Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54700.1
JCVISYN3A_0288

Histidine--tRNA ligase.
M. mycoides homolog: P62372.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 30
Unique PROST Go: 5
Unique BLAST Go: 2
Unique Foldseek Go: 7

Total Homologs: 1726
Unique PROST Homologs: 547
Unique BLAST Homologs: 27
Unique Foldseek Homologs: 33

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: hisS; Histidine--tRNA ligase
Zhang et al. [4]: GO:0006427|histidyl-tRNA aminoacylation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q02RV6 (Histidine--tRNA ligase) with a FATCAT P-Value: 0 and RMSD of 2.18 angstrom. The sequence alignment identity is 35.6%.
Structural alignment shown in left. Query protein AVX54700.1 colored as red in alignment, homolog Q02RV6 colored as blue. Query protein AVX54700.1 is also shown in right top, homolog Q02RV6 showed in right bottom. They are colored based on secondary structures. 

  AVX54700.1 M---LQKPRGTQDFFLDEAKLWNKVETKLKEILDQFNYSEIRTPMFESKELFIRSIGSTTDIVSKEMYEFVDKKNRSLVLKPEGTASVVRAVIENKLYKE 97
      Q02RV6 MSKSLQAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGTDVVDKEMYTFLDRNGESLTMRPEGTAGCVRAVLEHGLSGG 100

  AVX54700.1 ENLPLKVYYISPMFRYERPQNGRYRQFHQLGIEVF---GSDSIQQDYEVLNIAT-KIINQFKLN--ENIKIYTNFLITGKN--REDYILELKKYLSD-F- 187
      Q02RV6 GQVQ-KLWYTGPMFRYEKPQKGRYRQFHQIGVEVFNLPGPD-I--DAELI-ILTWRLWQ--KLGMADAVTLQLNTL--GSSEARARYREALVAYLQERFE 191

  AVX54700.1 KLCNDCNTRLEKNPLRVLDCKIDDKQ--FKNVPSMQDFLTKEQ-------KTRYDQTLELFKKTNISVIHDDKLVRGLDYY--TGF--IFEIKYLNNNNE 274
      Q02RV6 QLDEDSQRRMTTNPLRILDSKVESTQALLVGAPTLHDYLDEESIAHFEGLKARLD-AVGLRYEIN------QKLVRGLDYYCRTAFEWVTD-K-LGAQG- 281

  AVX54700.1 QTIIAGGRYNNLVNEIGNINLAACGFGMGLERFINIIKEQNSSL------VNQKTNIDLYTICI--D--DL-AIELNQQILDLTRS-I-GLKADSNYYHL 361
      Q02RV6 -TVCGGGRYDGLVSQFGGKPTPGVGFAMGVERLV-LLLE---TLGVIPAELNRPA--DLY-VCAFGEPAELAALTLAEQL----RSAIPGIRLLVNAGAG 369

  AVX54700.1 SLKSALKKADKLNPKYVIILGSNEAKTNEFI----IKDQINKTQIK-TTLTKFIKYLK------ 414
      Q02RV6 SFKSQFKKADKSGARFALILGEDEV-ANRVVGFKPLRDEGEQQSIAWDALP---EHLAACLAQA 429

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0004827 proline-tRNA ligase activity
1. PBF GO:0006433 prolyl-tRNA aminoacylation
1. PBF GO:0000105 histidine biosynthetic process
1. PBF GO:0002161 aminoacyl-tRNA editing activity
1. PBF GO:0004821 histidine-tRNA ligase activity
1. PBF GO:0005737 cytoplasm
1. PBF GO:0005524 ATP binding
1. PBF GO:0046872 metal ion binding
1. PBF GO:0006427 histidyl-tRNA aminoacylation
3. BF GO:0004829 threonine-tRNA ligase activity
3. BF GO:0006435 threonyl-tRNA aminoacylation
4. PB GO:0032543 mitochondrial translation
4. PB GO:0006412 translation
4. PB GO:0003723 RNA binding
4. PB GO:0005886 plasma membrane
4. PB GO:0043906 Ala-tRNA(Pro) hydrolase activity
5. P GO:0006556 S-adenosylmethionine biosynthetic process
5. P GO:0004478 methionine adenosyltransferase activity
5. P GO:0000049 tRNA binding
5. P GO:0006730 one-carbon metabolic process
5. P GO:0070159 mitochondrial threonyl-tRNA aminoacylation
6. F GO:0006432 phenylalanyl-tRNA aminoacylation
6. F GO:0009328 phenylalanine-tRNA ligase complex
6. F GO:0008270 zinc ion binding
6. F GO:0051290 protein heterotetramerization
6. F GO:0005829 cytosol
6. F GO:0000287 magnesium ion binding
6. F GO:0004826 phenylalanine-tRNA ligase activity
7. B GO:1901342 regulation of vasculature development
7. B GO:0006418 tRNA aminoacylation for protein translation

Uniprot GO Annotations

GO Description
GO:0006412 translation
GO:0004821 histidine-tRNA ligase activity
GO:0016874 ligase activity
GO:0004812 aminoacyl-tRNA ligase activity
GO:0005524 ATP binding
GO:0005737 cytoplasm
GO:0006427 histidyl-tRNA aminoacylation
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P60917 Histidine--tRNA ligase 0.00e+00 5.53e-68 1.48e-73 0.9198
1. PBF Q160T4 Histidine--tRNA ligase 4.83e-11 2.06e-36 1.32e-06 0.7836
1. PBF A7I940 Histidine--tRNA ligase 2.26e-14 1.42e-48 3.26e-54 0.8002
1. PBF B9DNF9 Histidine--tRNA ligase 0.00e+00 6.28e-57 9.43e-92 0.949
1. PBF C3LT13 Histidine--tRNA ligase 0.00e+00 6.67e-61 4.60e-87 0.93
1. PBF A6Q9Z9 Histidine--tRNA ligase 0.00e+00 5.82e-52 2.04e-68 0.9192
1. PBF A9NGF8 Histidine--tRNA ligase 0.00e+00 8.97e-68 3.14e-79 0.9269
1. PBF Q9PJJ9 Histidine--tRNA ligase 0.00e+00 2.95e-58 2.72e-74 0.9075
1. PBF Q8FPL5 Histidine--tRNA ligase 0.00e+00 1.08e-60 1.12e-72 0.935
1. PBF Q5KWS8 Histidine--tRNA ligase 0.00e+00 1.48e-64 7.76e-101 0.9527
1. PBF Q2N5U7 Histidine--tRNA ligase 0.00e+00 3.69e-41 1.06e-62 0.8353
1. PBF Q21AX3 Histidine--tRNA ligase 2.04e-12 2.68e-31 1.19e-06 0.7605
1. PBF B7LCQ4 Histidine--tRNA ligase 0.00e+00 3.10e-61 3.99e-85 0.9493
1. PBF C4KIQ9 Histidine--tRNA ligase 0.00e+00 4.27e-59 5.30e-40 0.8032
1. PBF Q92BJ3 Histidine--tRNA ligase 0.00e+00 1.40e-60 6.97e-96 0.9469
1. PBF C0MGD4 Histidine--tRNA ligase 0.00e+00 1.26e-61 7.54e-87 0.9629
1. PBF Q9KDG2 Histidine--tRNA ligase 0.00e+00 5.27e-62 2.19e-104 0.9529
1. PBF Q5E771 Histidine--tRNA ligase 0.00e+00 8.39e-61 6.64e-83 0.9205
1. PBF C5CCH4 Histidine--tRNA ligase 4.13e-11 1.90e-50 1.18e-16 0.6915
1. PBF B5F197 Histidine--tRNA ligase 0.00e+00 2.31e-62 9.43e-85 0.9455
1. PBF Q47RX0 Histidine--tRNA ligase 3.15e-10 1.67e-44 5.17e-14 0.7353
1. PBF B5XJ83 Histidine--tRNA ligase 0.00e+00 5.33e-64 7.28e-99 0.9578
1. PBF B3R1K1 Histidine--tRNA ligase 0.00e+00 1.63e-44 6.44e-80 0.9426
1. PBF B8ER30 Histidine--tRNA ligase 3.24e-11 1.04e-35 1.22e-09 0.7403
1. PBF B2TXT9 Histidine--tRNA ligase 0.00e+00 1.30e-61 3.66e-85 0.9279
1. PBF A4JEN9 Histidine--tRNA ligase 0.00e+00 2.01e-53 3.55e-79 0.9449
1. PBF A9F907 Histidine--tRNA ligase 0.00e+00 1.70e-53 3.45e-75 0.9118
1. PBF Q3IWD2 Histidine--tRNA ligase 4.05e-11 7.78e-41 8.16e-09 0.7701
1. PBF A0PPE8 Histidine--tRNA ligase 0.00e+00 4.74e-69 2.79e-69 0.9236
1. PBF Q87S15 Histidine--tRNA ligase 0.00e+00 1.51e-61 1.22e-85 0.9273
1. PBF Q3AJS6 ATP phosphoribosyltransferase regulatory subunit 9.86e-12 3.96e-30 1.38e-08 0.7159
1. PBF Q7VRR8 Histidine--tRNA ligase 0.00e+00 8.21e-59 6.20e-67 0.9444
1. PBF P62358 ATP phosphoribosyltransferase regulatory subunit 4.00e-15 1.24e-36 2.62e-24 0.7199
1. PBF A7ZDK1 Histidine--tRNA ligase 0.00e+00 2.80e-58 5.04e-73 0.9119
1. PBF A2RKS4 ATP phosphoribosyltransferase regulatory subunit 2.09e-09 4.19e-03 5.64e-17 0.6938
1. PBF Q2NIN2 Histidine--tRNA ligase 0.00e+00 4.63e-56 1.63e-82 0.9404
1. PBF Q5PBP9 Histidine--tRNA ligase 0.00e+00 8.25e-57 6.14e-62 0.9038
1. PBF A0PXP2 ATP phosphoribosyltransferase regulatory subunit 6.28e-14 3.79e-38 1.41e-13 0.7509
1. PBF B0TF88 Histidine--tRNA ligase 0.00e+00 2.47e-58 7.96e-91 0.9306
1. PBF Q4UU37 Histidine--tRNA ligase 5.20e-11 4.05e-45 1.77e-16 0.7309
1. PBF B3QQI7 Histidine--tRNA ligase 0.00e+00 1.21e-59 1.78e-69 0.9336
1. PBF Q5X519 Histidine--tRNA ligase 0.00e+00 1.20e-64 3.88e-70 0.9369
1. PBF C1EMB3 ATP phosphoribosyltransferase regulatory subunit 4.77e-15 1.11e-35 2.91e-25 0.7228
1. PBF A9N202 Histidine--tRNA ligase 0.00e+00 2.62e-62 2.40e-85 0.9439
1. PBF B7MHZ9 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.923
1. PBF Q8U431 Histidine--tRNA ligase 0.00e+00 1.09e-45 2.83e-40 0.817
