factor Tu	1.87e-07	NA	1.15e-10	NA
7. B	Q87DG7	Bifunctional enzyme CysN/CysC	2.60e-04	NA	1.34e-08	NA
7. B	Q4G342	Elongation factor Tu, chloroplastic	1.43e-06	NA	7.43e-12	NA
7. B	A0LRL8	Elongation factor Tu	1.73e-07	NA	2.03e-14	NA
7. B	Q12AU7	Translation initiation factor IF-2	5.65e-04	NA	7.19e-16	NA
7. B	P07810	Elongation factor 1-alpha	8.30e-06	NA	2.46e-13	NA
7. B	A4FPM7	Elongation factor Tu	1.97e-07	NA	3.69e-14	NA
7. B	Q46J13	Translation initiation factor IF-2	1.82e-03	NA	1.06e-14	NA
7. B	A8GHW1	GTPase Der	1.07e-02	NA	0.001	NA
7. B	Q727D5	Elongation factor Tu	1.68e-07	NA	1.14e-13	NA
7. B	Q211E6	Elongation factor Tu	1.70e-07	NA	5.88e-13	NA
7. B	Q81ZS3	Elongation factor Tu	2.02e-07	NA	5.99e-13	NA
7. B	B4F2B9	Translation initiation factor IF-2	4.07e-04	NA	2.16e-13	NA
7. B	B6ENE2	Translation initiation factor IF-2	2.42e-04	NA	1.73e-13	NA
7. B	C3L0M1	GTPase Der	6.73e-03	NA	1.78e-04	NA
7. B	P50064	Elongation factor Tu	1.32e-06	NA	8.53e-14	NA
7. B	B6JN44	Elongation factor Tu	2.33e-07	NA	7.71e-17	NA
7. B	P74227	Elongation factor Tu	8.42e-07	NA	1.85e-11	NA
7. B	A8ABM5	Elongation factor 1-alpha	6.62e-06	NA	4.21e-19	NA
7. B	Q464Z4	Elongation factor 1-alpha	1.28e-06	NA	2.77e-17	NA
7. B	Q81WM3	Translation initiation factor IF-2	3.78e-06	NA	6.03e-15	NA
7. B	Q6G4W7	Translation initiation factor IF-2	1.48e-04	NA	2.52e-14	NA
7. B	Q31W47	Translation initiation factor IF-2	5.10e-04	NA	2.10e-13	NA
7. B	Q8U1R8	Probable translation initiation factor IF-2	6.97e-03	NA	0.034	NA
7. B	P23845	Sulfate adenylyltransferase subunit 1	1.86e-06	NA	2.13e-10	NA
7. B	Q0K9B9	Translation initiation factor IF-2	7.33e-04	NA	1.07e-19	NA
7. B	Q0TEA7	Sulfate adenylyltransferase subunit 1	1.67e-06	NA	2.13e-10	NA
7. B	Q03M88	Translation initiation factor IF-2	7.96e-04	NA	6.22e-13	NA
7. B	B0CH34	Elongation factor Tu	6.70e-08	NA	6.71e-14	NA
7. B	Q7W9A5	Translation initiation factor IF-2	6.38e-05	NA	9.19e-18	NA
7. B	B8G1W4	Elongation factor Tu	2.06e-07	NA	1.63e-14	NA
7. B	Q3ICZ9	GTPase Der	5.94e-03	NA	7.50e-05	NA
7. B	B0BBV3	Elongation factor Tu	2.14e-07	NA	1.71e-16	NA
7. B	A8ZZ65	Translation initiation factor IF-2	1.60e-04	NA	6.59e-11	NA
7. B	P74120	GTPase Der	1.15e-02	NA	0.021	NA
7. B	A7MGU7	GTPase Der	7.57e-03	NA	8.37e-05	NA
7. B	Q6LLV5	Elongation factor Tu 2	2.62e-07	NA	1.09e-15	NA
7. B	B2UQY9	Elongation factor Tu	1.47e-07	NA	4.44e-13	NA
7. B	A9WSW5	Elongation factor Tu	2.07e-07	NA	1.17e-17	NA
7. B	O67825	Translation initiation factor IF-2	7.91e-05	NA	2.17e-18	NA
7. B	Q9P9Q9	Elongation factor Tu	1.60e-07	NA	6.55e-13	NA
7. B	A8LC58	Elongation factor Tu	1.76e-07	NA	1.11e-11	NA
7. B	A6TCD0	GTPase Der	7.69e-03	NA	4.04e-05	NA
7. B	Q3AW53	Elongation factor Tu	1.19e-06	NA	2.34e-14	NA
7. B	B9L7I8	Elongation factor Tu	2.38e-07	NA	7.27e-14	NA
7. B	Q9PQH1	Translation initiation factor IF-2	5.37e-06	NA	1.51e-08	NA
7. B	P0CY35	Elongation factor 1-alpha 1	1.05e-05	NA	7.22e-09	NA
7. B	P9WNM4	Bifunctional enzyme CysN/CysC	5.48e-04	NA	6.30e-06	NA
7. B	C4K2I2	Elongation factor Tu	1.74e-07	NA	4.57e-17	NA
7. B	Q0SSD4	Translation initiation factor IF-2	3.46e-05	NA	1.50e-13	NA
7. B	C4K4F8	Elongation factor Tu	2.10e-07	NA	2.08e-14	NA
7. B	Q9XCI8	GTPase Der	8.61e-03	NA	5.01e-05	NA
7. B	Q2VIR3	Eukaryotic translation initiation factor 2 subunit 3B	7.36e-10	NA	0.005	NA
7. B	O69303	Elongation factor Tu	2.23e-07	NA	8.68e-17	NA
7. B	Q6GJC0	Elongation factor Tu	1.59e-07	NA	1.96e-13	NA
7. B	Q3A9R3	Elongation factor Tu 1	2.19e-07	NA	8.35e-15	NA
7. B	B2GBC2	Elongation factor Tu	1.67e-07	NA	4.01e-14	NA
7. B	O74774	Elongation factor 1 alpha-like protein	3.29e-05	NA	8.24e-11	NA
7. B	Q97ID7	GTPase Der	5.64e-03	NA	0.045	NA
7. B	Q5PLB0	Translation initiation factor IF-2	4.98e-04	NA	3.36e-13	NA
7. B	Q4UL51	Translation initiation factor IF-2	1.23e-04	NA	6.46e-14	NA
7. B	B0VE81	Translation initiation factor IF-2	4.34e-04	NA	2.19e-14	NA
7. B	A4YJE9	Translation initiation factor IF-2	1.62e-04	NA	3.03e-13	NA
7. B	C5D3R5	Elongation factor Tu	1.59e-07	NA	1.92e-15	NA
7. B	Q9MUP0	Elongation factor Tu, chloroplastic	7.73e-07	NA	3.91e-09	NA
7. B	Q5HIC7	Elongation factor Tu	1.50e-07	NA	1.96e-13	NA
7. B	A3PEY3	Translation initiation factor IF-2	6.39e-04	NA	4.99e-15	NA
7. B	Q32B27	Elongation factor Tu	3.11e-07	NA	3.13e-12	NA
7. B	B5R578	GTPase Der	9.99e-03	NA	5.14e-05	NA
7. B	Q83ES6	Elongation factor Tu	1.63e-07	NA	1.83e-14	NA
7. B	B2I2M7	Translation initiation factor IF-2	4.33e-04	NA	2.19e-14	NA
7. B	Q9X764	Translation initiation factor IF-2	2.79e-04	NA	4.67e-15	NA
7. B	Q7VHF6	Translation initiation factor IF-2	1.20e-04	NA	7.00e-16	NA
7. B	B3PMU1	Elongation factor Tu	2.33e-07	NA	1.75e-16	NA
7. B	A4IXH0	GTPase Der	1.05e-02	NA	1.86e-04	NA
7. B	Q0RRS3	Elongation factor Tu	1.83e-07	NA	3.95e-12	NA
7. B	Q2YQR7	Translation initiation factor IF-2	2.86e-04	NA	2.02e-13	NA
7. B	Q8EX18	Elongation factor Tu	2.03e-07	NA	9.88e-18	NA
7. B	A8P1W0	Elongation factor G, mitochondrial	1.11e-16	NA	3.68e-24	NA
7. B	Q8KT97	Elongation factor Tu	1.89e-07	NA	9.91e-16	NA
7. B	B2HSL3	Elongation factor Tu	1.95e-07	NA	1.33e-12	NA
7. B	Q9JYD2	Translation initiation factor IF-2	6.06e-04	NA	4.81e-16	NA
7. B	Q609C0	Translation initiation factor IF-2	3.09e-04	NA	4.49e-14	NA
7. B	B9DKV8	Elongation factor Tu	1.61e-07	NA	9.19e-14	NA
7. B	Q8M9W7	Elongation factor Tu, chloroplastic	3.67e-06	NA	1.53e-06	NA
7. B	A5IHR6	Elongation factor Tu	1.96e-07	NA	4.33e-11	NA
7. B	Q8E645	Elongation factor Tu	2.19e-07	NA	7.35e-12	NA
7. B	A6KYK9	Elongation factor Tu	1.61e-07	NA	3.98e-17	NA
7. B	B7V1F6	Translation initiation factor IF-2	3.66e-04	NA	1.12e-17	NA
7. B	A8G6Z5	Translation initiation factor IF-2	6.64e-04	NA	1.29e-14	NA
7. B	B5ZBC9	Translation initiation factor IF-2	2.54e-06	NA	1.19e-08	NA
7. B	A9WGP6	Translation initiation factor IF-2	5.60e-05	NA	9.05e-14	NA
7. B	Q8NZU7	Translation initiation factor IF-2	8.29e-04	NA	1.44e-11	NA
7. B	Q87EV4	Translation initiation factor IF-2	4.82e-04	NA	3.83e-13	NA
7. B	Q4A578	Translation initiation factor IF-2	1.72e-05	NA	4.67e-11	NA
7. B	A7FNJ0	Elongation factor Tu 1	2.04e-07	NA	2.46e-12	NA
7. B	Q4L5X1	Translation initiation factor IF-2	4.13e-05	NA	1.14e-15	NA
7. B	A7I656	Elongation factor 1-alpha	2.29e-06	NA	2.45e-21	NA
7. B	B7HQU2	Elongation factor Tu	1.58e-07	NA	1.08e-12	NA
7. B	Q493T7	Translation initiation factor IF-2	5.49e-04	NA	4.71e-15	NA
7. B	Q3A6P9	Elongation factor Tu 2	1.95e-07	NA	4.69e-12	NA
7. B	A1VXL9	Translation initiation factor IF-2	1.27e-04	NA	1.58e-11	NA
7. B	Q8EHL5	Translation initiation factor IF-2	3.34e-04	NA	6.12e-19	NA
7. B	A4JAM5	Elongation factor Tu	1.76e-07	NA	4.07e-16	NA
7. B	P51287	Elongation factor Tu, chloroplastic	9.54e-07	NA	1.52e-12	NA
7. B	Q0C1F4	Elongation factor Tu 1	1.56e-07	NA	3.46e-13	NA
7. B	A7GK18	Elongation factor Tu	1.59e-07	NA	1.09e-11	NA
7. B	B5E653	Elongation factor Tu	2.46e-07	NA	3.06e-12	NA
7. B	Q7UMW2	Bifunctional enzyme CysN/CysC	2.63e-04	NA	2.92e-06	NA
7. B	Q26487	Elongation factor 1-alpha (Fragment)	2.07e-06	NA	4.68e-07	NA
7. B	B5RM34	Elongation factor Tu	1.35e-07	NA	9.64e-14	NA
7. B	C4ZX86	GTPase Der	8.53e-03	NA	1.06e-04	NA
7. B	Q5ZYP5	Elongation factor Tu	1.62e-07	NA	4.33e-11	NA
7. B	A4YCR6	Elongation factor 1-alpha	5.63e-06	NA	3.09e-22	NA
7. B	Q2NVM8	Sulfate adenylyltransferase subunit 1	1.94e-05	NA	1.05e-09	NA
7. B	A7GGA7	GTPase Der	7.68e-03	NA	2.56e-04	NA
7. B	Q6YQV8	Elongation factor Tu	2.23e-07	NA	2.16e-14	NA
7. B	Q2GGQ8	Translation initiation factor IF-2	6.62e-05	NA	4.85e-11	NA
7. B	A6UV43	Elongation factor 1-alpha	3.20e-07	NA	5.96e-14	NA
7. B	P0DH99	Elongation factor 1-alpha 1	3.60e-06	NA	1.46e-10	NA
7. B	O50306	Elongation factor Tu	1.49e-07	NA	4.25e-15	NA
7. B	B4T0P5	GTPase Der	1.41e-02	NA	5.01e-05	NA
7. B	A6U188	Translation initiation factor IF-2	1.15e-04	NA	1.47e-14	NA
7. B	Q1RIX0	Translation initiation factor IF-2	2.43e-04	NA	7.54e-13	NA
7. B	A8G907	Translation initiation factor IF-2	5.73e-04	NA	2.41e-16	NA
7. B	Q2NQL7	Elongation factor Tu	2.04e-07	NA	2.62e-12	NA
7. B	Q73SD1	Elongation factor Tu	2.10e-07	NA	2.13e-14	NA
7. B	Q83JF9	Translation initiation factor IF-2	5.13e-04	NA	2.10e-13	NA
7. B	A1SU43	GTPase Der	1.72e-02	NA	2.49e-04	NA
7. B	B5YS58	Translation initiation factor IF-2	2.39e-04	NA	2.11e-13	NA
7. B	B0B9K4	Translation initiation factor IF-2	2.34e-04	NA	7.29e-12	NA
7. B	B8I5N8	Elongation factor Tu	2.33e-07	NA	3.63e-16	NA
7. B	Q8KAH0	Elongation factor Tu	1.58e-07	NA	1.94e-14	NA
7. B	Q8Z4P6	GTPase Der	8.31e-03	NA	4.71e-05	NA
7. B	Q3BWY6	Elongation factor Tu	2.11e-07	NA	2.31e-14	NA
7. B	Q0I1U9	Elongation factor Tu	2.84e-07	NA	8.94e-13	NA
7. B	A1SNN5	Elongation factor Tu	1.68e-07	NA	8.02e-16	NA
7. B	Q9PK73	Elongation factor Tu	NA	NA	2.34e-16	NA
7. B	Q4K519	Elongation factor Tu	2.21e-07	NA	4.37e-14	NA
7. B	B7LEG9	Sulfate adenylyltransferase subunit 1	1.87e-06	NA	2.11e-10	NA
7. B	P0A6P6	GTPase Der	9.03e-03	NA	1.06e-04	NA
7. B	B7NKN7	Translation initiation factor IF-2	6.05e-04	NA	2.11e-13	NA
7. B	A5GAW4	Elongation factor Tu	2.21e-07	NA	9.73e-15	NA
7. B	Q17VM8	Elongation factor Tu	1.94e-07	NA	6.88e-14	NA
7. B	Q0T208	GTPase Der	8.88e-03	NA	1.06e-04	NA
7. B	Q3SLQ1	Elongation factor Tu	1.96e-07	NA	1.31e-11	NA
7. B	C3L0B6	Translation initiation factor IF-2	4.05e-05	NA	1.45e-17	NA
7. B	A7FMS2	Translation initiation factor IF-2	5.11e-04	NA	1.65e-12	NA
7. B	A3PGI1	Elongation factor Tu	6.63e-08	NA	8.57e-17	NA
7. B	B8F4X7	GTPase Der	1.53e-02	NA	0.002	NA
7. B	A5IQA2	Elongation factor Tu	1.59e-07	NA	1.96e-13	NA
7. B	Q65PA9	Elongation factor Tu	1.44e-07	NA	3.18e-15	NA
7. B	Q03F25	Elongation factor Tu	2.38e-07	NA	3.25e-16	NA
7. B	B9JYK6	Translation initiation factor IF-2	2.43e-04	NA	2.13e-15	NA
7. B	A1BDF1	Translation initiation factor IF-2	2.43e-04	NA	8.90e-13	NA
7. B	A9M5Q2	Elongation factor Tu	6.86e-08	NA	1.07e-13	NA
7. B	P59506	Elongation factor Tu	2.01e-07	NA	3.24e-10	NA
7. B	Q0A797	Translation initiation factor IF-2	4.40e-04	NA	1.08e-14	NA
7. B	Q2S1P8	Elongation factor Tu	2.37e-07	NA	1.45e-13	NA
7. B	Q3AMT6	Elongation factor Tu	1.06e-06	NA	3.59e-18	NA
7. B	Q1QN32	Elongation factor Tu	1.67e-07	NA	3.50e-14	NA
7. B	Q976B1	Elongation factor 1-alpha	5.25e-06	NA	9.52e-19	NA
7. B	Q2RJM5	Translation initiation factor IF-2	1.87e-04	NA	2.95e-16	NA
7. B	Q2GJ61	Elongation factor Tu	2.21e-07	NA	7.90e-12	NA
7. B	A1ALS6	Elongation factor Tu	2.28e-07	NA	1.12e-14	NA
7. B	Q8DCQ7	Elongation factor Tu 2	1.90e-07	NA	4.96e-15	NA
7. B	B8J1Y4	Translation initiation factor IF-2	2.82e-04	NA	1.14e-14	NA
7. B	Q8R050	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A	5.64e-06	NA	1.30e-08	NA
7. B	B4SBU5	Elongation factor Tu	2.05e-07	NA	2.09e-11	NA
7. B	B4TFX1	Sulfate adenylyltransferase subunit 1	2.04e-06	NA	4.11e-10	NA
7. B	B6JKX5	Translation initiation factor IF-2	3.00e-04	NA	2.80e-15	NA
7. B	Q2IPZ7	Translation initiation factor IF-2	2.97e-04	NA	6.05e-10	NA
7. B	Q5E830	Sulfate adenylyltransferase subunit 1	9.80e-06	NA	3.85e-09	NA
7. B	A0R8H8	Elongation factor Tu	1.63e-07	NA	9.92e-13	NA
7. B	A5VJ92	Elongation factor Tu	2.29e-07	NA	9.94e-14	NA
7. B	Q2W2H3	Elongation factor Tu	1.85e-07	NA	3.20e-13	NA
7. B	B0KK53	Elongation factor Tu	2.52e-07	NA	1.78e-13	NA
7. B	F1QGW6	Eukaryotic translation initiation factor 2 subunit 3	7.08e-10	NA	0.004	NA
7. B	A2CC87	Elongation factor Tu	1.06e-06	NA	1.02e-16	NA
7. B	Q10XM3	Translation initiation factor IF-2	5.43e-04	NA	2.71e-13	NA
7. B	Q0TMN0	Elongation factor Tu	1.91e-07	NA	9.39e-14	NA
7. B	Q8P173	Putative elongation factor 4	0.00e+00	NA	2.50e-64	NA
7. B	B1MGH7	Elongation factor Tu	2.03e-07	NA	1.51e-13	NA
7. B	Q9Y713	Elongation factor 1-alpha	4.06e-06	NA	1.08e-08	NA
7. B	Q3JSY9	Translation initiation factor IF-2	5.69e-04	NA	1.65e-17	NA
7. B	Q74JU6	Elongation factor Tu	2.75e-07	NA	2.61e-16	NA
7. B	Q2RQU6	Elongation factor Tu 2	1.58e-07	NA	1.11e-12	NA
7. B	Q8EB10	Sulfate adenylyltransferase subunit 1	2.05e-06	NA	5.18e-11	NA
7. B	Q8KTA6	Elongation factor Tu	1.81e-07	NA	3.11e-16	NA
7. B	P84319	Elongation factor 1-alpha (Fragment)	1.68e-06	NA	1.25e-06	NA
7. B	P84321	Elongation factor 1-alpha (Fragment)	1.84e-06	NA	1.25e-06	NA
7. B	P0CN32	Elongation factor G, mitochondrial	4.00e-15	NA	3.21e-19	NA
7. B	Q2S8Z8	Elongation factor Tu	1.97e-07	NA	3.68e-12	NA