1. PBF A7H477 Histidine--tRNA ligase 0.00e+00 8.88e-57 7.84e-56 0.9152
1. PBF Q14K18 Histidine--tRNA ligase 0.00e+00 2.10e-66 2.59e-86 0.9357
1. PBF B2SKP3 Histidine--tRNA ligase 6.87e-10 1.63e-45 1.37e-15 0.7377
1. PBF B1VDK9 Histidine--tRNA ligase 0.00e+00 9.58e-63 3.28e-75 0.9096
1. PBF B2GBQ9 ATP phosphoribosyltransferase regulatory subunit 1.49e-10 1.58e-29 2.60e-08 0.6973
1. PBF Q2IQF8 ATP phosphoribosyltransferase regulatory subunit 1.31e-08 3.26e-10 8.43e-08 0.6599
1. PBF C0ZZ58 Histidine--tRNA ligase 0.00e+00 1.17e-66 1.52e-72 0.9019
1. PBF B1IWE7 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9219
1. PBF Q31XX6 Histidine--tRNA ligase 0.00e+00 6.99e-62 2.02e-84 0.927
1. PBF A3DF35 Histidine--tRNA ligase 0.00e+00 1.73e-63 2.02e-86 0.9445
1. PBF Q317R4 Histidine--tRNA ligase 0.00e+00 1.43e-60 1.96e-81 0.9451
1. PBF B3QZS0 Histidine--tRNA ligase 0.00e+00 1.02e-63 1.93e-88 0.9216
1. PBF Q0BK72 Histidine--tRNA ligase 0.00e+00 1.95e-67 3.49e-87 0.9308
1. PBF B7VJT9 Histidine--tRNA ligase 0.00e+00 1.78e-64 1.52e-85 0.9271
1. PBF Q8XJ27 Histidine--tRNA ligase 0.00e+00 4.86e-60 7.94e-78 0.9405
1. PBF Q8EC33 Histidine--tRNA ligase 0.00e+00 4.32e-61 8.04e-82 0.9216
1. PBF Q2GCZ0 Histidine--tRNA ligase 0.00e+00 7.30e-64 1.41e-66 0.9171
1. PBF Q668A0 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9417
1. PBF Q827T0 Histidine--tRNA ligase 0.00e+00 1.98e-62 3.54e-75 0.9209
1. PBF A0PZW9 Histidine--tRNA ligase 0.00e+00 2.85e-64 4.67e-88 0.9309
1. PBF A2S2A3 Histidine--tRNA ligase 0.00e+00 3.76e-51 9.88e-85 0.9431
1. PBF A1V9B1 Histidine--tRNA ligase 0.00e+00 9.62e-60 1.06e-79 0.9295
1. PBF B4EZT2 Histidine--tRNA ligase 0.00e+00 4.51e-62 1.31e-82 0.9368
1. PBF A3D6V8 Histidine--tRNA ligase 0.00e+00 2.05e-60 9.54e-83 0.9255
1. PBF P60913 Histidine--tRNA ligase 0.00e+00 5.92e-64 2.78e-76 0.9302
1. PBF A7Z751 Histidine--tRNA ligase 0.00e+00 1.53e-66 2.40e-97 0.9527
1. PBF Q1XDD9 Histidine--tRNA ligase, chloroplastic 0.00e+00 5.61e-55 1.16e-82 0.9437
1. PBF Q0AB56 ATP phosphoribosyltransferase regulatory subunit 5.09e-11 1.26e-20 5.80e-07 0.6831
1. PBF Q886Y9 Histidine--tRNA ligase 0.00e+00 2.18e-63 2.85e-78 0.9056
1. PBF Q4A5X2 Histidine--tRNA ligase 0.00e+00 1.14e-20 2.05e-52 0.8791
1. PBF Q8F9Y3 Histidine--tRNA ligase 9.44e-15 1.13e-53 3.10e-35 0.7992
1. PBF Q8PLH2 Histidine--tRNA ligase 5.75e-11 4.25e-47 1.71e-14 0.7211
1. PBF Q1CK90 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9419
1. PBF Q87C26 Histidine--tRNA ligase 2.18e-11 2.90e-45 4.65e-17 0.7257
1. PBF B2SXS9 Histidine--tRNA ligase 0.00e+00 4.38e-52 2.49e-80 0.9467
1. PBF B0K732 ATP phosphoribosyltransferase regulatory subunit 3.20e-13 6.24e-27 4.44e-26 0.7232
1. PBF P62351 Histidine--tRNA ligase 0.00e+00 1.59e-61 3.17e-69 0.9342
1. PBF Q8DHP7 Histidine--tRNA ligase 0.00e+00 3.22e-54 1.82e-91 0.9365
1. PBF Q24US1 Histidine--tRNA ligase 0.00e+00 9.38e-60 1.32e-95 0.9527
1. PBF P56194 Histidine--tRNA ligase 0.00e+00 4.67e-57 6.98e-65 0.9187
1. PBF Q6D277 Histidine--tRNA ligase 0.00e+00 7.49e-64 2.68e-85 0.929
1. PBF Q88PJ6 Histidine--tRNA ligase 0.00e+00 7.99e-63 9.01e-82 0.9032
1. PBF B5XNL6 Histidine--tRNA ligase 0.00e+00 3.58e-62 1.33e-86 0.9286
1. PBF B1ILA3 ATP phosphoribosyltransferase regulatory subunit 4.08e-13 2.12e-37 9.91e-20 0.7351
1. PBF Q3BUG0 Histidine--tRNA ligase 4.15e-11 4.99e-43 5.80e-18 0.7262
1. PBF C1FKE6 Histidine--tRNA ligase 0.00e+00 1.72e-59 1.70e-90 0.9334
1. PBF B0VAI1 ATP phosphoribosyltransferase regulatory subunit 1.11e-08 1.38e-21 0.020 0.6686
1. PBF B3WEM3 Histidine--tRNA ligase 0.00e+00 2.40e-61 8.93e-99 0.9334
1. PBF Q1IEI0 Histidine--tRNA ligase 0.00e+00 2.62e-63 5.43e-79 0.9141
1. PBF A7HDB0 ATP phosphoribosyltransferase regulatory subunit 8.54e-10 8.01e-09 1.50e-09 0.6757
1. PBF Q81T64 ATP phosphoribosyltransferase regulatory subunit 4.88e-15 1.13e-35 1.65e-24 0.7062
1. PBF B3EFA6 Histidine--tRNA ligase 0.00e+00 7.80e-59 1.24e-67 0.9356
1. PBF C0RKC7 Histidine--tRNA ligase 4.33e-13 8.53e-34 1.10e-08 0.7352
1. PBF B2KBC0 Histidine--tRNA ligase 0.00e+00 1.05e-63 2.65e-78 0.9224
1. PBF P60910 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.955
1. PBF B3QII5 Histidine--tRNA ligase 5.93e-12 1.81e-31 5.92e-11 0.7528
1. PBF B3CLR6 Histidine--tRNA ligase 0.00e+00 1.36e-60 1.11e-78 0.9261
1. PBF P46696 Histidine--tRNA ligase 0.00e+00 1.44e-61 2.89e-70 0.9319
1. PBF Q5M281 Histidine--tRNA ligase 0.00e+00 4.65e-65 2.12e-90 0.9603
1. PBF Q3K7B7 Histidine--tRNA ligase 0.00e+00 2.16e-61 4.86e-81 0.9035
1. PBF B1ZUW6 Histidine--tRNA ligase 2.44e-15 7.86e-54 3.95e-28 0.809
1. PBF P30053 Histidine--tRNA ligase 0.00e+00 5.11e-60 2.77e-86 0.9628
1. PBF B0SH39 Histidine--tRNA ligase 6.66e-16 1.77e-57 8.09e-44 0.8033
1. PBF A4VZ92 Histidine--tRNA ligase 0.00e+00 1.44e-64 2.88e-103 0.9558
1. PBF B1LNG9 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9242
1. PBF B1I9T7 Histidine--tRNA ligase 0.00e+00 1.82e-64 2.13e-102 0.9647
1. PBF B7H068 Histidine--tRNA ligase 0.00e+00 7.10e-60 5.48e-80 0.9043
1. PBF A7GHS3 Histidine--tRNA ligase 0.00e+00 9.06e-58 2.64e-89 0.9306
1. PBF B4TD92 Histidine--tRNA ligase 0.00e+00 2.84e-62 1.14e-84 0.9439
1. PBF A3CVW4 Histidine--tRNA ligase 4.37e-14 3.54e-44 4.11e-45 0.798
1. PBF Q2RWE3 Histidine--tRNA ligase 0.00e+00 7.92e-66 2.26e-78 0.9342
1. PBF Q5NIL5 Histidine--tRNA ligase 0.00e+00 2.10e-66 2.59e-86 0.9396
1. PBF Q88UD8 ATP phosphoribosyltransferase regulatory subunit 1.40e-09 1.18e-26 2.95e-10 0.7133
1. PBF P59482 Histidine--tRNA ligase 0.00e+00 5.54e-67 5.60e-75 0.9491
1. PBF A4XY31 Histidine--tRNA ligase 0.00e+00 5.24e-60 3.48e-76 0.9108
1. PBF A7NEI6 Histidine--tRNA ligase 0.00e+00 1.08e-66 8.72e-87 0.9286
1. PBF Q83FF5 Probable histidine--tRNA ligase 8.44e-12 9.62e-41 2.79e-18 0.6677
1. PBF B7J168 Histidine--tRNA ligase 3.22e-13 1.64e-41 4.43e-18 0.7766
1. PBF P9WFV4 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 0.9098
1. PBF Q8RGJ5 Histidine--tRNA ligase 0.00e+00 3.23e-59 1.68e-87 0.9094
1. PBF A4IR95 Histidine--tRNA ligase 0.00e+00 1.58e-65 7.84e-101 0.9541
1. PBF A4YJ03 Histidine--tRNA ligase 8.77e-15 2.16e-57 1.88e-38 0.7851
1. PBF Q6ME90 Histidine--tRNA ligase 0.00e+00 4.09e-56 5.54e-82 0.9381
1. PBF B1AIS5 Histidine--tRNA ligase 0.00e+00 8.95e-67 6.59e-81 0.9335
1. PBF A5IN85 Histidine--tRNA ligase 0.00e+00 5.10e-68 3.71e-91 0.9423
1. PBF Q3SL69 Histidine--tRNA ligase 0.00e+00 1.18e-62 6.76e-76 0.9032
1. PBF B9MPF7 Histidine--tRNA ligase 0.00e+00 1.57e-62 1.82e-89 0.9446
1. PBF Q2GHH1 Histidine--tRNA ligase 0.00e+00 1.14e-58 1.68e-61 0.9221
1. PBF A4WIN2 Histidine--tRNA ligase 3.28e-14 3.41e-53 2.97e-31 0.7879
1. PBF Q4ZX22 Histidine--tRNA ligase 0.00e+00 1.03e-62 3.64e-79 0.9197
1. PBF A3NA53 Histidine--tRNA ligase 0.00e+00 1.37e-50 5.24e-85 0.9436
1. PBF B1L829 Histidine--tRNA ligase 0.00e+00 1.31e-67 9.31e-88 0.9425
1. PBF P67484 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 0.918
1. PBF Q2FTC5 Histidine--tRNA ligase 2.53e-14 1.83e-48 1.89e-46 0.7904
1. PBF A6WQP6 Histidine--tRNA ligase 0.00e+00 2.05e-60 9.54e-83 0.9262
1. PBF B4EAW8 Histidine--tRNA ligase 0.00e+00 9.54e-53 3.22e-80 0.9454
1. PBF A7HN13 Histidine--tRNA ligase 0.00e+00 1.11e-61 5.92e-97 0.9372