7. B	Q12PT0	GTPase Der	6.90e-03	NA	0.001	NA
7. B	A6LL68	GTPase Era	9.69e-04	NA	0.004	NA
7. B	C0ZVT7	Elongation factor Tu	1.94e-07	NA	2.30e-11	NA
7. B	A0JZ88	Elongation factor Tu	1.95e-07	NA	1.08e-18	NA
7. B	Q9Z0N2	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	6.82e-10	NA	0.001	NA
7. B	P56003	Elongation factor Tu	2.32e-07	NA	5.77e-16	NA
7. B	A2RD01	Translation initiation factor IF-2	1.06e-03	NA	2.78e-12	NA
7. B	Q39VA6	Translation initiation factor IF-2	4.17e-05	NA	2.49e-13	NA
7. B	Q9AC25	Translation initiation factor IF-2	4.23e-04	NA	5.80e-11	NA
7. B	Q2JUX4	Elongation factor Tu	1.17e-06	NA	3.71e-12	NA
7. B	Q7NBZ4	Translation initiation factor IF-2	2.23e-05	NA	5.95e-11	NA
7. B	Q87SX9	Sulfate adenylyltransferase subunit 1	2.97e-06	NA	2.98e-09	NA
7. B	Q03QN5	Elongation factor Tu	2.37e-07	NA	1.25e-12	NA
7. B	Q8G6A8	GTPase Der	6.07e-03	NA	0.022	NA
7. B	C1KZK6	Elongation factor Tu	1.84e-07	NA	4.01e-14	NA
7. B	P39730	Eukaryotic translation initiation factor 5B	1.10e-03	NA	1.54e-07	NA
7. B	A7H1L5	Translation initiation factor IF-2	1.17e-04	NA	5.69e-12	NA
7. B	Q21WJ5	Translation initiation factor IF-2	6.02e-04	NA	2.77e-14	NA
7. B	O83217	Elongation factor Tu	2.04e-07	NA	1.57e-12	NA
7. B	Q83NT9	Elongation factor Tu	1.67e-07	NA	2.16e-17	NA
7. B	A8YZP5	Elongation factor Tu	1.50e-07	NA	1.96e-13	NA
7. B	B2V4G9	Translation initiation factor IF-2	2.50e-04	NA	1.35e-13	NA
7. B	P0CE47	Elongation factor Tu 1	3.23e-07	NA	3.13e-12	NA
7. B	A8AQ58	Translation initiation factor IF-2	5.12e-04	NA	4.92e-13	NA
7. B	Q5RDE1	Eukaryotic translation initiation factor 5B	3.85e-03	NA	0.003	NA
7. B	B2FNR1	GTPase Der	7.35e-03	NA	0.010	NA
7. B	Q8KT95	Elongation factor Tu	1.81e-07	NA	1.69e-16	NA
7. B	A1S859	GTPase Der	1.22e-02	NA	2.82e-05	NA
7. B	C1CLI6	Elongation factor Tu	2.70e-07	NA	3.06e-12	NA
7. B	A6W394	Elongation factor Tu	2.80e-07	NA	1.41e-12	NA
7. B	Q8X7X7	Sulfate adenylyltransferase subunit 1	1.74e-06	NA	1.93e-10	NA
7. B	Q98QG1	Elongation factor Tu	6.34e-07	NA	1.18e-14	NA
7. B	A6WWW5	Translation initiation factor IF-2	3.01e-04	NA	5.35e-14	NA
7. B	Q73FL0	Translation initiation factor IF-2	1.09e-04	NA	1.89e-12	NA
7. B	C3LRM1	Sulfate adenylyltransferase subunit 1	2.76e-06	NA	2.80e-09	NA
7. B	C4K4J2	GTPase Der	1.14e-02	NA	1.19e-04	NA
7. B	Q79G84	Elongation factor Tu	1.68e-07	NA	8.78e-17	NA
7. B	C5CC66	Elongation factor Tu	2.10e-07	NA	1.13e-14	NA
7. B	Q72GW4	Elongation factor Tu	1.95e-07	NA	1.44e-14	NA
7. B	B8HVR7	Elongation factor Tu	1.16e-06	NA	5.54e-12	NA
7. B	O24310	Elongation factor Tu, chloroplastic	NA	NA	7.09e-11	NA
7. B	A9IMT5	Translation initiation factor IF-2	1.39e-04	NA	2.89e-14	NA
7. B	A5IM81	Elongation factor Tu	2.82e-07	NA	2.35e-14	NA
7. B	A0QS98	Elongation factor Tu	2.12e-07	NA	1.81e-14	NA
7. B	B7GU46	Elongation factor Tu	1.57e-07	NA	9.37e-13	NA
7. B	B8ZSC1	Elongation factor Tu	1.94e-07	NA	9.21e-13	NA
7. B	Q72ER1	Translation initiation factor IF-2	5.83e-04	NA	3.43e-10	NA
7. B	A6LSQ4	Translation initiation factor IF-2	3.92e-05	NA	4.74e-16	NA
7. B	Q24208	Eukaryotic translation initiation factor 2 subunit 3	3.89e-08	NA	0.002	NA
7. B	Q839G8	Elongation factor Tu	1.89e-07	NA	4.61e-15	NA
7. B	B7LCQ1	GTPase Der	4.65e-03	NA	1.06e-04	NA
7. B	B3QUN2	Translation initiation factor IF-2	4.56e-04	NA	1.20e-11	NA
7. B	Q2YXP7	Translation initiation factor IF-2	1.13e-04	NA	1.47e-14	NA
7. B	B6EGZ1	GTPase Der	1.95e-02	NA	4.09e-04	NA
7. B	Q40450	Elongation factor TuA, chloroplastic	2.37e-06	NA	3.89e-10	NA
7. B	Q149F3	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	4.90e-06	NA	8.78e-10	NA
7. B	A0RQJ3	Elongation factor Tu	2.46e-07	NA	4.01e-17	NA
7. B	C1F697	Translation initiation factor IF-2	3.82e-04	NA	3.39e-12	NA
7. B	B1YGU8	Elongation factor Tu	1.42e-07	NA	1.50e-14	NA
7. B	B3EAE7	Translation initiation factor IF-2	6.31e-05	NA	1.03e-11	NA
7. B	A0PM42	Elongation factor Tu	2.08e-07	NA	1.33e-12	NA
7. B	A5FZW7	Elongation factor Tu	1.33e-07	NA	1.37e-17	NA
7. B	B4U1E8	Translation initiation factor IF-2	4.46e-04	NA	2.09e-12	NA
7. B	P33167	Elongation factor Tu	1.77e-07	NA	8.48e-16	NA
7. B	Q3JMP6	Elongation factor Tu	1.65e-07	NA	1.18e-16	NA
7. B	A4JDX1	Translation initiation factor IF-2	5.75e-04	NA	1.69e-18	NA
7. B	A6TZ25	Elongation factor Tu	1.53e-07	NA	1.96e-13	NA
7. B	Q9HGI6	Eukaryotic peptide chain release factor GTP-binding subunit	7.58e-05	NA	7.03e-06	NA
7. B	B8ZL95	Elongation factor Tu	2.40e-07	NA	3.06e-12	NA
7. B	Q53871	Elongation factor Tu-1	1.54e-07	NA	4.96e-14	NA
7. B	A9NEN4	Elongation factor Tu	1.47e-07	NA	5.40e-14	NA
7. B	Q03YI2	Elongation factor Tu	1.84e-07	NA	8.91e-13	NA
7. B	A5WH42	Elongation factor Tu 2	1.85e-07	NA	8.40e-16	NA
7. B	Q64VQ9	Sulfate adenylyltransferase subunit 1	3.23e-04	NA	1.90e-07	NA
7. B	Q8TVE5	Translation initiation factor 2 subunit gamma	3.09e-08	NA	3.50e-07	NA
7. B	A8A5E6	Elongation factor Tu 1	3.22e-07	NA	3.13e-12	NA
7. B	C4KZP9	Elongation factor Tu	1.73e-07	NA	1.69e-14	NA
7. B	Q92HF5	Translation initiation factor IF-2	1.37e-04	NA	9.76e-12	NA
7. B	B7LKC7	GTPase Der	7.53e-03	NA	1.04e-04	NA
7. B	A8F223	Translation initiation factor IF-2	1.49e-04	NA	8.00e-12	NA
7. B	Q24UI6	Translation initiation factor IF-2	2.99e-04	NA	4.76e-15	NA
7. B	B2U207	Translation initiation factor IF-2	2.39e-04	NA	2.00e-13	NA
7. B	Q48E77	Translation initiation factor IF-2	3.93e-04	NA	1.15e-19	NA
7. B	A9N8V6	Translation initiation factor IF-2	7.55e-05	NA	4.57e-15	NA
7. B	A1T4L6	Elongation factor Tu	2.04e-07	NA	1.90e-15	NA
7. B	P84320	Elongation factor 1-alpha (Fragment)	3.07e-06	NA	1.25e-06	NA
7. B	Q6F0J5	Elongation factor Tu	1.30e-06	NA	2.58e-18	NA
7. B	B0K3E4	GTPase Der	6.20e-03	NA	0.013	NA
7. B	P84322	Elongation factor 1-alpha (Fragment)	3.01e-06	NA	1.25e-06	NA
7. B	Q1LLR6	Translation initiation factor IF-2	6.36e-04	NA	4.69e-18	NA
7. B	Q30X13	Elongation factor Tu	2.38e-07	NA	1.91e-13	NA
7. B	B7MB89	Translation initiation factor IF-2	2.34e-04	NA	2.11e-13	NA
7. B	B2J5B1	Elongation factor Tu	1.03e-06	NA	3.61e-12	NA
7. B	Q1LSY4	Elongation factor Tu	2.26e-07	NA	1.20e-16	NA
7. B	Q0AIJ7	Elongation factor Tu 1	2.05e-07	NA	1.70e-13	NA
7. B	A4SGG2	Translation initiation factor IF-2	1.28e-04	NA	3.66e-10	NA
7. B	P02992	Elongation factor Tu, mitochondrial	5.36e-07	NA	2.91e-16	NA
7. B	B7LXG3	Sulfate adenylyltransferase subunit 1	1.75e-06	NA	2.11e-10	NA
7. B	A1UU50	Translation initiation factor IF-2	1.41e-04	NA	1.90e-15	NA
7. B	Q9TKZ5	Elongation factor Tu, chloroplastic	8.63e-07	NA	3.76e-12	NA
7. B	Q63TP8	Translation initiation factor IF-2	5.74e-04	NA	1.65e-17	NA
7. B	B0BTQ8	GTPase Der	1.18e-02	NA	0.001	NA
7. B	B1KMH4	Sulfate adenylyltransferase subunit 1	2.62e-06	NA	2.61e-09	NA
7. B	Q5FQM3	Translation initiation factor IF-2	2.23e-04	NA	3.22e-12	NA
7. B	Q9KV37	Elongation factor Tu-A	2.20e-07	NA	1.83e-16	NA
7. B	A7FVZ3	Translation initiation factor IF-2	4.05e-05	NA	3.45e-17	NA
7. B	B3H0R7	GTPase Der	1.03e-02	NA	0.001	NA
7. B	Q79GC6	Elongation factor Tu	1.76e-07	NA	8.78e-17	NA
7. B	Q0BYB2	Elongation factor Tu 2	1.61e-07	NA	1.93e-13	NA
7. B	Q4P257	Elongation factor G, mitochondrial	4.09e-10	NA	1.12e-18	NA
7. B	B8J1A0	Elongation factor Tu	1.41e-07	NA	6.18e-15	NA
7. B	Q9V1G0	Translation initiation factor 2 subunit gamma	3.10e-08	NA	4.13e-12	NA
7. B	B4S5M9	Elongation factor Tu	1.86e-07	NA	2.64e-13	NA
7. B	Q14K20	Translation initiation factor IF-2	2.68e-04	NA	3.30e-13	NA
7. B	A1AVJ8	Elongation factor Tu 1	1.99e-07	NA	3.41e-14	NA
7. B	Q4FLK5	Elongation factor Tu	1.75e-07	NA	2.40e-13	NA
7. B	Q04634	Elongation factor 1-alpha	3.29e-06	NA	1.21e-10	NA
7. B	B1KX71	GTPase Der	8.55e-03	NA	6.60e-04	NA
7. B	A5GF86	Translation initiation factor IF-2	1.69e-04	NA	3.74e-13	NA
7. B	Q83GW1	Elongation factor Tu	1.67e-07	NA	5.62e-17	NA
7. B	Q1JFG4	Translation initiation factor IF-2	8.28e-04	NA	2.88e-12	NA
7. B	Q2FHG9	Translation initiation factor IF-2	1.13e-04	NA	1.45e-14	NA
7. B	Q8EC36	GTPase Der	1.10e-02	NA	7.24e-05	NA
7. B	B1KSM7	Elongation factor Tu	2.50e-07	NA	7.79e-17	NA
7. B	B5FA79	Translation initiation factor IF-2	5.34e-04	NA	1.29e-12	NA
7. B	Q5GRY3	Elongation factor Tu 2	6.92e-08	NA	6.60e-14	NA
7. B	Q21H61	Translation initiation factor IF-2	2.56e-04	NA	8.33e-16	NA
7. B	A1T056	Elongation factor Tu	1.84e-07	NA	4.99e-13	NA
7. B	Q482Z9	Sulfate adenylyltransferase subunit 1	2.95e-06	NA	1.57e-09	NA
7. B	P42472	Elongation factor Tu (Fragment)	9.91e-07	NA	6.07e-14	NA
7. B	A1WCN6	Elongation factor Tu 2	1.88e-07	NA	2.79e-14	NA
7. B	A1KRF9	Elongation factor Tu	1.67e-07	NA	3.68e-12	NA
7. B	O31300	Elongation factor Tu (Fragment)	1.92e-08	NA	2.20e-09	NA
7. B	B8D7R4	Translation initiation factor IF-2	4.26e-04	NA	7.03e-16	NA
7. B	A8EW02	Elongation factor Tu	2.24e-07	NA	3.58e-14	NA
7. B	Q6ACZ0	Elongation factor Tu	1.83e-07	NA	3.55e-12	NA
7. B	B8DTV7	Elongation factor Tu	1.90e-07	NA	1.12e-11	NA
7. B	P84317	Elongation factor 1-alpha (Fragment)	2.09e-06	NA	1.25e-06	NA
7. B	Q2J2J9	Translation initiation factor IF-2	1.35e-04	NA	3.59e-13	NA
7. B	B8D9K1	Sulfate adenylyltransferase subunit 1	1.04e-05	NA	3.25e-10	NA
7. B	Q3J5S4	Elongation factor Tu	6.62e-08	NA	8.57e-17	NA
7. B	Q4QMT5	Elongation factor Tu 2	2.14e-07	NA	5.36e-13	NA
7. B	P57498	Sulfate adenylyltransferase subunit 1	3.33e-05	NA	1.41e-10	NA
7. B	Q8ZBP2	Sulfate adenylyltransferase subunit 1	1.88e-06	NA	1.54e-09	NA
7. B	P13927	Elongation factor Tu	1.35e-07	NA	1.27e-19	NA
7. B	A1JIH3	Elongation factor Tu 1	2.16e-07	NA	1.81e-12	NA
7. B	P16018	Elongation factor 1-alpha	2.61e-06	NA	3.56e-26	NA
7. B	Q0BND2	GTPase Der	1.57e-02	NA	1.98e-04	NA
7. B	P41203	Elongation factor 1-alpha	6.60e-06	NA	1.39e-22	NA
7. B	B2SEW7	Translation initiation factor IF-2	2.65e-04	NA	3.47e-13	NA
7. B	C0M8P7	Translation initiation factor IF-2	4.70e-04	NA	2.09e-12	NA
7. B	P69952	Elongation factor Tu	2.08e-07	NA	8.87e-12	NA
7. B	A8GSP4	Translation initiation factor IF-2	1.23e-04	NA	1.45e-11	NA
7. B	B5YHT8	Translation initiation factor IF-2	1.47e-04	NA	1.51e-15	NA
7. B	B1II49	Translation initiation factor IF-2	4.01e-05	NA	3.13e-17	NA
7. B	Q8TJT7	Translation initiation factor 2 subunit gamma	3.22e-08	NA	4.33e-11	NA
7. B	Q5HVZ7	Elongation factor Tu	2.17e-07	NA	8.68e-17	NA
7. B	Q089R8	Elongation factor Tu 1	2.36e-07	NA	6.72e-14	NA
7. B	A6VNE0	Translation initiation factor IF-2	3.50e-04	NA	2.60e-16	NA
7. B	Q54XD8	Eukaryotic translation initiation factor 2 subunit 3	6.49e-10	NA	1.59e-05	NA
7. B	Q8RA37	Translation initiation factor IF-2	3.83e-05	NA	7.84e-17	NA
7. B	Q13TF5	Elongation factor Tu	1.81e-07	NA	4.03e-16	NA
7. B	Q3YWT3	Elongation factor Tu 1	3.21e-07	NA	3.13e-12	NA
7. B	A9BCI5	Translation initiation factor IF-2	6.09e-04	NA	1.12e-14	NA
7. B	B2K2Q5	Translation initiation factor IF-2	5.16e-04	NA	1.65e-12	NA
7. B	Q5QWA3	Elongation factor Tu	2.48e-07	NA	4.64e-13	NA
7. B	B9LSM6	Translation initiation factor 2 subunit gamma	8.61e-08	NA	1.43e-07	NA
7. B	P35021	Elongation factor 1-alpha	5.51e-06	NA	1.73e-22	NA
7. B	A0QIY2	Translation initiation factor IF-2	2.45e-04	NA	2.31e-15	NA
7. B	Q134R0	Elongation factor Tu 2	1.76e-07	NA	5.29e-14	NA
7. B	A1VYI6	Elongation factor Tu	2.51e-07	NA	8.68e-17	NA
7. B	A7FW89	GTPase Der	6.65e-03	NA	2.89e-04	NA
7. B	A7MZI5	Translation initiation factor IF-2	3.48e-04	NA	1.59e-12	NA
7. B	A9KD33	Elongation factor Tu	2.22e-07	NA	1.83e-14	NA
7. B	Q1MIE3	Elongation factor Tu	6.00e-08	NA	1.36e-12	NA
7. B	Q4ZMP2	Elongation factor Tu	2.68e-07	NA	8.14e-12	NA
7. B	Q9WZV1	GTPase Era	1.07e-03	NA	0.004	NA
7. B	A8GVB2	Elongation factor Tu	1.54e-07	NA	3.91e-14	NA
7. B	Q3K302	Translation initiation factor IF-2	9.25e-04	NA	2.15e-13	NA
7. B	Q748X8	Elongation factor Tu	2.58e-07	NA	1.13e-15	NA
7. B	B1XGY0	Translation initiation factor IF-2	2.44e-04	NA	2.11e-13	NA
7. B	B0CCD0	Elongation factor Tu	1.57e-07	NA	7.26e-14	NA
7. B	B7GJ65	Elongation factor Tu	2.11e-07	NA	8.47e-17	NA
7. B	B1VET1	Elongation factor Tu	1.74e-07	NA	1.20e-09	NA
7. B	C6C171	Elongation factor Tu	1.61e-07	NA	3.85e-13	NA
7. B	Q8P7U7	Translation initiation factor IF-2	2.62e-04	NA	4.17e-12	NA
7. B	A8G8E0	Elongation factor Tu 1	2.11e-07	NA	1.70e-12	NA
7. B	B5BGJ5	Translation initiation factor IF-2	5.02e-04	NA	3.36e-13	NA