1. PBF Q2RHW0 Histidine--tRNA ligase 0.00e+00 5.35e-59 9.26e-92 0.9463
1. PBF A5GIA4 Histidine--tRNA ligase 0.00e+00 1.05e-46 1.51e-72 0.8887
1. PBF A8ZUR6 Histidine--tRNA ligase 0.00e+00 5.22e-59 1.47e-84 0.928
1. PBF B9KU51 Histidine--tRNA ligase 2.73e-11 5.54e-41 4.33e-17 0.739
1. PBF Q2JRX6 Histidine--tRNA ligase 0.00e+00 6.31e-62 1.41e-85 0.9237
1. PBF Q4A8C3 Histidine--tRNA ligase 0.00e+00 1.55e-60 3.84e-65 0.9171
1. PBF O30548 ATP phosphoribosyltransferase regulatory subunit 8.37e-11 1.78e-24 2.84e-05 0.7012
1. PBF Q3JRQ5 Histidine--tRNA ligase 0.00e+00 3.76e-51 9.88e-85 0.9429
1. PBF Q5F9G8 Histidine--tRNA ligase 0.00e+00 1.52e-59 3.24e-71 0.9354
1. PBF Q97NC9 Histidine--tRNA ligase 0.00e+00 1.12e-62 1.51e-101 0.9621
1. PBF Q3YRB1 Histidine--tRNA ligase 0.00e+00 1.67e-60 3.92e-66 0.92
1. PBF C3MRE4 Histidine--tRNA ligase 0.00e+00 4.27e-59 5.30e-40 0.7948
1. PBF Q8TS62 Histidine--tRNA ligase 1.22e-15 7.52e-50 1.62e-41 0.7758
1. PBF P62372 Histidine--tRNA ligase 0.00e+00 7.86e-103 0.0 0.9945
1. PBF A2BVT6 Histidine--tRNA ligase 0.00e+00 2.67e-58 2.16e-80 0.915
1. PBF A4SE02 Histidine--tRNA ligase 0.00e+00 2.51e-60 7.33e-73 0.9331
1. PBF Q8TV61 Histidine--tRNA ligase 4.33e-15 2.95e-53 6.62e-42 0.8142
1. PBF A1K3Z0 Histidine--tRNA ligase 0.00e+00 2.92e-54 7.04e-81 0.9474
1. PBF Q83H72 Probable histidine--tRNA ligase 1.04e-11 9.62e-41 2.79e-18 0.6785
1. PBF Q7NHZ4 ATP phosphoribosyltransferase regulatory subunit 1.29e-12 1.27e-30 2.89e-13 0.7557
1. PBF Q9HXJ5 Histidine--tRNA ligase 0.00e+00 9.33e-63 2.95e-75 0.9335
1. PBF A7X345 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9524
1. PBF Q0AE43 Histidine--tRNA ligase 0.00e+00 5.62e-64 3.64e-82 0.943
1. PBF B1WU69 ATP phosphoribosyltransferase regulatory subunit 2.59e-13 2.90e-38 3.01e-11 0.7367
1. PBF Q63UT2 Histidine--tRNA ligase 0.00e+00 1.73e-51 1.90e-84 0.9429
1. PBF A5UAB7 Histidine--tRNA ligase 0.00e+00 5.49e-59 3.16e-77 0.9408
1. PBF P60918 Histidine--tRNA ligase 0.00e+00 8.41e-59 2.45e-80 0.9336
1. PBF A4Y8T9 Histidine--tRNA ligase 0.00e+00 3.02e-61 7.51e-81 0.9316
1. PBF Q5WHP4 Histidine--tRNA ligase 1 0.00e+00 2.76e-67 4.93e-105 0.9552
1. PBF A8MGM7 Histidine--tRNA ligase 0.00e+00 3.58e-60 1.43e-100 0.9385
1. PBF B8CKR2 Histidine--tRNA ligase 0.00e+00 1.05e-61 4.39e-86 0.9039
1. PBF Q3ZAI8 Histidine--tRNA ligase 0.00e+00 3.02e-58 9.59e-82 0.9422
1. PBF Q9YEB2 Histidine--tRNA ligase 5.55e-16 5.96e-50 1.65e-25 0.7727
1. PBF Q9PPF4 Histidine--tRNA ligase 0.00e+00 1.29e-58 1.19e-57 0.9102
1. PBF B7M7L8 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9284
1. PBF Q62JW5 Histidine--tRNA ligase 0.00e+00 3.76e-51 9.88e-85 0.9463
1. PBF B2J5J5 Histidine--tRNA ligase 1.03e-12 1.29e-40 1.62e-15 0.7292
1. PBF B0JRF1 Histidine--tRNA ligase 0.00e+00 2.70e-55 2.63e-87 0.947
1. PBF A9KFU6 Histidine--tRNA ligase 0.00e+00 3.32e-60 7.15e-81 0.9309
1. PBF A8GVU9 Histidine--tRNA ligase 0.00e+00 4.07e-65 1.00e-70 0.9243
1. PBF B7JFY9 ATP phosphoribosyltransferase regulatory subunit 3.66e-15 2.14e-35 2.97e-25 0.709
1. PBF A9B9Z7 Histidine--tRNA ligase 0.00e+00 4.40e-58 8.43e-79 0.9346
1. PBF B1L6B4 Histidine--tRNA ligase 0.00e+00 6.64e-49 2.99e-26 0.7822
1. PBF C4LIW5 Histidine--tRNA ligase 0.00e+00 6.93e-64 5.64e-76 0.9081
1. PBF A7I1U5 Histidine--tRNA ligase 0.00e+00 2.67e-65 8.41e-79 0.9324
1. PBF C4LC38 Histidine--tRNA ligase 0.00e+00 5.87e-61 4.56e-77 0.9257
1. PBF B1KKJ3 Histidine--tRNA ligase 0.00e+00 4.74e-58 6.40e-84 0.9139
1. PBF Q8K9P3 Histidine--tRNA ligase 0.00e+00 4.53e-65 7.24e-83 0.9312
1. PBF B9KHM7 Histidine--tRNA ligase 0.00e+00 9.81e-57 3.47e-63 0.9088
1. PBF A6VHK3 Histidine--tRNA ligase 2.43e-13 7.11e-49 8.87e-42 0.747
1. PBF Q603B8 Histidine--tRNA ligase 0.00e+00 1.82e-64 6.05e-76 0.937
1. PBF Q99XK9 Histidine--tRNA ligase 0.00e+00 2.43e-64 2.39e-99 0.9554
1. PBF Q82XU9 Histidine--tRNA ligase 0.00e+00 1.33e-64 7.91e-79 0.9393
1. PBF Q11RN9 Histidine--tRNA ligase 6.85e-14 3.10e-45 1.27e-22 0.7907
1. PBF Q824R3 Histidine--tRNA ligase 0.00e+00 3.12e-56 1.10e-76 0.9246
1. PBF Q92E82 ATP phosphoribosyltransferase regulatory subunit 6.64e-12 2.35e-30 1.00e-15 0.7121
1. PBF Q7VC06 ATP phosphoribosyltransferase regulatory subunit 7.52e-10 4.63e-31 3.05e-12 0.6793
1. PBF C3KVW9 ATP phosphoribosyltransferase regulatory subunit 4.53e-14 4.32e-37 8.37e-20 0.7437
1. PBF B0K0N4 Histidine--tRNA ligase 0.00e+00 1.65e-62 7.38e-95 0.9444
1. PBF A0K7T5 Histidine--tRNA ligase 0.00e+00 1.24e-52 5.04e-81 0.9453
1. PBF Q038S0 Histidine--tRNA ligase 0.00e+00 2.40e-61 8.93e-99 0.9323
1. PBF Q7V4P3 Histidine--tRNA ligase 0.00e+00 9.77e-54 1.94e-74 0.936
1. PBF B9IUZ4 ATP phosphoribosyltransferase regulatory subunit 8.10e-15 1.07e-35 8.96e-25 0.708
1. PBF O84547 Histidine--tRNA ligase 0.00e+00 1.72e-59 1.98e-76 0.9021
1. PBF Q92IK8 Histidine--tRNA ligase 0.00e+00 1.36e-63 1.76e-64 0.9251
1. PBF P43823 Histidine--tRNA ligase 0.00e+00 3.80e-61 1.87e-80 0.9366
1. PBF Q6G289 Histidine--tRNA ligase 2.16e-12 1.75e-36 4.46e-17 0.7552
1. PBF Q9JUZ9 Histidine--tRNA ligase 0.00e+00 1.41e-59 3.35e-70 0.9341
1. PBF Q6G8T8 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9532
1. PBF A5N7Q4 ATP phosphoribosyltransferase regulatory subunit 4.32e-13 2.94e-30 6.52e-16 0.7217
1. PBF B1XJ88 Histidine--tRNA ligase 0.00e+00 1.01e-59 7.56e-90 0.9479
1. PBF P62373 Histidine--tRNA ligase 0.00e+00 4.18e-63 2.70e-84 0.9117
1. PBF Q38XB7 Histidine--tRNA ligase 0.00e+00 2.85e-59 5.21e-109 0.9433
1. PBF B0KPI8 Histidine--tRNA ligase 0.00e+00 7.99e-63 9.01e-82 0.906
1. PBF B8FKS7 Histidine--tRNA ligase 0.00e+00 7.95e-62 3.21e-80 0.9428
1. PBF A2C9V7 ATP phosphoribosyltransferase regulatory subunit 1.89e-11 1.07e-29 4.57e-11 0.7453
1. PBF Q6F199 Histidine--tRNA ligase 0.00e+00 6.09e-36 1.52e-138 0.966
1. PBF Q6AP31 Proline--tRNA ligase 9.83e-06 5.35e-04 0.006 0.4877
1. PBF A1RUZ2 Histidine--tRNA ligase 3.08e-14 5.68e-52 5.12e-35 0.7821
1. PBF Q6HDC2 Histidine--tRNA ligase 2 0.00e+00 1.08e-56 1.51e-103 0.9512
1. PBF A9AGZ7 Histidine--tRNA ligase 0.00e+00 1.92e-53 2.96e-80 0.9469
1. PBF B0TLI5 Histidine--tRNA ligase 0.00e+00 4.73e-60 2.16e-83 0.9135
1. PBF B1W3H3 Histidine--tRNA ligase 0.00e+00 2.80e-61 3.21e-74 0.931
1. PBF O52765 Histidine--tRNA ligase 0.00e+00 2.62e-62 2.40e-85 0.945
1. PBF P62379 Histidine--tRNA ligase 0.00e+00 3.96e-60 5.47e-80 0.9221
1. PBF A3QCG3 Histidine--tRNA ligase 0.00e+00 2.34e-61 3.47e-86 0.9157
1. PBF Q980L3 Histidine--tRNA ligase 4.55e-15 2.78e-60 1.00e-39 0.7875
1. PBF Q04WC4 Histidine--tRNA ligase 1.52e-14 1.16e-54 6.69e-34 0.7988
1. PBF C4L534 Histidine--tRNA ligase 0.00e+00 6.84e-63 2.76e-106 0.9513
1. PBF B2SCY7 Histidine--tRNA ligase 3.78e-13 6.49e-34 9.27e-09 0.7489
1. PBF Q03F51 Histidine--tRNA ligase 0.00e+00 4.58e-68 7.89e-99 0.9505
1. PBF B9DW81 Histidine--tRNA ligase 0.00e+00 1.30e-63 1.38e-92 0.9631
1. PBF A2SQI5 Histidine--tRNA ligase 1.64e-14 1.51e-46 8.07e-54 0.7967
1. PBF B0K622 ATP phosphoribosyltransferase regulatory subunit 1.94e-12 3.36e-27 4.19e-26 0.7314
1. PBF A9NDV9 Histidine--tRNA ligase 0.00e+00 3.32e-60 7.15e-81 0.9318
1. PBF B0S168 Histidine--tRNA ligase 3.44e-13 7.98e-49 3.30e-20 0.7331
1. PBF B2IWE2 ATP phosphoribosyltransferase regulatory subunit 5.61e-14 4.14e-34 6.37e-13 0.7727
1. PBF B3CTK8 Histidine--tRNA ligase 0.00e+00 2.90e-63 2.70e-63 0.9148
1. PBF A9HJ49 Histidine--tRNA ligase 0.00e+00 8.29e-65 1.11e-72 0.9016
1. PBF Q1AWC4 Histidine--tRNA ligase 0.00e+00 1.88e-62 7.50e-83 0.8959
1. PBF P74592 ATP phosphoribosyltransferase regulatory subunit 8.55e-14 1.77e-32 4.43e-13 0.7638
1. PBF A9BAD0 ATP phosphoribosyltransferase regulatory subunit 2.35e-11 4.24e-28 8.39e-09 0.7111
1. PBF C1L0J8 ATP phosphoribosyltransferase regulatory subunit 6.39e-10 2.11e-30 1.14e-13 0.6975
1. PBF P67486 Histidine--tRNA ligase 0.00e+00 1.77e-63 2.73e-93 0.9596
1. PBF A6SZW1 ATP phosphoribosyltransferase regulatory subunit 6.90e-09 2.99e-19 0.036 0.6773
1. PBF A8F593 Histidine--tRNA ligase 0.00e+00 6.35e-53 6.20e-91 0.9521
1. PBF C3MZH9 Histidine--tRNA ligase 0.00e+00 2.11e-59 1.49e-37 0.7944
1. PBF A5WGQ0 Histidine--tRNA ligase 0.00e+00 3.26e-61 7.09e-75 0.9008
1. PBF P0DG40 Histidine--tRNA ligase 0.00e+00 7.30e-64 2.01e-98 0.9576
1. PBF P67485 Histidine--tRNA ligase 0.00e+00 1.77e-63 2.73e-93 0.9602
1. PBF A5F9R5 Histidine--tRNA ligase 6.68e-13 1.64e-42 1.07e-17 0.7765
1. PBF Q9JZX9 Histidine--tRNA ligase 0.00e+00 9.76e-58 2.19e-70 0.9333
1. PBF A0RBL6 ATP phosphoribosyltransferase regulatory subunit 8.22e-15 1.11e-35 2.91e-25 0.7093
1. PBF A0RPD3 Histidine--tRNA ligase 0.00e+00 7.47e-60 2.93e-72 0.9228
1. PBF B2HWK9 ATP phosphoribosyltransferase regulatory subunit 4.91e-09 1.38e-21 0.020 0.6696
1. PBF Q47WC1 Histidine--tRNA ligase 0.00e+00 2.67e-58 1.14e-77 0.9139
1. PBF P57375 Histidine--tRNA ligase 0.00e+00 4.18e-63 4.33e-81 0.9325
1. PBF A2C182 Histidine--tRNA ligase 0.00e+00 2.58e-59 7.37e-80 0.9359
1. PBF B9MFY6 ATP phosphoribosyltransferase regulatory subunit 1.46e-10 3.54e-22 9.72e-08 0.6975
1. PBF B7MYE9 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9277
1. PBF Q1BGX3 Histidine--tRNA ligase 0.00e+00 1.24e-52 5.04e-81 0.9449
1. PBF Q3AD55 ATP phosphoribosyltransferase regulatory subunit 2.01e-10 5.71e-03 6.65e-17 0.7403
1. PBF A8GMY5 Histidine--tRNA ligase 0.00e+00 2.90e-63 2.64e-66 0.9314
1. PBF O51160 Histidine--tRNA ligase 1.79e-13 1.64e-41 4.43e-18 0.7948
1. PBF Q4JVE8 Histidine--tRNA ligase 0.00e+00 2.52e-51 4.14e-75 0.9091
1. PBF B1XPZ9 ATP phosphoribosyltransferase regulatory subunit 1.23e-13 2.31e-30 6.78e-12 0.7338
1. PBF A6X3C2 ATP phosphoribosyltransferase regulatory subunit 5.65e-07 9.42e-03 2.08e-06 0.5809
1. PBF B1YR43 Histidine--tRNA ligase 0.00e+00 1.82e-52 2.96e-80 0.9444
1. PBF B7IAF3 ATP phosphoribosyltransferase regulatory subunit 1.07e-08 1.38e-21 0.020 0.6704
1. PBF A2BQA4 Histidine--tRNA ligase 0.00e+00 2.92e-60 9.25e-84 0.9228
1. PBF B8GTN4 Histidine--tRNA ligase 0.00e+00 5.37e-60 1.09e-75 0.9362
1. PBF C6BVJ9 Histidine--tRNA ligase 0.00e+00 1.93e-62 2.20e-83 0.9139
1. PBF A6UT01 Histidine--tRNA ligase 2.58e-14 3.80e-48 1.06e-39 0.7614
1. PBF C3N7K1 Histidine--tRNA ligase 0.00e+00 3.67e-59 4.98e-40 0.7958
1. PBF B0R6V2 Histidine--tRNA ligase 1.71e-14 8.26e-53 3.09e-18 0.7462
1. PBF Q3A829 ATP phosphoribosyltransferase regulatory subunit 1.72e-13 1.79e-41 4.78e-11 0.7585
1. PBF B0TWR5 Histidine--tRNA ligase 0.00e+00 8.74e-65 2.97e-87 0.9183
1. PBF Q5L735 Histidine--tRNA ligase 0.00e+00 2.92e-52 4.23e-72 0.9153
1. PBF P62359 ATP phosphoribosyltransferase regulatory subunit 2.68e-08 2.36e-03 2.55e-06 0.6806
1. PBF Q1RIC9 Proline--tRNA ligase 1.10e-07 4.78e-09 0.017 0.489
1. PBF Q5N453 ATP phosphoribosyltransferase regulatory subunit 2.38e-13 6.21e-38 3.14e-18 0.736
1. PBF Q9PQK6 Histidine--tRNA ligase 0.00e+00 8.95e-67 6.59e-81 0.9244
1. PBF B9LRS2 Histidine--tRNA ligase 1.01e-14 9.60e-49 5.96e-34 0.7625
1. PBF Q28TV0 Histidine--tRNA ligase 2.18e-12 1.41e-40 6.97e-08 0.7377
1. PBF B7HHF9 ATP phosphoribosyltransferase regulatory subunit 1.22e-10 1.68e-36 9.88e-25 0.6825
1. PBF B4S4H1 Histidine--tRNA ligase 0.00e+00 4.76e-63 1.49e-68 0.9222
1. PBF Q7VWL1 Histidine--tRNA ligase 0.00e+00 5.33e-64 2.28e-65 0.9383
1. PBF Q3AXX8 ATP phosphoribosyltransferase regulatory subunit 1.82e-11 2.94e-30 4.86e-10 0.7327
1. PBF Q04X87 Histidine--tRNA ligase 1.42e-14 1.16e-54 6.69e-34 0.7998
1. PBF B1YCS2 Histidine--tRNA ligase 2.15e-14 3.56e-49 1.67e-35 0.7714
1. PBF C6DBH3 Histidine--tRNA ligase 0.00e+00 8.31e-64 2.38e-85 0.9322
1. PBF B4UGX0 ATP phosphoribosyltransferase regulatory subunit 1.31e-08 5.43e-11 7.23e-08 0.6773
1. PBF B1IMD8 Histidine--tRNA ligase 0.00e+00 2.84e-57 6.66e-89 0.9293
1. PBF O83647 Histidine--tRNA ligase 4.13e-13 7.73e-48 1.02e-25 0.7606
1. PBF Q8KFT6 Histidine--tRNA ligase 0.00e+00 1.08e-58 7.76e-69 0.9317
1. PBF A5UGH2 Histidine--tRNA ligase 0.00e+00 1.18e-59 8.55e-78 0.939
1. PBF Q46ZI4 Histidine--tRNA ligase 0.00e+00 1.30e-41 2.38e-80 0.9393
1. PBF Q97CE6 Histidine--tRNA ligase 2.72e-12 4.97e-55 3.74e-31 0.7832
1. PBF Q043X4 Histidine--tRNA ligase 0.00e+00 1.01e-56 8.89e-93 0.9466
1. PBF Q13X29 Histidine--tRNA ligase 0.00e+00 3.19e-51 3.91e-80 0.9488
1. PBF Q7U9Q6 Histidine--tRNA ligase 0.00e+00 1.53e-57 1.02e-83 0.8992
1. PBF Q1QTK7 Histidine--tRNA ligase 0.00e+00 1.58e-58 5.55e-79 0.9089
1. PBF Q9RUN5 Histidine--tRNA ligase 0.00e+00 1.35e-54 2.27e-58 0.9279
1. PBF Q5LAE0 Histidine--tRNA ligase 3.22e-12 1.04e-42 4.78e-25 0.7262
1. PBF Q7NS89 Histidine--tRNA ligase 0.00e+00 4.98e-67 9.96e-77 0.9546
1. PBF Q7W6P7 Histidine--tRNA ligase 0.00e+00 8.76e-64 2.90e-66 0.9336
1. PBF B5R581 Histidine--tRNA ligase 0.00e+00 2.43e-62 1.65e-85 0.9462
1. PBF A7GT85 Histidine--tRNA ligase 0.00e+00 8.00e-59 7.85e-108 0.952
1. PBF A5GL51 ATP phosphoribosyltransferase regulatory subunit 3.48e-11 2.35e-31 8.27e-04 0.6963
1. PBF Q4FTW6 Histidine--tRNA ligase 0.00e+00 4.29e-55 9.06e-67 0.8987
1. PBF Q8NQ07 Histidine--tRNA ligase 0.00e+00 8.59e-62 1.47e-73 0.9282
1. PBF A9R801 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9444
1. PBF Q0TP27 Histidine--tRNA ligase 0.00e+00 1.01e-59 2.00e-77 0.9412
1. PBF A0KJ45 Histidine--tRNA ligase 0.00e+00 7.08e-65 2.58e-78 0.9337
1. PBF Q83K44 Histidine--tRNA ligase 0.00e+00 5.87e-61 3.58e-85 0.9438
1. PBF O28631 Histidine--tRNA ligase 1.61e-14 1.99e-51 5.35e-49 0.7935
1. PBF Q8CWW2 Histidine--tRNA ligase 0.00e+00 2.27e-60 1.14e-95 0.9573
1. PBF A5FSR7 Histidine--tRNA ligase 0.00e+00 2.33e-59 6.44e-82 0.9472
1. PBF Q8D1Y2 Histidine--tRNA ligase 0.00e+00 1.58e-65 1.10e-62 0.9308
1. PBF B2FPL6 Histidine--tRNA ligase 4.01e-10 1.57e-47 3.36e-19 0.7269
1. PBF A8LKA5 Histidine--tRNA ligase 1.52e-11 2.36e-39 1.25e-18 0.7586
1. PBF B0USG9 Histidine--tRNA ligase 0.00e+00 2.56e-64 1.51e-84 0.9392
1. PBF B2VE90 Histidine--tRNA ligase 0.00e+00 3.06e-63 1.67e-82 0.9289
1. PBF A1ANS7 Histidine--tRNA ligase 0.00e+00 4.19e-66 1.48e-81 0.912
1. PBF A5VTT4 Histidine--tRNA ligase 3.71e-13 1.12e-33 8.41e-09 0.7439
1. PBF Q6L1Q5 Histidine--tRNA ligase 2.22e-16 4.09e-55 1.90e-33 0.8048
1. PBF A5VYT6 Histidine--tRNA ligase 0.00e+00 7.99e-63 9.01e-82 0.9061
1. PBF P56455 Histidine--tRNA ligase 8.00e-13 2.52e-49 2.84e-19 0.7483
1. PBF Q46LS5 Histidine--tRNA ligase 0.00e+00 1.91e-56 2.00e-79 0.9289
1. PBF Q3A5R6 Histidine--tRNA ligase 0.00e+00 1.75e-67 2.13e-88 0.9337