7. B	B7LR37	Translation initiation factor IF-2	5.01e-04	NA	1.79e-13	NA
7. B	Q8R603	Elongation factor Tu	1.48e-07	NA	6.53e-16	NA
7. B	B1AIV8	Translation initiation factor IF-2	2.35e-06	NA	1.51e-08	NA
7. B	A1RHQ7	GTPase Der	6.36e-03	NA	4.46e-05	NA
7. B	Q2NEL1	Elongation factor 1-alpha	2.10e-06	NA	5.08e-15	NA
7. B	B3QLF4	GTPase Der	2.80e-03	NA	0.013	NA
7. B	P86933	Elongation factor 1-alpha	3.21e-06	NA	4.25e-10	NA
7. B	Q8KH12	GTPase Der	3.38e-03	NA	1.60e-04	NA
7. B	B8DAY7	Elongation factor Tu	2.35e-07	NA	7.04e-15	NA
7. B	P75590	Translation initiation factor IF-2	3.67e-05	NA	1.10e-11	NA
7. B	A0K6X5	Translation initiation factor IF-2	5.61e-04	NA	2.99e-18	NA
7. B	Q8YP63	Elongation factor Tu	1.10e-06	NA	1.84e-11	NA
7. B	A4VHM8	Elongation factor Tu 2	2.45e-07	NA	1.64e-14	NA
7. B	A8EWR6	Sulfate adenylyltransferase subunit 1	2.03e-06	NA	2.29e-07	NA
7. B	Q64NV3	GTPase Der	7.72e-03	NA	1.82e-04	NA
7. B	A1AEU5	Sulfate adenylyltransferase subunit 1	1.99e-06	NA	2.22e-10	NA
7. B	Q8IYD1	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	5.11e-06	NA	5.82e-10	NA
7. B	Q1QEP5	Translation initiation factor IF-2	1.77e-04	NA	4.10e-18	NA
7. B	A4WEY3	Translation initiation factor IF-2	5.35e-04	NA	2.60e-15	NA
7. B	Q5L8K8	GTPase Der	8.13e-03	NA	1.82e-04	NA
7. B	A1TZQ4	GTPase Der	6.56e-03	NA	0.023	NA
7. B	Q30SS6	Translation initiation factor IF-2	1.69e-04	NA	1.27e-15	NA
7. B	Q8XZV6	Translation initiation factor IF-2	5.44e-04	NA	4.69e-18	NA
7. B	A1BJ36	Elongation factor Tu	1.84e-07	NA	4.96e-13	NA
7. B	B3PII1	Sulfate adenylyltransferase subunit 1	5.70e-06	NA	3.80e-10	NA
7. B	Q3IJV1	Elongation factor Tu 2	2.10e-07	NA	1.01e-12	NA
7. B	B4RV85	GTPase Der	1.39e-02	NA	2.94e-06	NA
7. B	B4T461	Sulfate adenylyltransferase subunit 1	1.81e-06	NA	4.22e-10	NA
7. B	P54959	Elongation factor 1-alpha	3.34e-07	NA	3.35e-07	NA
7. B	Q46ZP1	Translation initiation factor IF-2	2.63e-04	NA	1.77e-20	NA
7. B	Q8TXJ4	Elongation factor 2	1.16e-08	NA	7.86e-17	NA
7. B	Q5FCW3	Putative elongation factor Tu-like protein	6.81e-09	NA	2.64e-06	NA
7. B	Q0BPG2	Translation initiation factor IF-2	1.56e-04	NA	3.51e-12	NA
7. B	B3EP63	Elongation factor Tu	2.00e-07	NA	8.44e-14	NA
7. B	Q0WL56	Elongation factor 1-alpha 3	3.19e-06	NA	1.46e-10	NA
7. B	B8GAE2	Translation initiation factor IF-2	6.31e-05	NA	8.22e-14	NA
7. B	Q82WD0	Translation initiation factor IF-2	4.17e-05	NA	6.97e-20	NA
7. B	P09591	Elongation factor Tu	1.78e-07	NA	3.95e-13	NA
7. B	C0PYN4	GTPase Der	8.22e-03	NA	5.23e-05	NA
7. B	Q9R342	Elongation factor Tu	1.86e-07	NA	1.12e-11	NA
7. B	B5FAX6	GTPase Der	2.38e-02	NA	6.81e-05	NA
7. B	A5D2S0	Translation initiation factor IF-2	2.78e-04	NA	2.18e-17	NA
7. B	P22679	Elongation factor Tu	2.49e-07	NA	4.16e-15	NA
7. B	A3N246	Elongation factor Tu	1.73e-07	NA	2.60e-12	NA
7. B	A1VAK4	Elongation factor Tu	1.67e-07	NA	1.14e-13	NA
7. B	Q8EWU0	Translation initiation factor IF-2	2.82e-05	NA	7.97e-07	NA
7. B	Q3KI84	Translation initiation factor IF-2	3.93e-04	NA	1.19e-20	NA
7. B	A6LPP6	Elongation factor Tu	2.11e-07	NA	2.23e-16	NA
7. B	Q31GK5	Translation initiation factor IF-2	2.49e-04	NA	1.22e-11	NA
7. B	A3CTG3	Elongation factor 1-alpha	1.80e-06	NA	3.74e-17	NA
7. B	Q1R5U4	Elongation factor Tu 2	3.24e-07	NA	3.43e-12	NA
7. B	Q039K9	Elongation factor Tu	2.26e-07	NA	1.99e-16	NA
7. B	C3PPA9	Elongation factor Tu	1.73e-07	NA	4.57e-17	NA
7. B	B1LFS0	Translation initiation factor IF-2	4.63e-04	NA	2.05e-13	NA
7. B	B0TM14	Elongation factor Tu	2.91e-07	NA	7.79e-15	NA
7. B	B6I6E1	Sulfate adenylyltransferase subunit 1	1.75e-06	NA	2.34e-10	NA
7. B	B1ICR4	Elongation factor Tu	2.41e-07	NA	3.06e-12	NA
7. B	Q0ABH7	Elongation factor Tu	1.82e-07	NA	6.49e-13	NA
7. B	B1LBP2	Elongation factor Tu	2.51e-07	NA	2.35e-14	NA
7. B	A7MWE9	Sulfate adenylyltransferase subunit 1	2.37e-06	NA	9.62e-10	NA
7. B	A4J5X2	Translation initiation factor IF-2	2.96e-04	NA	2.78e-17	NA
7. B	P60338	Elongation factor Tu-A	1.89e-07	NA	3.83e-15	NA
7. B	Q8PZA0	Translation initiation factor 2 subunit gamma	1.61e-08	NA	3.73e-11	NA
7. B	B0K8N3	GTPase Der	4.92e-03	NA	0.013	NA
7. B	A6TWJ8	Elongation factor Tu 2	2.90e-07	NA	5.14e-08	NA
7. B	Q7VLI2	Translation initiation factor IF-2	3.30e-04	NA	2.79e-16	NA
7. B	Q0T0B3	Translation initiation factor IF-2	4.72e-04	NA	2.13e-13	NA
7. B	P14865	Elongation factor 1-alpha	1.18e-05	NA	1.09e-09	NA
7. B	B0RU84	Elongation factor Tu 1	2.07e-07	NA	2.34e-15	NA
7. B	B8E6N2	Translation initiation factor IF-2	4.81e-04	NA	3.75e-18	NA
7. B	B8ELG5	Elongation factor Tu	1.59e-07	NA	1.24e-11	NA
7. B	P9WKK1	Translation initiation factor IF-2	1.08e-04	NA	1.97e-15	NA
7. B	B1MY04	Elongation factor Tu	2.29e-07	NA	1.29e-12	NA
7. B	A7FZ71	Elongation factor Tu	2.43e-07	NA	7.05e-17	NA
7. B	Q03FS3	Translation initiation factor IF-2	8.01e-04	NA	1.48e-14	NA
7. B	A3QCG6	GTPase Der	1.84e-02	NA	3.54e-05	NA
7. B	B3WE38	Elongation factor Tu	2.17e-07	NA	1.99e-16	NA
7. B	B5EI57	Translation initiation factor IF-2	3.97e-04	NA	1.67e-14	NA
7. B	A6VCK1	Translation initiation factor IF-2	3.53e-04	NA	1.24e-17	NA
7. B	P0CT53	Elongation factor 1-alpha-A	3.50e-06	NA	9.73e-08	NA
7. B	B2G6R2	Elongation factor Tu	2.58e-07	NA	9.94e-14	NA
7. B	O26361	Translation initiation factor 2 subunit gamma	2.14e-08	NA	4.41e-12	NA
7. B	C1FS59	Translation initiation factor IF-2	3.87e-05	NA	3.93e-17	NA
7. B	Q6B8S2	Translation initiation factor IF-2, chloroplastic	1.05e-04	NA	3.92e-11	NA
7. B	B0KHX8	Translation initiation factor IF-2	3.94e-04	NA	1.16e-18	NA
7. B	Q1AW55	Translation initiation factor IF-2	5.79e-05	NA	6.95e-17	NA
7. B	Q4FVL5	Translation initiation factor IF-2	4.05e-04	NA	1.50e-17	NA
7. B	A8FKQ5	Elongation factor Tu	2.11e-07	NA	8.68e-17	NA
7. B	P34811	Elongation factor G-1, chloroplastic	3.33e-16	NA	1.65e-13	NA
7. B	A5D5K0	Elongation factor Tu 1	2.35e-07	NA	2.03e-17	NA
7. B	A0Q874	Elongation factor Tu	1.70e-07	NA	4.86e-14	NA
7. B	A4WKK8	Elongation factor 1-alpha	2.13e-06	NA	4.68e-13	NA
7. B	P49410	Elongation factor Tu, mitochondrial	3.19e-07	NA	5.43e-13	NA
7. B	A9N205	GTPase Der	5.25e-03	NA	4.96e-05	NA
7. B	B9KEV0	Translation initiation factor IF-2	1.20e-04	NA	9.65e-13	NA