1. PBF A5CEP8 Histidine--tRNA ligase 0.00e+00 1.60e-63 2.91e-62 0.9293
1. PBF Q4FND9 Histidine--tRNA ligase 7.50e-12 1.40e-44 1.54e-09 0.7639
1. PBF Q8CS98 Histidine--tRNA ligase 0.00e+00 4.00e-64 5.41e-104 0.9471
1. PBF P75069 Histidine--tRNA ligase 0.00e+00 7.20e-63 4.34e-68 0.8956
1. PBF P60921 Histidine--tRNA ligase 2.87e-12 2.83e-50 1.03e-43 0.7482
1. PBF Q8DN46 Histidine--tRNA ligase 0.00e+00 1.33e-63 4.53e-103 0.9652
1. PBF A2CCR1 Histidine--tRNA ligase 0.00e+00 4.63e-54 7.01e-75 0.9207
1. PBF Q8DMD8 ATP phosphoribosyltransferase regulatory subunit 9.26e-12 3.96e-40 3.74e-17 0.7548
1. PBF Q04I50 Histidine--tRNA ligase 0.00e+00 1.33e-63 4.53e-103 0.9557
1. PBF B1HV72 Histidine--tRNA ligase 0.00e+00 6.16e-67 2.19e-98 0.9519
1. PBF A1AWV6 Histidine--tRNA ligase 0.00e+00 6.90e-65 1.47e-74 0.9332
1. PBF Q1GJD0 Histidine--tRNA ligase 1.58e-12 6.71e-40 4.14e-17 0.7392
1. PBF Q5QYB0 Histidine--tRNA ligase 0.00e+00 5.28e-57 3.37e-87 0.9045
1. PBF B8DA56 ATP phosphoribosyltransferase regulatory subunit 6.01e-10 7.00e-31 2.72e-14 0.7037
1. PBF Q6FYU5 Histidine--tRNA ligase 3.78e-12 1.33e-37 9.42e-22 0.7194
1. PBF B5YHK1 Histidine--tRNA ligase 0.00e+00 7.66e-60 6.13e-97 0.9244
1. PBF A5FX98 Histidine--tRNA ligase 0.00e+00 4.28e-62 5.14e-75 0.9371
1. PBF P60920 Histidine--tRNA ligase 2.72e-13 2.60e-43 7.95e-26 0.7582
1. PBF C5D510 Histidine--tRNA ligase 0.00e+00 1.74e-62 2.74e-100 0.9518
1. PBF A3CR40 Histidine--tRNA ligase 0.00e+00 5.78e-58 4.22e-95 0.9619
1. PBF Q5H0L6 Histidine--tRNA ligase 3.26e-10 1.63e-45 1.37e-15 0.7189
1. PBF Q2A1H0 Histidine--tRNA ligase 0.00e+00 1.79e-66 5.37e-87 0.9371
1. PBF B9MFX7 Histidine--tRNA ligase 0.00e+00 6.67e-61 5.48e-74 0.9353
1. PBF B0U3B6 Histidine--tRNA ligase 1.51e-11 3.87e-45 2.49e-17 0.7224
1. PBF A4G0V7 Histidine--tRNA ligase 1.64e-12 1.72e-47 2.23e-42 0.7476
1. PBF Q97FJ7 Histidine--tRNA ligase 7.37e-14 4.16e-47 1.83e-29 0.7451
1. PBF B8HUL5 ATP phosphoribosyltransferase regulatory subunit 2.95e-12 7.59e-36 3.39e-16 0.7451
1. PBF Q7TV03 ATP phosphoribosyltransferase regulatory subunit 7.70e-12 9.26e-30 1.71e-14 0.7417
1. PBF B8GDZ3 Histidine--tRNA ligase 5.55e-15 2.83e-46 1.52e-49 0.8011
1. PBF A1WXZ0 Histidine--tRNA ligase 0.00e+00 6.24e-64 6.95e-79 0.9192
1. PBF C5CXH6 ATP phosphoribosyltransferase regulatory subunit 2.47e-10 6.90e-21 2.77e-08 0.7143
1. PBF A2RN96 Histidine--tRNA ligase 0.00e+00 6.81e-54 1.61e-94 0.9557
1. PBF B5Z8I6 Histidine--tRNA ligase 3.82e-13 4.11e-50 8.59e-20 0.7515
1. PBF A7FY04 Histidine--tRNA ligase 0.00e+00 1.42e-57 7.58e-89 0.9298
1. PBF P60909 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9526
1. PBF B3EB83 Histidine--tRNA ligase 0.00e+00 3.60e-64 7.17e-85 0.9039
1. PBF B4STN3 Histidine--tRNA ligase 2.92e-11 5.34e-47 6.35e-19 0.7248
1. PBF B1XAY9 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9251
1. PBF Q0IDK4 Histidine--tRNA ligase 0.00e+00 4.86e-56 1.50e-75 0.9262
1. PBF B1VA46 Histidine--tRNA ligase 0.00e+00 2.39e-57 4.02e-83 0.9281
1. PBF Q1R8L9 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9263
1. PBF Q2GBN6 Histidine--tRNA ligase 0.00e+00 2.45e-59 2.25e-67 0.8628
1. PBF C3P500 ATP phosphoribosyltransferase regulatory subunit 8.33e-15 1.13e-35 1.65e-24 0.7131
1. PBF Q5GSM4 Histidine--tRNA ligase 0.00e+00 4.65e-65 1.38e-72 0.9168
1. PBF Q39UD2 Histidine--tRNA ligase 0.00e+00 8.41e-63 8.41e-85 0.9155
1. PBF Q02WI8 Histidine--tRNA ligase 0.00e+00 7.32e-54 1.42e-94 0.9631
1. PBF B7UGW0 Histidine--tRNA ligase 0.00e+00 1.17e-61 2.89e-85 0.9512
1. PBF A1AE52 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.927
1. PBF Q4UM71 Histidine--tRNA ligase 0.00e+00 6.93e-64 8.99e-66 0.926
1. PBF B8JBF6 Histidine--tRNA ligase 0.00e+00 2.90e-63 7.32e-78 0.9303
1. PBF Q68X64 Histidine--tRNA ligase 0.00e+00 3.49e-60 4.33e-69 0.931
1. PBF Q3IMP5 Histidine--tRNA ligase 9.55e-15 2.47e-47 8.86e-36 0.7726
1. PBF C1CH52 Histidine--tRNA ligase 0.00e+00 1.82e-63 5.21e-103 0.9557
1. PBF A1KLS8 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 0.9169
1. PBF Q5X9E5 Histidine--tRNA ligase 0.00e+00 7.49e-64 1.10e-98 0.958
1. PBF Q7V263 Histidine--tRNA ligase 0.00e+00 1.12e-55 8.18e-80 0.9193
1. PBF Q2YT99 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9537
1. PBF Q1AX12 ATP phosphoribosyltransferase regulatory subunit 9.73e-11 2.34e-34 4.71e-15 0.6939
1. PBF Q7MNF0 Histidine--tRNA ligase 0.00e+00 6.67e-61 1.00e-85 0.9366
1. PBF Q30RH3 Histidine--tRNA ligase 0.00e+00 8.05e-57 2.00e-70 0.9298
1. PBF Q67KH4 ATP phosphoribosyltransferase regulatory subunit 8.87e-14 7.47e-29 1.12e-26 0.7547
1. PBF B4TR94 Histidine--tRNA ligase 0.00e+00 2.31e-62 9.43e-85 0.9436
1. PBF Q8EPR9 Histidine--tRNA ligase 0.00e+00 1.44e-59 4.96e-99 0.9471
1. PBF Q1WTV0 Histidine--tRNA ligase 0.00e+00 4.51e-62 6.61e-98 0.9461
1. PBF Q9KTX0 Histidine--tRNA ligase 0.00e+00 6.67e-61 4.60e-87 0.9309
1. PBF Q81N41 Histidine--tRNA ligase 1 6.31e-14 1.66e-49 2.23e-24 0.7523
1. PBF Q55267 ATP phosphoribosyltransferase regulatory subunit 4.10e-13 6.21e-38 3.14e-18 0.7372
1. PBF Q2P3K8 Histidine--tRNA ligase 3.71e-11 5.40e-45 2.20e-15 0.7284
1. PBF A4TMT6 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.943
1. PBF Q6HG86 Histidine--tRNA ligase 1 4.98e-14 1.91e-48 6.75e-26 0.7513
1. PBF B4RV88 Histidine--tRNA ligase 0.00e+00 1.26e-63 1.13e-79 0.9093
1. PBF P60914 Histidine--tRNA ligase 0.00e+00 1.23e-64 6.66e-72 0.902
1. PBF A1BDE6 Histidine--tRNA ligase 0.00e+00 3.14e-57 6.64e-70 0.9349
1. PBF Q0K963 Histidine--tRNA ligase 0.00e+00 6.69e-44 1.44e-79 0.9433
1. PBF A3M212 Histidine--tRNA ligase 0.00e+00 3.60e-58 9.12e-81 0.9171
1. PBF Q5WDH6 ATP phosphoribosyltransferase regulatory subunit 3.29e-10 2.90e-28 1.36e-15 0.7045
1. PBF Q987T0 Histidine--tRNA ligase 5.22e-12 6.09e-36 6.79e-12 0.7369
1. PBF Q8F737 ATP phosphoribosyltransferase regulatory subunit 7.60e-08 2.36e-03 2.55e-06 0.6892
1. PBF Q5LXM9 Histidine--tRNA ligase 0.00e+00 4.65e-65 2.12e-90 0.9585
1. PBF B7UWI9 Histidine--tRNA ligase 0.00e+00 7.99e-63 2.99e-75 0.9238
1. PBF Q5N0Z5 Histidine--tRNA ligase 0.00e+00 3.45e-55 6.36e-85 0.941
1. PBF A6U299 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9499
1. PBF Q7VF68 Histidine--tRNA ligase 3.03e-12 2.15e-47 1.05e-22 0.7389
1. PBF Q3YZ38 Histidine--tRNA ligase 0.00e+00 9.53e-61 1.42e-84 0.9278
1. PBF Q8ZWZ1 Histidine--tRNA ligase 1.23e-14 6.31e-51 1.33e-24 0.7803
1. PBF A1KT95 Histidine--tRNA ligase 0.00e+00 1.97e-58 2.46e-70 0.9423
1. PBF Q662M6 Histidine--tRNA ligase 1.85e-13 2.46e-41 5.78e-16 0.7683
1. PBF B1JS06 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9432
1. PBF P60919 Histidine--tRNA ligase 8.45e-13 9.97e-30 1.34e-11 0.7576
1. PBF Q3ICZ6 Histidine--tRNA ligase 0.00e+00 7.97e-61 1.09e-77 0.9278
1. PBF Q5FKI5 Histidine--tRNA ligase 0.00e+00 3.53e-56 2.97e-90 0.9517
1. PBF Q7UZ20 Histidine--tRNA ligase 2.15e-12 8.66e-48 9.30e-22 0.733
1. PBF A3CNT6 ATP phosphoribosyltransferase regulatory subunit 4.14e-08 2.79e-03 9.47e-11 0.6871
1. PBF A6TKS9 ATP phosphoribosyltransferase regulatory subunit 1.80e-13 5.04e-30 1.76e-19 0.7275
1. PBF Q3B0D3 Histidine--tRNA ligase 0.00e+00 2.22e-57 2.78e-74 0.9132
1. PBF Q9KXP2 Histidine--tRNA ligase 0.00e+00 3.48e-63 7.06e-71 0.9233