7. B	O66429	Elongation factor Tu	1.69e-07	NA	7.64e-16	NA
7. B	Q39Y08	Elongation factor Tu	2.19e-07	NA	8.73e-13	NA
7. B	Q8ZJB2	Elongation factor Tu-A	2.11e-07	NA	2.23e-12	NA
7. B	Q0HX53	GTPase Der	1.42e-02	NA	7.38e-05	NA
7. B	A8GW31	Translation initiation factor IF-2	2.42e-04	NA	1.12e-12	NA
7. B	Q2J728	Translation initiation factor IF-2	3.84e-04	NA	3.10e-08	NA
7. B	B1HMZ0	Elongation factor Tu	1.84e-07	NA	1.65e-13	NA
7. B	Q1CCT9	Elongation factor Tu 2	2.03e-07	NA	2.23e-12	NA
7. B	C4ZZQ5	Sulfate adenylyltransferase subunit 1	1.84e-06	NA	2.13e-10	NA
7. B	Q1IFW8	Elongation factor Tu	2.55e-07	NA	1.58e-13	NA
7. B	A0KJ48	GTPase Der	6.49e-03	NA	0.002	NA
7. B	P42475	Elongation factor Tu	1.42e-07	NA	8.05e-16	NA
7. B	P85834	Elongation factor Tu, mitochondrial	4.63e-07	NA	4.17e-14	NA
7. B	Q97I51	Translation initiation factor IF-2	3.34e-05	NA	3.18e-14	NA
7. B	Q9KTW7	GTPase Der	3.23e-03	NA	1.30e-05	NA
7. B	A3N8V8	Translation initiation factor IF-2	5.83e-04	NA	1.65e-17	NA
7. B	Q98R05	Translation initiation factor IF-2	1.64e-05	NA	2.31e-13	NA
7. B	Q1GVI9	Translation initiation factor IF-2	1.08e-04	NA	4.09e-11	NA
7. B	Q049V5	Translation initiation factor IF-2	7.10e-05	NA	1.74e-14	NA
7. B	Q04ZJ5	Translation initiation factor IF-2	1.31e-04	NA	5.76e-14	NA
7. B	P41091	Eukaryotic translation initiation factor 2 subunit 3	3.70e-08	NA	7.78e-04	NA
7. B	Q0AUG3	Elongation factor Tu 2	1.95e-07	NA	3.61e-15	NA
7. B	B1JDW6	Elongation factor Tu	2.79e-07	NA	1.78e-13	NA
7. B	B6I583	GTPase Der	8.25e-03	NA	1.06e-04	NA
7. B	Q31IY4	Elongation factor Tu	1.79e-07	NA	1.64e-11	NA
7. B	O60841	Eukaryotic translation initiation factor 5B	3.78e-03	NA	4.21e-05	NA
7. B	B5RDQ7	Sulfate adenylyltransferase subunit 1	2.23e-06	NA	3.86e-10	NA
7. B	B1LNG6	GTPase Der	9.21e-03	NA	1.01e-04	NA
7. B	P26751	Elongation factor 1-alpha	6.22e-07	NA	3.43e-14	NA
7. B	C4Z2R9	Elongation factor Tu	2.62e-07	NA	1.86e-14	NA
7. B	Q6G9U4	Translation initiation factor IF-2	1.14e-04	NA	1.42e-14	NA
7. B	Q83HG7	Translation initiation factor IF-2	7.91e-05	NA	5.25e-15	NA
7. B	Q57JH9	Translation initiation factor IF-2	5.05e-04	NA	3.22e-13	NA
7. B	Q9HV55	Translation initiation factor IF-2	3.52e-04	NA	1.10e-17	NA
7. B	P68158	Elongation factor Tu, chloroplastic	2.33e-06	NA	3.89e-10	NA
7. B	Q0HNT9	Elongation factor Tu 2	2.46e-07	NA	1.87e-15	NA
7. B	Q6L202	Elongation factor 1-alpha	3.71e-06	NA	1.89e-19	NA
7. B	Q2IXR2	Elongation factor Tu	1.67e-07	NA	2.42e-13	NA
7. B	Q5L3Z9	Elongation factor Tu	1.46e-07	NA	6.04e-15	NA
7. B	P13442	Bifunctional enzyme NodQ	2.27e-04	NA	2.32e-09	NA
7. B	Q73PN3	Elongation factor Tu	2.03e-07	NA	1.38e-12	NA
7. B	Q2GFN6	Elongation factor Tu	1.80e-07	NA	3.24e-12	NA
7. B	C1A8T3	GTPase Der	3.74e-03	NA	0.013	NA
7. B	P33171	Elongation factor Tu	1.08e-06	NA	2.86e-12	NA
7. B	A8ANW5	Sulfate adenylyltransferase subunit 1	2.25e-06	NA	6.03e-10	NA
7. B	B3ELN8	Translation initiation factor IF-2	1.55e-04	NA	1.47e-13	NA
7. B	C0MDY5	Translation initiation factor IF-2	8.49e-04	NA	1.73e-12	NA
7. B	Q8LPC4	Elongation factor 1-alpha	2.31e-06	NA	3.76e-10	NA
7. B	Q5HB61	Translation initiation factor IF-2	6.67e-05	NA	2.54e-13	NA
7. B	Q83BS1	Translation initiation factor IF-2	1.80e-04	NA	4.98e-15	NA
7. B	Q5XAH1	Translation initiation factor IF-2	9.47e-04	NA	2.88e-12	NA
7. B	Q4L3K9	Elongation factor Tu	1.63e-07	NA	2.28e-14	NA
7. B	Q8F7K1	Translation initiation factor IF-2	1.93e-04	NA	6.21e-13	NA
7. B	Q88QN7	Elongation factor Tu-B	2.93e-07	NA	1.58e-13	NA
7. B	A5W987	Translation initiation factor IF-2	3.97e-04	NA	1.14e-18	NA
7. B	Q9KU80	Translation initiation factor IF-2	5.25e-04	NA	6.45e-13	NA
7. B	A8G1F0	Elongation factor Tu	2.61e-07	NA	1.01e-14	NA
7. B	A8GYW2	Elongation factor Tu	2.79e-07	NA	4.91e-14	NA
7. B	Q0TA85	Elongation factor Tu 2	3.31e-07	NA	3.43e-12	NA
7. B	B0UV21	Elongation factor Tu	2.10e-07	NA	8.94e-13	NA
7. B	B6JET1	Elongation factor Tu	1.60e-07	NA	5.87e-12	NA
7. B	Q06SH3	Elongation factor Tu, chloroplastic	4.04e-07	NA	2.05e-11	NA
7. B	Q8R5Z1	Translation initiation factor IF-2	5.79e-05	NA	2.12e-14	NA
7. B	A5ISF3	Translation initiation factor IF-2	1.14e-04	NA	1.47e-14	NA
7. B	A5VXN3	Elongation factor Tu	2.74e-07	NA	1.78e-13	NA
7. B	Q6AP86	Elongation factor Tu 1	2.27e-07	NA	1.39e-15	NA
7. B	C1CUQ9	Translation initiation factor IF-2	1.97e-05	NA	1.80e-13	NA
7. B	Q07V78	Translation initiation factor IF-2	1.41e-04	NA	9.49e-13	NA
7. B	Q3IUD8	Elongation factor 1-alpha	4.27e-06	NA	1.64e-24	NA
7. B	P59587	Translation initiation factor IF-2	3.47e-04	NA	2.11e-13	NA
7. B	Q1MQY8	Translation initiation factor IF-2	1.02e-03	NA	5.18e-11	NA
7. B	P25038	Translation initiation factor IF-2, mitochondrial	7.07e-05	NA	6.48e-08	NA
7. B	Q250N4	Elongation factor Tu	2.02e-07	NA	1.63e-14	NA
7. B	Q0BFY3	Translation initiation factor IF-2	5.51e-04	NA	1.58e-18	NA
7. B	Q1D7V1	Elongation factor Tu 1	1.92e-07	NA	3.03e-15	NA
7. B	P06805	Elongation factor 1-alpha	1.35e-05	NA	5.06e-10	NA
7. B	Q9Y450	HBS1-like protein	4.12e-05	NA	1.84e-12	NA
7. B	A8HTW6	Elongation factor Tu	1.74e-07	NA	1.73e-13	NA
7. B	B9IZJ2	Elongation factor Tu	1.37e-07	NA	1.08e-12	NA
7. B	Q2SDW8	GTPase Der	1.80e-03	NA	0.004	NA
7. B	Q57KJ0	Sulfate adenylyltransferase subunit 1	1.89e-06	NA	3.16e-10	NA
7. B	Q1CN86	Elongation factor Tu 1	2.17e-07	NA	2.44e-12	NA
7. B	P02991	Elongation factor Tu, chloroplastic	1.16e-06	NA	1.99e-12	NA
7. B	B3R1E4	Translation initiation factor IF-2	5.45e-04	NA	4.21e-20	NA
7. B	B5XHV3	Translation initiation factor IF-2	2.67e-04	NA	2.46e-12	NA
7. B	Q3AHW1	Translation initiation factor IF-2	7.86e-04	NA	4.78e-14	NA
7. B	Q7MGR1	Elongation factor Tu 2	2.04e-07	NA	4.96e-15	NA
7. B	Q7UZY7	Elongation factor Tu	9.55e-07	NA	1.24e-17	NA
7. B	O29663	Translation initiation factor 2 subunit gamma	3.36e-08	NA	7.08e-10	NA
7. B	B1IA80	Translation initiation factor IF-2	3.99e-04	NA	5.52e-13	NA
7. B	Q8UGK1	GTPase Era	1.58e-03	NA	0.033	NA
7. B	Q9PD78	Bifunctional enzyme CysN/CysC	2.42e-04	NA	3.08e-08	NA
7. B	Q2A515	GTPase Der	7.47e-03	NA	1.98e-04	NA
7. B	Q8R9J1	GTPase Der	2.57e-03	NA	0.002	NA
7. B	A1WXV1	Translation initiation factor IF-2	1.55e-04	NA	1.48e-12	NA