1. PBF Q8P9P5 Histidine--tRNA ligase 4.51e-11 3.31e-45 9.54e-17 0.7323
1. PBF Q8A6N7 Histidine--tRNA ligase 2.94e-13 1.83e-42 2.47e-24 0.7326
1. PBF Q252T8 Histidine--tRNA ligase 0.00e+00 2.59e-54 3.41e-77 0.9188
1. PBF B0JS32 ATP phosphoribosyltransferase regulatory subunit 7.88e-13 9.97e-30 6.72e-10 0.7459
1. PBF Q2RGV6 ATP phosphoribosyltransferase regulatory subunit 3.35e-11 2.92e-25 2.34e-25 0.749
1. PBF Q3ZWB6 Histidine--tRNA ligase 0.00e+00 2.33e-59 6.44e-82 0.9387
1. PBF B7K2B6 Histidine--tRNA ligase 0.00e+00 1.73e-56 3.46e-82 0.9414
1. PBF A0M0E2 Histidine--tRNA ligase 1.49e-13 2.23e-43 6.50e-20 0.7851
1. PBF B0B9Z6 Histidine--tRNA ligase 0.00e+00 9.30e-59 1.08e-75 0.8956
1. PBF B5ZB96 Histidine--tRNA ligase 0.00e+00 3.39e-65 3.25e-72 0.9046
1. PBF Q31I05 Histidine--tRNA ligase 0.00e+00 1.64e-59 1.07e-77 0.9398
1. PBF B2K9P9 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9432
1. PBF Q1MKY0 Histidine--tRNA ligase 3.69e-12 1.00e-27 5.37e-19 0.739
1. PBF Q49Y69 Histidine--tRNA ligase 0.00e+00 1.61e-66 3.76e-101 0.9548
1. PBF Q1C5I9 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9427
1. PBF B0SQQ4 Histidine--tRNA ligase 5.55e-16 1.77e-57 8.09e-44 0.8141
1. PBF Q3AA16 Histidine--tRNA ligase 0.00e+00 1.00e-61 8.96e-95 0.9508
1. PBF Q5UXW4 Histidine--tRNA ligase 6.88e-15 4.59e-52 1.44e-35 0.7606
1. PBF O32039 Histidine--tRNA ligase 0.00e+00 1.49e-66 1.68e-98 0.9563
1. PBF Q7MTB3 Histidine--tRNA ligase 1.69e-13 5.78e-45 1.12e-23 0.7677
1. PBF A7GDQ0 ATP phosphoribosyltransferase regulatory subunit 6.41e-14 3.39e-37 4.54e-20 0.7312
1. PBF A1VZB3 Histidine--tRNA ligase 0.00e+00 1.06e-56 1.92e-57 0.9162
1. PBF Q9CE78 Histidine--tRNA ligase 0.00e+00 5.47e-55 7.20e-93 0.9613
1. PBF C1DE56 Histidine--tRNA ligase 0.00e+00 5.44e-61 3.75e-77 0.9173
1. PBF B0B8B7 Histidine--tRNA ligase 0.00e+00 9.30e-59 1.08e-75 0.8938
1. PBF Q638Q6 Histidine--tRNA ligase 1 4.71e-14 1.04e-47 3.71e-27 0.7667
1. PBF P60922 Histidine--tRNA ligase 1.05e-14 3.33e-50 8.66e-27 0.8049
1. PBF A3PBZ7 Histidine--tRNA ligase 0.00e+00 7.20e-61 1.36e-85 0.9291
1. PBF A9MDU4 Histidine--tRNA ligase 2.96e-13 1.12e-33 1.00e-08 0.7373
1. PBF B0K977 Histidine--tRNA ligase 0.00e+00 3.31e-62 5.59e-97 0.9459
1. PBF B7KFP0 Histidine--tRNA ligase 0.00e+00 1.94e-54 9.26e-82 0.9455
1. PBF A9VLH1 ATP phosphoribosyltransferase regulatory subunit 2.13e-10 1.09e-35 9.56e-24 0.6806
1. PBF Q3B1Z1 Histidine--tRNA ligase 0.00e+00 2.00e-61 5.43e-71 0.9362
1. PBF Q2JMG5 ATP phosphoribosyltransferase regulatory subunit 6.82e-13 1.05e-19 2.75e-15 0.7219
1. PBF Q2KY92 Histidine--tRNA ligase 0.00e+00 8.37e-62 4.85e-67 0.9272
1. PBF Q92RR7 Histidine--tRNA ligase 7.81e-11 1.13e-35 1.76e-11 0.7344
1. PBF Q4L6X6 Histidine--tRNA ligase 0.00e+00 2.02e-63 2.97e-94 0.9498
1. PBF A9KIA5 Histidine--tRNA ligase 0.00e+00 5.28e-63 6.54e-82 0.9391
1. PBF Q3KLF4 Histidine--tRNA ligase 0.00e+00 1.72e-59 1.98e-76 0.9061
1. PBF P47281 Histidine--tRNA ligase 0.00e+00 2.22e-65 5.83e-74 0.9131
1. PBF B7K4F1 ATP phosphoribosyltransferase regulatory subunit 2.18e-12 3.87e-38 4.87e-09 0.7433
1. PBF Q5P7B4 Histidine--tRNA ligase 0.00e+00 9.90e-56 1.09e-80 0.9443
1. PBF C3K1L3 Histidine--tRNA ligase 0.00e+00 4.18e-63 2.65e-83 0.9112
1. PBF Q0HKV8 Histidine--tRNA ligase 0.00e+00 6.50e-61 1.26e-80 0.9252
1. PBF Q6GG72 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9541
1. PBF Q1GAG8 Histidine--tRNA ligase 0.00e+00 1.81e-59 1.31e-94 0.9404
1. PBF B7IN97 ATP phosphoribosyltransferase regulatory subunit 1.42e-10 2.25e-37 1.86e-23 0.6882
1. PBF Q8Z4P4 Histidine--tRNA ligase 0.00e+00 3.23e-62 6.20e-85 0.9441
1. PBF Q5WCR7 Histidine--tRNA ligase 2 5.31e-14 3.10e-46 1.97e-25 0.7739
1. PBF Q5WWH1 Histidine--tRNA ligase 0.00e+00 6.40e-64 3.10e-70 0.9313
1. PBF B5BAY6 Histidine--tRNA ligase 0.00e+00 5.27e-62 6.75e-85 0.9433
1. PBF A9A947 Histidine--tRNA ligase 8.12e-14 2.36e-47 1.08e-41 0.7503
1. PBF B3WED7 ATP phosphoribosyltransferase regulatory subunit 5.40e-10 5.05e-27 3.43e-09 0.701
1. PBF C1AF49 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 0.9063
1. PBF Q8R880 ATP phosphoribosyltransferase regulatory subunit 2.94e-12 2.22e-25 3.77e-25 0.7176
1. PBF B2UUV2 Histidine--tRNA ligase 4.49e-13 4.48e-49 2.38e-20 0.7657
1. PBF Q65GR3 Histidine--tRNA ligase 0.00e+00 2.27e-66 1.84e-102 0.9482
1. PBF Q1QD17 Histidine--tRNA ligase 0.00e+00 3.93e-57 3.98e-67 0.8967
1. PBF Q2YIH9 Histidine--tRNA ligase 3.20e-13 6.49e-34 9.27e-09 0.7371
1. PBF B2S3N0 Histidine--tRNA ligase 3.36e-13 7.73e-48 1.02e-25 0.7611
1. PBF Q48LZ3 Histidine--tRNA ligase 0.00e+00 3.86e-63 1.96e-77 0.9214
1. PBF Q9UY31 Histidine--tRNA ligase 2.49e-14 8.58e-47 1.77e-41 0.804
1. PBF B1I363 Histidine--tRNA ligase 0.00e+00 1.36e-61 2.67e-96 0.9502
1. PBF B8FQR7 Histidine--tRNA ligase 0.00e+00 9.38e-60 1.32e-95 0.9531
1. PBF A4VNX0 Histidine--tRNA ligase 0.00e+00 3.18e-61 9.33e-73 0.9345
1. PBF Q183H5 Histidine--tRNA ligase 0.00e+00 1.65e-62 9.75e-100 0.9433
1. PBF Q81LI6 Histidine--tRNA ligase 2 0.00e+00 1.08e-56 1.51e-103 0.9545
1. PBF Q65R83 Histidine--tRNA ligase 0.00e+00 4.78e-66 8.37e-84 0.9427
1. PBF Q5HAI0 Histidine--tRNA ligase 0.00e+00 1.53e-62 1.48e-65 0.9013
1. PBF B7N6A2 Histidine--tRNA ligase 0.00e+00 2.59e-61 1.03e-84 0.9493
1. PBF Q5PNI1 Histidine--tRNA ligase 0.00e+00 5.27e-62 6.75e-85 0.9471
1. PBF P60915 Histidine--tRNA ligase 0.00e+00 3.21e-65 3.71e-83 0.9187
1. PBF A4FBB7 Histidine--tRNA ligase 0.00e+00 8.29e-65 5.80e-79 0.9236
1. PBF Q0AHF6 ATP phosphoribosyltransferase regulatory subunit 5.10e-10 1.52e-21 5.69e-04 0.669
1. PBF B3QS95 Histidine--tRNA ligase 0.00e+00 3.49e-62 6.86e-70 0.9314
1. PBF Q579Q8 Histidine--tRNA ligase 2.56e-13 6.49e-34 9.27e-09 0.7482
1. PBF C1CAV1 Histidine--tRNA ligase 0.00e+00 4.07e-63 1.03e-102 0.9556
1. PBF C5BET0 Histidine--tRNA ligase 0.00e+00 4.65e-65 5.05e-86 0.9276
1. PBF Q3AQK2 Histidine--tRNA ligase 0.00e+00 1.36e-60 1.40e-70 0.9325
1. PBF Q7VME1 Histidine--tRNA ligase 0.00e+00 3.97e-65 1.85e-77 0.9399
1. PBF B0BWZ9 Histidine--tRNA ligase 0.00e+00 1.48e-63 1.41e-64 0.9233
1. PBF B7HKC8 ATP phosphoribosyltransferase regulatory subunit 7.22e-15 1.07e-35 8.96e-25 0.7132
1. PBF C3KTB7 Histidine--tRNA ligase 0.00e+00 2.16e-59 5.73e-91 0.9303
1. PBF Q3MEH7 ATP phosphoribosyltransferase regulatory subunit 5.61e-14 2.01e-33 4.22e-13 0.7565
1. PBF B5Z0Y3 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9252
1. PBF A7FFZ0 Histidine--tRNA ligase 0.00e+00 1.51e-61 1.28e-88 0.9431
1. PBF A3MTI8 Histidine--tRNA ligase 1.21e-14 1.86e-50 2.68e-35 0.7993
1. PBF A5ITF5 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9535
1. PBF A1V4K0 Histidine--tRNA ligase 0.00e+00 3.76e-51 9.88e-85 0.943
1. PBF B9M1R1 ATP phosphoribosyltransferase regulatory subunit 2.77e-13 4.78e-43 7.78e-17 0.7341
1. PBF Q8YB45 Histidine--tRNA ligase 4.39e-13 8.53e-34 1.10e-08 0.7421
1. PBF Q2NS41 Histidine--tRNA ligase 0.00e+00 1.41e-62 4.29e-87 0.9381
1. PBF B4T0P8 Histidine--tRNA ligase 0.00e+00 2.43e-62 1.65e-85 0.9443
1. PBF B7GPS9 Histidine--tRNA ligase 5.61e-10 8.23e-45 5.00e-16 0.7364
1. PBF Q7TU96 ATP phosphoribosyltransferase regulatory subunit 5.70e-11 2.46e-25 4.09e-04 0.6896
1. PBF B8D110 ATP phosphoribosyltransferase regulatory subunit 8.23e-12 1.08e-51 4.19e-28 0.7495
1. PBF B2I5Y4 Histidine--tRNA ligase 4.50e-11 2.90e-45 4.65e-17 0.7219
1. PBF A4J716 ATP phosphoribosyltransferase regulatory subunit 1.14e-13 1.04e-33 1.30e-20 0.7464
1. PBF A9BMU4 ATP phosphoribosyltransferase regulatory subunit 4.19e-10 7.46e-22 3.42e-08 0.6932
1. PBF A8FLH8 Histidine--tRNA ligase 0.00e+00 2.99e-57 8.61e-58 0.9174
1. PBF A9M402 Histidine--tRNA ligase 0.00e+00 1.68e-59 2.54e-70 0.9377
1. PBF B3GY63 Histidine--tRNA ligase 0.00e+00 1.64e-63 1.48e-76 0.9348
1. PBF Q03IB2 Histidine--tRNA ligase 0.00e+00 3.48e-65 7.13e-91 0.9563
1. PBF B7IHK5 Histidine--tRNA ligase 0.00e+00 5.37e-60 6.21e-95 0.9441
1. PBF B7KDF3 ATP phosphoribosyltransferase regulatory subunit 1.11e-13 5.37e-32 1.35e-11 0.7511
1. PBF Q0AYS2 Histidine--tRNA ligase 0.00e+00 1.85e-60 4.65e-92 0.9264
1. PBF O26346 Histidine--tRNA ligase 7.77e-16 3.32e-49 4.48e-50 0.801
1. PBF A8Z2F8 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.954
1. PBF B5FAX3 Histidine--tRNA ligase 0.00e+00 8.39e-61 6.64e-83 0.924
1. PBF Q9Z7P1 Histidine--tRNA ligase 0.00e+00 3.47e-57 1.38e-70 0.9234
1. PBF P0DG41 Histidine--tRNA ligase 0.00e+00 7.30e-64 2.01e-98 0.9573
1. PBF Q03SE4 Histidine--tRNA ligase 0.00e+00 7.95e-62 3.68e-97 0.9448
1. PBF Q39FR0 Histidine--tRNA ligase 0.00e+00 2.05e-52 7.04e-80 0.9451
1. PBF Q5FR00 ATP phosphoribosyltransferase regulatory subunit 1.13e-08 3.88e-17 6.77e-09 0.6636
1. PBF A6LL06 Histidine--tRNA ligase 0.00e+00 1.20e-60 2.34e-95 0.9412
1. PBF C3PN13 Histidine--tRNA ligase 0.00e+00 2.36e-63 2.13e-64 0.9259
1. PBF Q9PBC2 Histidine--tRNA ligase 2.63e-11 4.84e-45 1.37e-16 0.7287
1. PBF Q9ZDL9 Histidine--tRNA ligase 0.00e+00 2.40e-61 2.64e-66 0.9246
1. PBF Q2JUD2 ATP phosphoribosyltransferase regulatory subunit 1.19e-12 8.38e-33 1.72e-17 0.7346
1. PBF A5I6D6 Histidine--tRNA ligase 0.00e+00 1.42e-57 7.58e-89 0.9296
1. PBF B2I3E6 Histidine--tRNA ligase 0.00e+00 2.24e-58 1.48e-80 0.9113
1. PBF A4XHB0 Histidine--tRNA ligase 0.00e+00 2.28e-61 1.17e-88 0.9401
1. PBF Q12PT3 Histidine--tRNA ligase 0.00e+00 2.52e-61 2.64e-90 0.9101
1. PBF C4XT36 Histidine--tRNA ligase 0.00e+00 7.39e-63 3.01e-78 0.9318
1. PBF Q2GLK4 Histidine--tRNA ligase 0.00e+00 1.11e-63 2.03e-69 0.9099
1. PBF Q0S1B6 Histidine--tRNA ligase 0.00e+00 6.07e-66 2.32e-68 0.9108
1. PBF Q7NHH9 Histidine--tRNA ligase 1.56e-11 1.66e-49 2.57e-10 0.7265
1. PBF B9KG88 Histidine--tRNA ligase 0.00e+00 8.61e-61 1.03e-62 0.9297
1. PBF A2C228 ATP phosphoribosyltransferase regulatory subunit 2.23e-11 1.04e-31 2.94e-08 0.7041
1. PBF B7LKC4 Histidine--tRNA ligase 0.00e+00 4.40e-63 1.16e-82 0.9391
1. PBF Q0VNE1 Histidine--tRNA ligase 0.00e+00 8.41e-63 3.15e-79 0.8567
1. PBF Q97KI4 ATP phosphoribosyltransferase regulatory subunit 4.51e-11 3.09e-32 1.16e-17 0.6957
1. PBF Q4AA96 Histidine--tRNA ligase 0.00e+00 2.15e-60 5.96e-64 0.9202
1. PBF Q88VQ7 Histidine--tRNA ligase 0.00e+00 6.93e-66 3.81e-104 0.9429
1. PBF Q892X7 Histidine--tRNA ligase 1.20e-11 4.54e-46 4.93e-25 0.7415
1. PBF Q47BR7 Histidine--tRNA ligase 0.00e+00 2.39e-59 2.62e-77 0.9466
1. PBF B2JIV0 Histidine--tRNA ligase 0.00e+00 4.27e-52 3.47e-80 0.9428
1. PBF Q0TEX1 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9297
1. PBF Q71ZF0 Histidine--tRNA ligase 0.00e+00 1.95e-65 7.95e-97 0.9488
1. PBF Q0I2E8 Histidine--tRNA ligase 0.00e+00 8.53e-64 3.45e-84 0.9362
1. PBF B8E9S8 Histidine--tRNA ligase 0.00e+00 2.05e-60 9.54e-83 0.9258
1. PBF A5F3G1 Histidine--tRNA ligase 0.00e+00 6.67e-61 4.60e-87 0.9245
1. PBF P60837 ATP phosphoribosyltransferase regulatory subunit 4.11e-10 1.38e-40 6.00e-18 0.7224
1. PBF C0R4G6 Histidine--tRNA ligase 0.00e+00 4.40e-63 1.11e-68 0.9276
1. PBF Q601R3 Histidine--tRNA ligase 0.00e+00 5.51e-60 7.94e-64 0.9197
1. PBF Q15R57 Histidine--tRNA ligase 0.00e+00 3.97e-65 2.36e-83 0.9402
1. PBF Q02RV6 Histidine--tRNA ligase 0.00e+00 9.33e-63 2.95e-75 0.9313
1. PBF C0MB21 Histidine--tRNA ligase 0.00e+00 2.94e-61 7.05e-88 0.962
1. PBF B9E707 Histidine--tRNA ligase 0.00e+00 9.98e-64 5.15e-100 0.9465
1. PBF C0QFI0 Histidine--tRNA ligase 0.00e+00 6.08e-58 5.64e-82 0.9363
1. PBF Q975U9 Histidine--tRNA ligase 2.66e-15 2.71e-57 3.70e-37 0.777
1. PBF Q5LVN3 Histidine--tRNA ligase 3.36e-11 9.95e-38 3.27e-15 0.7398
1. PBF Q83C80 Histidine--tRNA ligase 0.00e+00 3.32e-60 7.15e-81 0.933
1. PBF Q8YMC2 Histidine--tRNA ligase 1.97e-12 9.51e-46 1.87e-19 0.7555
1. PBF A1T898 Histidine--tRNA ligase 0.00e+00 3.33e-67 7.98e-71 0.924
1. PBF Q6HLE9 ATP phosphoribosyltransferase regulatory subunit 1.02e-14 1.11e-35 2.83e-25 0.7123
1. PBF Q04AV4 Histidine--tRNA ligase 0.00e+00 2.33e-59 1.26e-94 0.9454
1. PBF Q8Y029 Histidine--tRNA ligase 0.00e+00 1.14e-56 7.74e-80 0.9457
1. PBF B7I5G8 Histidine--tRNA ligase 0.00e+00 6.26e-60 7.77e-81 0.9167
1. PBF Q3JYL6 Histidine--tRNA ligase 0.00e+00 3.06e-63 2.47e-93 0.9605
1. PBF Q67LN9 Histidine--tRNA ligase 0.00e+00 1.83e-58 2.80e-84 0.9485
1. PBF A9MHL6 Histidine--tRNA ligase 0.00e+00 1.81e-61 1.17e-84 0.9293
1. PBF Q57LI7 Histidine--tRNA ligase 0.00e+00 1.12e-62 8.64e-84 0.9468
1. PBF A8AY30 ATP phosphoribosyltransferase regulatory subunit 4.04e-08 5.02e-03 3.27e-10 0.6869
1. PBF A8GU77 Proline--tRNA ligase 1.18e-07 4.78e-09 0.017 0.4879
1. PBF B6I586 Histidine--tRNA ligase 0.00e+00 2.11e-61 7.60e-86 0.9501
1. PBF A4IW12 Histidine--tRNA ligase 0.00e+00 2.10e-66 2.59e-86 0.9315
1. PBF B5FR62 Histidine--tRNA ligase 0.00e+00 2.43e-62 1.65e-85 0.9453
1. PBF Q8DTQ5 ATP phosphoribosyltransferase regulatory subunit 1.51e-09 1.99e-02 5.26e-12 0.6982
1. PBF A4WD92 Histidine--tRNA ligase 0.00e+00 3.90e-61 2.13e-87 0.9416
1. PBF B1HVP6 ATP phosphoribosyltransferase regulatory subunit 2.06e-12 8.22e-33 7.89e-22 0.7286
1. PBF A8A320 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9255
1. PBF B9E5P3 Histidine--tRNA ligase 0.00e+00 1.02e-63 6.42e-86 0.9282
1. PBF A1S862 Histidine--tRNA ligase 0.00e+00 2.36e-63 1.59e-82 0.9266
1. PBF B4U0K6 Histidine--tRNA ligase 0.00e+00 2.32e-60 7.77e-88 0.9616
1. PBF Q48QS7 Histidine--tRNA ligase 0.00e+00 4.21e-64 3.34e-99 0.9575
1. PBF B7GWX1 ATP phosphoribosyltransferase regulatory subunit 1.09e-08 1.38e-21 0.020 0.6519
1. PBF A6VV07 Histidine--tRNA ligase 0.00e+00 1.41e-59 1.12e-80 0.9268
1. PBF P60911 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9542
1. PBF Q55653 Histidine--tRNA ligase 0.00e+00 8.10e-40 3.80e-88 0.9397
1. PBF B4UEL3 Histidine--tRNA ligase 0.00e+00 2.98e-63 3.22e-79 0.9304
1. PBF P62371 Histidine--tRNA ligase 7.88e-15 1.92e-53 3.20e-35 0.802
1. PBF Q0A986 Histidine--tRNA ligase 0.00e+00 1.17e-60 4.07e-80 0.9166
1. PBF Q8EWB8 Histidine--tRNA ligase 0.00e+00 4.53e-65 1.22e-92 0.9391
1. PBF B1JDV7 Histidine--tRNA ligase 0.00e+00 1.49e-62 1.04e-81 0.9061
1. PBF Q8RAI8 Histidine--tRNA ligase 0.00e+00 5.01e-63 1.34e-91 0.9462
1. PBF P60912 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9522
1. PBF Q085U5 Histidine--tRNA ligase 0.00e+00 5.84e-62 2.73e-86 0.9214
1. PBF P62370 Histidine--tRNA ligase 2 0.00e+00 2.71e-57 5.61e-103 0.9497
1. PBF Q4K6V0 Histidine--tRNA ligase 0.00e+00 8.63e-63 1.50e-78 0.9064