7. B	B6YQ04	Elongation factor Tu	2.10e-07	NA	4.35e-18	NA
7. B	C1DFK9	Translation initiation factor IF-2	3.39e-04	NA	4.68e-17	NA
7. B	Q9YAV0	Elongation factor 1-alpha	1.42e-05	NA	4.24e-19	NA
7. B	B4T6Z8	Translation initiation factor IF-2	5.06e-04	NA	3.79e-13	NA
7. B	B2VG01	Sulfate adenylyltransferase subunit 1	2.29e-06	NA	6.24e-11	NA
7. B	P65133	Translation initiation factor IF-2	1.14e-04	NA	1.47e-14	NA
7. B	Q5PIW4	Elongation factor Tu	2.15e-07	NA	2.37e-12	NA
7. B	Q65SK9	Translation initiation factor IF-2	3.16e-04	NA	6.85e-16	NA
7. B	O74718	Eukaryotic peptide chain release factor GTP-binding subunit	3.87e-05	NA	1.02e-13	NA
7. B	P50256	Elongation factor 1-alpha C	1.91e-06	NA	2.74e-08	NA
7. B	A6LLL1	Elongation factor Tu	2.39e-07	NA	3.14e-16	NA
7. B	Q0ID59	Elongation factor Tu	1.16e-06	NA	4.62e-13	NA
7. B	Q69ZS7	HBS1-like protein	4.61e-05	NA	2.40e-12	NA
7. B	Q5F5Q8	Elongation factor Tu	1.65e-07	NA	3.25e-12	NA
7. B	B7HJ46	Elongation factor Tu	1.60e-07	NA	9.92e-13	NA
7. B	A9MT05	Elongation factor Tu	2.18e-07	NA	2.37e-12	NA
7. B	A7NS01	Elongation factor Tu 2	3.13e-07	NA	3.54e-13	NA
7. B	A8Z3U9	Translation initiation factor IF-2	1.15e-04	NA	1.45e-14	NA
7. B	A0Q8F3	Translation initiation factor IF-2	2.74e-04	NA	3.33e-13	NA
7. B	A1AIF3	Elongation factor Tu 2	3.21e-07	NA	3.43e-12	NA
7. B	A5FJF9	Translation initiation factor IF-2	6.80e-05	NA	5.52e-14	NA
7. B	Q6MU81	Elongation factor Tu	2.42e-07	NA	3.22e-18	NA
7. B	Q5HRK4	Elongation factor Tu	1.55e-07	NA	2.81e-15	NA
7. B	Q5E768	GTPase Der	9.19e-03	NA	6.81e-05	NA
7. B	B6YW69	Translation initiation factor 2 subunit gamma	2.33e-08	NA	3.08e-17	NA
7. B	C3PKP2	Elongation factor Tu	1.94e-07	NA	5.47e-13	NA
7. B	A9BCK0	Elongation factor Tu	1.03e-06	NA	3.86e-18	NA
7. B	A2SH40	Translation initiation factor IF-2	2.46e-04	NA	7.51e-17	NA
7. B	A5USJ1	Elongation factor Tu 1	2.90e-07	NA	5.98e-14	NA
7. B	A4IXZ5	Sulfate adenylyltransferase subunit 1	1.93e-05	NA	9.99e-09	NA
7. B	Q96WZ1	Elongation factor 1-alpha	3.69e-06	NA	6.07e-08	NA
7. B	Q5WLR4	Elongation factor Tu	1.55e-07	NA	5.90e-16	NA
7. B	A6LE88	Elongation factor Tu	1.93e-07	NA	6.11e-17	NA
7. B	Q28WF7	Translation initiation factor IF-2	9.61e-05	NA	1.49e-13	NA
7. B	Q055E6	Elongation factor Tu	2.15e-07	NA	8.54e-10	NA
7. B	C5C0J3	Elongation factor Tu	2.60e-07	NA	1.66e-15	NA
7. B	A2BYN4	Elongation factor Tu	1.01e-06	NA	5.77e-18	NA
7. B	Q31XB3	Sulfate adenylyltransferase subunit 1	1.77e-06	NA	2.28e-10	NA
7. B	A8F4Q9	Elongation factor Tu	2.31e-07	NA	8.54e-14	NA
7. B	Q0C441	GTPase Der	7.13e-03	NA	0.012	NA
7. B	Q39KI2	Elongation factor Tu	1.72e-07	NA	6.70e-16	NA
7. B	Q8CST4	Translation initiation factor IF-2	1.23e-04	NA	6.34e-15	NA
7. B	A5ULM5	Elongation factor 1-alpha	2.34e-06	NA	6.23e-20	NA
7. B	Q07KJ2	Elongation factor Tu	1.69e-07	NA	1.37e-13	NA
7. B	Q49X54	Translation initiation factor IF-2	1.10e-04	NA	6.16e-16	NA
7. B	Q3YRK7	Elongation factor Tu	2.00e-07	NA	1.25e-11	NA
7. B	P64027	Elongation factor Tu	1.72e-07	NA	3.68e-12	NA
7. B	A8H249	GTPase Der	9.55e-03	NA	0.001	NA
7. B	B4RTW4	Sulfate adenylyltransferase subunit 1	3.72e-06	NA	1.09e-09	NA
7. B	B2SFC9	Elongation factor Tu	2.07e-07	NA	4.86e-14	NA
7. B	B3EUG6	Translation initiation factor IF-2	1.94e-04	NA	3.07e-11	NA
7. B	Q9TLV8	Elongation factor Tu, chloroplastic	1.81e-07	NA	7.21e-12	NA
7. B	Q8PJ55	Translation initiation factor IF-2	2.39e-04	NA	3.64e-11	NA
7. B	B2TXT6	GTPase Der	1.09e-02	NA	1.09e-04	NA
7. B	Q74IS8	Translation initiation factor IF-2	3.91e-05	NA	1.88e-18	NA
7. B	Q8Y422	Elongation factor Tu	2.46e-07	NA	4.01e-14	NA
7. B	A5ELM9	Elongation factor Tu	1.65e-07	NA	2.40e-12	NA
7. B	A5FQQ5	Elongation factor Tu	1.17e-06	NA	6.36e-13	NA
7. B	Q9KUZ6	Elongation factor Tu-B	2.03e-07	NA	1.53e-16	NA
7. B	Q30TQ5	Elongation factor Tu	2.00e-07	NA	3.02e-17	NA
7. B	Q8UE16	Elongation factor Tu	5.92e-08	NA	1.13e-12	NA
7. B	A4J3P1	GTPase Der	7.80e-03	NA	0.030	NA
7. B	A6T3K6	Elongation factor Tu	2.02e-07	NA	9.91e-15	NA
7. B	Q8D2X6	Translation initiation factor IF-2	2.64e-04	NA	9.33e-11	NA
7. B	A5VR08	Elongation factor Tu	6.57e-08	NA	1.07e-13	NA
7. B	Q8DK04	Translation initiation factor IF-2	2.54e-04	NA	1.20e-15	NA
7. B	Q6GHG6	Translation initiation factor IF-2	1.11e-04	NA	1.45e-14	NA
7. B	Q030K2	Translation initiation factor IF-2	2.73e-04	NA	6.32e-15	NA
7. B	C4LL63	Elongation factor Tu	2.06e-07	NA	4.87e-13	NA
7. B	A5VTB2	Translation initiation factor IF-2	2.75e-04	NA	7.98e-13	NA
7. B	Q5PBH1	Elongation factor Tu	2.23e-07	NA	1.09e-10	NA
7. B	Q8TRC4	Elongation factor 1-alpha	1.14e-06	NA	3.22e-23	NA
7. B	Q0AFJ3	Translation initiation factor IF-2	1.89e-04	NA	7.31e-19	NA
7. B	B8DLL9	Elongation factor Tu	1.73e-07	NA	1.93e-13	NA
7. B	Q02FS8	Translation initiation factor IF-2	3.68e-04	NA	1.12e-17	NA
7. B	P0A6N3	Elongation factor Tu	3.22e-07	NA	3.43e-12	NA
7. B	B0K9Q0	Translation initiation factor IF-2	3.22e-05	NA	2.89e-16	NA
7. B	Q9UZK7	Probable translation initiation factor IF-2	1.39e-03	NA	0.024	NA
7. B	B8DG02	Translation initiation factor IF-2	3.69e-04	NA	5.67e-18	NA
7. B	Q0T1I2	Sulfate adenylyltransferase subunit 1	1.70e-06	NA	2.18e-10	NA
7. B	Q3B1Z8	Translation initiation factor IF-2	1.28e-04	NA	1.10e-14	NA
7. B	P29542	Elongation factor Tu-1	1.61e-07	NA	3.35e-15	NA
7. B	B0K1D6	Translation initiation factor IF-2	9.85e-05	NA	7.77e-16	NA
7. B	Q8XJR8	Translation initiation factor IF-2	5.06e-05	NA	1.60e-13	NA
7. B	Q5M5I8	Elongation factor Tu	2.22e-07	NA	2.28e-13	NA
7. B	B7IT17	Elongation factor Tu	1.55e-07	NA	6.87e-13	NA
7. B	B3PDM5	GTPase Der	1.13e-02	NA	0.002	NA
7. B	Q7TT91	Elongation factor Tu	2.39e-07	NA	8.78e-17	NA
7. B	A1ST27	Sulfate adenylyltransferase subunit 1	3.84e-06	NA	2.03e-07	NA
7. B	B9LBJ2	Translation initiation factor IF-2	5.65e-05	NA	9.05e-14	NA
7. B	Q9TMM9	Elongation factor Tu, apicoplast	2.54e-07	NA	1.27e-13	NA
7. B	A8YV35	GTPase Der	5.26e-03	NA	0.003	NA
7. B	Q4URD7	Elongation factor Tu 1	2.06e-07	NA	2.72e-14	NA
7. B	Q3J9B6	Translation initiation factor IF-2	3.33e-04	NA	7.57e-18	NA
7. B	Q2JMX7	Elongation factor Tu	1.10e-06	NA	2.91e-09	NA
7. B	Q2HJN6	Elongation factor 1-alpha 3	6.17e-06	NA	1.73e-07	NA
7. B	Q10251	Eukaryotic translation initiation factor 5B	1.29e-03	NA	2.33e-06	NA
7. B	B7N699	GTPase Der	6.76e-03	NA	1.01e-04	NA
7. B	A4IW92	Elongation factor Tu	1.64e-07	NA	4.86e-14	NA
7. B	A4VXH3	Translation initiation factor IF-2	8.45e-04	NA	1.33e-13	NA
7. B	Q2G8Y2	Elongation factor Tu	1.28e-07	NA	4.05e-15	NA
7. B	A6WHR4	Elongation factor Tu	2.52e-07	NA	2.39e-13	NA
7. B	Q5R797	Eukaryotic translation initiation factor 2 subunit 3	7.13e-10	NA	7.39e-04	NA
7. B	Q46WC7	Elongation factor Tu	1.86e-07	NA	3.70e-15	NA
7. B	B4S4S6	Translation initiation factor IF-2	1.73e-04	NA	4.16e-13	NA
7. B	A7HM54	Elongation factor Tu	2.83e-07	NA	4.71e-14	NA
7. B	Q5LIN1	Translation initiation factor IF-2	3.56e-04	NA	2.03e-11	NA
7. B	Q8PUR8	Elongation factor 1-alpha	1.10e-06	NA	4.15e-17	NA
7. B	B0S1E5	Translation initiation factor IF-2	1.83e-04	NA	7.94e-14	NA
7. B	Q1IF43	Translation initiation factor IF-2	4.12e-04	NA	1.90e-18	NA
7. B	Q0TEX4	GTPase Der	1.06e-02	NA	1.07e-04	NA
7. B	A5U071	Elongation factor Tu	2.07e-07	NA	1.57e-13	NA
7. B	A6VGV6	Elongation factor 1-alpha	2.48e-06	NA	9.14e-14	NA
7. B	Q9HGI7	Eukaryotic peptide chain release factor GTP-binding subunit	2.10e-05	NA	1.62e-08	NA
7. B	Q1JCT6	Elongation factor Tu	2.75e-07	NA	2.65e-10	NA
7. B	Q975N8	Translation initiation factor 2 subunit gamma	1.41e-07	NA	2.79e-12	NA
7. B	Q2GA15	GTPase Der	5.43e-03	NA	0.002	NA
7. B	Q04U31	Translation initiation factor IF-2	1.14e-04	NA	4.56e-14	NA
7. B	Q661E5	Elongation factor Tu	1.22e-07	NA	1.36e-13	NA
7. B	Q1C2U1	Elongation factor Tu 1	2.11e-07	NA	2.23e-12	NA
7. B	Q089Q6	Elongation factor Tu 2	2.54e-07	NA	6.72e-14	NA
7. B	B1IUS8	Sulfate adenylyltransferase subunit 1	1.82e-06	NA	2.14e-10	NA
7. B	A5VCZ5	Translation initiation factor IF-2	1.02e-04	NA	6.35e-09	NA
7. B	A6QBQ5	Translation initiation factor IF-2	2.17e-04	NA	3.17e-16	NA
7. B	P0A6P5	GTPase Der	8.64e-03	NA	1.06e-04	NA
7. B	A0RUM4	Elongation factor 1-alpha	5.76e-06	NA	8.87e-13	NA
7. B	A8IG20	Translation initiation factor IF-2	4.57e-04	NA	1.84e-12	NA
7. B	C3LSP8	Translation initiation factor IF-2	4.01e-04	NA	6.45e-13	NA
7. B	Q3APH1	Elongation factor Tu	1.77e-07	NA	7.03e-12	NA
7. B	Q12WT3	Elongation factor 1-alpha	1.50e-06	NA	1.19e-19	NA
7. B	Q3MBZ7	Translation initiation factor IF-2	4.44e-04	NA	6.14e-14	NA
7. B	B6ELP3	Sulfate adenylyltransferase subunit 1	3.87e-06	NA	6.40e-10	NA
7. B	P40174	Elongation factor Tu-1	1.55e-07	NA	1.49e-13	NA
7. B	Q1J7N4	Elongation factor Tu	2.14e-07	NA	8.56e-12	NA
7. B	A1TSK3	Translation initiation factor IF-2	4.91e-04	NA	2.68e-17	NA
7. B	A5CCA0	Elongation factor Tu 1	1.42e-07	NA	2.49e-18	NA
7. B	A8GNW1	Translation initiation factor IF-2	1.14e-04	NA	1.14e-14	NA
7. B	A7NEI8	Translation initiation factor IF-2	2.66e-04	NA	2.68e-13	NA
7. B	Q8BFR5	Elongation factor Tu, mitochondrial	4.89e-07	NA	1.16e-14	NA
7. B	Q01SX2	Elongation factor Tu	1.61e-07	NA	2.04e-16	NA
7. B	P15170	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A	1.81e-05	NA	4.20e-09	NA
7. B	B2GUV7	Eukaryotic translation initiation factor 5B	6.65e-03	NA	9.07e-05	NA
7. B	Q5M101	Elongation factor Tu	2.23e-07	NA	2.28e-13	NA
7. B	P17245	Elongation factor Tu, cyanelle	1.28e-06	NA	5.59e-12	NA
7. B	A5F3E6	GTPase Der	7.15e-03	NA	1.30e-05	NA
7. B	P32769	Elongation factor 1 alpha-like protein	2.32e-05	NA	3.13e-10	NA
7. B	Q5QTY8	Translation initiation factor IF-2	5.18e-04	NA	8.67e-15	NA
7. B	P28295	Elongation factor 1-alpha	1.11e-05	NA	2.93e-11	NA
7. B	P35450	Elongation factor G, chloroplastic (Fragment)	2.14e-08	NA	6.96e-14	NA
7. B	Q6KI66	Elongation factor Tu	2.19e-07	NA	1.39e-16	NA
7. B	P48865	Elongation factor Tu	1.83e-07	NA	1.89e-16	NA
7. B	A4XZ92	Elongation factor Tu	2.40e-07	NA	2.21e-14	NA
7. B	B7UHH0	Sulfate adenylyltransferase subunit 1	1.75e-06	NA	2.40e-10	NA
7. B	Q1LI13	Elongation factor Tu	1.83e-07	NA	3.80e-15	NA
7. B	Q92GW4	Elongation factor Tu	1.80e-07	NA	1.28e-16	NA
7. B	B5FTS9	Sulfate adenylyltransferase subunit 1	1.29e-06	NA	3.86e-10	NA
7. B	Q8KFT1	Translation initiation factor IF-2	1.44e-04	NA	3.62e-14	NA
7. B	P72339	Bifunctional enzyme NodQ	2.45e-04	NA	2.05e-07	NA
7. B	A0QL35	Elongation factor Tu	2.03e-07	NA	2.13e-14	NA
7. B	Q134S7	Elongation factor Tu 1	1.68e-07	NA	6.28e-14	NA
7. B	A2BT83	Elongation factor Tu	9.79e-07	NA	1.11e-17	NA
7. B	A4T1R2	Elongation factor Tu	2.09e-07	NA	8.89e-15	NA
7. B	P27634	Elongation factor 1-alpha (Fragment)	NA	NA	8.29e-04	NA
7. B	P64025	Elongation factor Tu	7.61e-08	NA	1.07e-13	NA
7. B	Q5X873	Elongation factor Tu	1.94e-07	NA	4.33e-11	NA
7. B	P19486	Elongation factor 1-alpha	1.23e-05	NA	3.21e-16	NA
7. B	A9W4X1	Sulfate adenylyltransferase subunit 1	2.88e-06	NA	1.15e-08	NA
7. B	B4RXT8	Translation initiation factor IF-2	5.38e-04	NA	9.51e-19	NA
7. B	P29544	Elongation factor Tu-3	4.06e-07	NA	2.28e-14	NA
7. B	A1TYJ5	Elongation factor Tu	2.08e-07	NA	2.94e-15	NA
7. B	Q17WQ8	Translation initiation factor IF-2	5.57e-04	NA	3.01e-15	NA
7. B	A1AGM6	Elongation factor Tu 1	3.36e-07	NA	3.13e-12	NA
7. B	Q7MXE4	Translation initiation factor IF-2	2.77e-04	NA	3.11e-13	NA
7. B	Q1Q8P2	Elongation factor Tu	2.58e-07	NA	1.05e-11	NA
7. B	A0LHL8	Translation initiation factor IF-2	3.17e-04	NA	1.36e-14	NA
7. B	B2USN4	Translation initiation factor IF-2	6.15e-04	NA	4.13e-15	NA
7. B	Q8R7V2	Elongation factor Tu-A	1.80e-07	NA	3.10e-13	NA
7. B	Q5L0I8	Translation initiation factor IF-2	2.52e-04	NA	3.43e-15	NA
7. B	Q8U082	Translation initiation factor 2 subunit gamma	2.48e-08	NA	5.31e-13	NA
7. B	B0TQA2	Translation initiation factor IF-2	5.13e-04	NA	7.90e-16	NA
7. B	A7GG06	Translation initiation factor IF-2	4.00e-05	NA	6.21e-15	NA
7. B	P29543	Elongation factor Tu-2	1.78e-07	NA	2.62e-11	NA
7. B	Q4A597	Elongation factor Tu	1.85e-07	NA	5.47e-14	NA
7. B	Q814C4	Elongation factor Tu	1.65e-07	NA	9.92e-13	NA
7. B	Q3AQK7	Translation initiation factor IF-2	3.88e-04	NA	4.74e-11	NA
7. B	P64026	Elongation factor Tu	1.61e-07	NA	3.68e-12	NA
7. B	A8LLG2	Elongation factor Tu	8.13e-08	NA	6.60e-15	NA
7. B	A5FIR0	GTPase Der	3.25e-03	NA	0.007	NA