1. PBF B1H0I8 Histidine--tRNA ligase 0.00e+00 1.55e-61 5.39e-95 0.9047
1. PBF Q028M4 Histidine--tRNA ligase 0.00e+00 1.49e-65 4.07e-82 0.9069
1. PBF O58028 Histidine--tRNA ligase 0.00e+00 3.47e-47 2.29e-39 0.8115
1. PBF P60916 Histidine--tRNA ligase 0.00e+00 2.60e-58 8.76e-95 0.9529
1. PBF Q7M8S6 Histidine--tRNA ligase 3.35e-12 1.03e-48 2.90e-25 0.7416
1. PBF Q492E1 Histidine--tRNA ligase 0.00e+00 1.32e-58 6.17e-71 0.9466
1. PBF C4ZX89 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9283
1. PBF A7MZE2 Histidine--tRNA ligase 0.00e+00 3.90e-61 5.40e-88 0.9332
1. PBF Q8YT12 ATP phosphoribosyltransferase regulatory subunit 3.77e-14 1.72e-33 3.27e-13 0.7462
1. PBF A6QHH3 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9534
1. PBF A5CWE8 Histidine--tRNA ligase 0.00e+00 1.65e-62 7.53e-69 0.9285
1. PBF C4K1W2 Histidine--tRNA ligase 0.00e+00 1.82e-63 1.46e-63 0.9267
1. PBF P57988 Histidine--tRNA ligase 0.00e+00 2.18e-63 4.54e-78 0.9371
1. PBF A0AG21 ATP phosphoribosyltransferase regulatory subunit 4.90e-10 1.58e-31 8.03e-16 0.7044
1. PBF Q8NZ19 Histidine--tRNA ligase 0.00e+00 7.69e-64 3.03e-99 0.9581
1. PBF Q8G864 Histidine--tRNA ligase 6.81e-10 1.00e-44 2.59e-16 0.7238
1. PBF A1JKS3 Histidine--tRNA ligase 0.00e+00 2.42e-63 8.05e-89 0.9345
1. PBF Q6KI17 Histidine--tRNA ligase 0.00e+00 4.08e-48 3.74e-74 0.8997
1. PBF Q9K6Z0 ATP phosphoribosyltransferase regulatory subunit 1.01e-10 1.33e-32 2.24e-17 0.71
1. PBF Q64QS2 Histidine--tRNA ligase 1.94e-13 9.36e-43 8.51e-25 0.7465
1. PBF Q8UHK4 Histidine--tRNA ligase 8.93e-13 2.63e-33 1.06e-15 0.7434
1. PBF A6VYL1 ATP phosphoribosyltransferase regulatory subunit 2.64e-11 6.40e-20 4.94e-06 0.6768
1. PBF A8EZE6 Histidine--tRNA ligase 0.00e+00 1.00e-61 5.61e-65 0.9172
1. PBF Q5YTH9 Histidine--tRNA ligase 0.00e+00 8.51e-65 2.97e-72 0.9036
1. PBF B6YS23 Histidine--tRNA ligase 1.40e-13 1.00e-48 7.05e-31 0.7623
1. PBF Q8FX93 Histidine--tRNA ligase 4.29e-13 1.12e-33 1.00e-08 0.7429
1. PBF Q2FG96 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9538
1. PBF Q6B910 Histidine--tRNA ligase, chloroplastic 0.00e+00 7.66e-65 1.17e-83 0.9317
1. PBF A1UTY3 Histidine--tRNA ligase 2.26e-13 1.47e-35 3.19e-08 0.7496
1. PBF B7NRG4 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9269
1. PBF Q0SP28 Histidine--tRNA ligase 1.64e-13 4.29e-41 1.68e-17 0.7902
1. PBF A5D3E2 Histidine--tRNA ligase 0.00e+00 6.50e-61 1.36e-95 0.9477
1. PBF Q7WHN1 Histidine--tRNA ligase 0.00e+00 8.76e-64 2.90e-66 0.932
1. PBF A8YUZ9 Histidine--tRNA ligase 0.00e+00 5.69e-57 1.66e-88 0.9517
1. PBF A6UQQ6 Histidine--tRNA ligase 1.12e-12 1.14e-49 7.99e-45 0.7421
1. PBF B4SCE2 Histidine--tRNA ligase 0.00e+00 2.38e-60 3.90e-75 0.9389
1. PBF P62367 Histidine--tRNA ligase 1 7.36e-14 2.65e-45 1.82e-26 0.7514
1. PBF B2GBY6 Histidine--tRNA ligase 0.00e+00 1.05e-57 1.19e-99 0.9545
1. PBF Q2SWE3 Histidine--tRNA ligase 0.00e+00 7.27e-51 2.18e-83 0.9408
1. PBF Q21W38 ATP phosphoribosyltransferase regulatory subunit 4.99e-11 1.22e-20 2.27e-06 0.6791
1. PBF A4J2J1 Histidine--tRNA ligase 0.00e+00 9.54e-59 3.95e-98 0.9368
1. PBF B0CDA0 Histidine--tRNA ligase 0.00e+00 3.93e-57 7.93e-84 0.949
1. PBF Q8Y708 Histidine--tRNA ligase 0.00e+00 3.42e-64 6.47e-97 0.953
1. PBF Q81G08 ATP phosphoribosyltransferase regulatory subunit 1.10e-10 1.61e-36 1.11e-24 0.6884
1. PBF Q9X0H5 Histidine--tRNA ligase 0.00e+00 1.17e-67 9.51e-88 0.9427
1. PBF Q8Y9F9 ATP phosphoribosyltransferase regulatory subunit 7.39e-10 6.49e-31 2.57e-16 0.7125
1. PBF Q6FEM2 Histidine--tRNA ligase 0.00e+00 3.39e-63 2.43e-83 0.9199
1. PBF Q5HFD2 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 0.9529
1. PBF A7ZPV7 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9267
1. PBF A0KUJ6 Histidine--tRNA ligase 0.00e+00 7.77e-61 1.13e-80 0.9261
1. PBF Q1H0V0 Histidine--tRNA ligase 0.00e+00 2.25e-62 8.66e-79 0.9336
1. PBF Q817X7 Histidine--tRNA ligase 2 0.00e+00 5.69e-57 1.45e-103 0.9506
1. PBF C1FN35 ATP phosphoribosyltransferase regulatory subunit 2.92e-13 7.04e-37 1.55e-19 0.7302
1. PBF Q1ISE2 Histidine--tRNA ligase 0.00e+00 1.21e-52 1.48e-84 0.9315
1. PBF P51348 Histidine--tRNA ligase, chloroplastic 0.00e+00 1.25e-54 1.99e-81 0.9453
1. PBF Q0BEW8 Histidine--tRNA ligase 0.00e+00 1.82e-52 2.96e-80 0.9442
1. PBF C1DD44 Histidine--tRNA ligase 0.00e+00 3.24e-64 1.25e-78 0.9558
1. PBF A5U5T0 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 0.9056
1. PBF Q7VCG1 Histidine--tRNA ligase 0.00e+00 1.06e-60 7.62e-76 0.932
1. PBF B8JDI0 ATP phosphoribosyltransferase regulatory subunit 4.57e-09 1.23e-11 5.68e-08 0.6787
1. PBF B3ELN3 Histidine--tRNA ligase 0.00e+00 4.29e-58 7.91e-70 0.9381
1. PBF B2A2F9 Histidine--tRNA ligase 0.00e+00 7.66e-60 2.75e-92 0.9419
1. PBF Q81B71 Histidine--tRNA ligase 1 5.54e-14 2.14e-49 2.54e-27 0.7529
1. PBF A4VT07 Histidine--tRNA ligase 0.00e+00 1.44e-64 2.88e-103 0.9554
1. PBF Q1RJ50 Histidine--tRNA ligase 0.00e+00 4.07e-65 1.00e-70 0.9246
1. PBF Q8DEZ9 Histidine--tRNA ligase 0.00e+00 6.67e-61 1.00e-85 0.9346
1. PBF B0V5G6 Histidine--tRNA ligase 0.00e+00 7.10e-60 5.48e-80 0.9046
1. PBF C1CV35 Histidine--tRNA ligase 0.00e+00 5.27e-49 1.03e-56 0.9233
1. PBF A1W587 ATP phosphoribosyltransferase regulatory subunit 8.84e-09 4.24e-22 4.09e-08 0.6882
1. PBF A6VQX5 Histidine--tRNA ligase 0.00e+00 4.21e-64 9.79e-79 0.9389
1. PBF A6LIF7 Histidine--tRNA ligase 1.12e-13 1.61e-43 1.16e-25 0.7586
1. PBF B6INM0 ATP phosphoribosyltransferase regulatory subunit 2.15e-09 2.46e-17 4.22e-04 0.6595
1. PBF Q31KX6 Histidine--tRNA ligase 0.00e+00 1.22e-54 2.93e-86 0.9378
1. PBF Q0HX56 Histidine--tRNA ligase 0.00e+00 1.06e-60 9.41e-81 0.9275
1. PBF Q6AQS3 Histidine--tRNA ligase 0.00e+00 2.39e-57 3.39e-82 0.9322
1. PBF C1B4E1 Histidine--tRNA ligase 0.00e+00 1.23e-66 7.65e-69 0.9099
1. PBF C1CNA0 Histidine--tRNA ligase 0.00e+00 4.18e-63 2.90e-103 0.959
1. PBF A1B3C5 Histidine--tRNA ligase 3.61e-11 3.03e-39 4.22e-08 0.7362
1. PBF B5ZRD0 Histidine--tRNA ligase 1.76e-12 1.32e-34 3.53e-18 0.7428
1. PBF Q5HV27 Histidine--tRNA ligase 0.00e+00 1.29e-58 1.19e-57 0.9123
1. PBF A8GHW4 Histidine--tRNA ligase 0.00e+00 2.08e-62 3.23e-91 0.9271
1. PBF Q7NBS9 Histidine--tRNA ligase 0.00e+00 6.21e-65 2.63e-70 0.9033
1. PBF Q5FG57 Histidine--tRNA ligase 0.00e+00 2.03e-62 7.15e-66 0.9014
1. PBF Q63DX4 ATP phosphoribosyltransferase regulatory subunit 5.66e-15 3.33e-36 7.68e-25 0.6995
1. PBF A9WXP3 Histidine--tRNA ligase 4.09e-13 1.44e-33 1.02e-08 0.7327
1. PBF B8ZPP6 Histidine--tRNA ligase 0.00e+00 1.33e-63 4.53e-103 0.9586
1. PBF Q0SRP7 Histidine--tRNA ligase 0.00e+00 3.40e-60 6.69e-78 0.9415
1. PBF Q2SSF4 Histidine--tRNA ligase 0.00e+00 1.66e-81 0.0 0.9905
1. PBF Q9HNP5 Histidine--tRNA ligase 1.03e-14 8.26e-53 3.09e-18 0.7449
1. PBF A6KXA6 Histidine--tRNA ligase 2.28e-13 4.73e-42 8.40e-24 0.7463
1. PBF C3MY40 Histidine--tRNA ligase 0.00e+00 4.27e-59 5.30e-40 0.796
1. PBF A1W578 Histidine--tRNA ligase 0.00e+00 2.05e-60 3.89e-74 0.9318
1. PBF P62374 Histidine--tRNA ligase 0.00e+00 4.67e-57 6.98e-65 0.9186
1. PBF Q5ZV96 Histidine--tRNA ligase 0.00e+00 1.51e-63 1.44e-69 0.9375
1. PBF B0VKR7 Histidine--tRNA ligase 0.00e+00 8.70e-60 3.10e-80 0.9176
1. PBF B8DU04 Histidine--tRNA ligase 4.72e-10 3.79e-45 7.70e-17 0.733
1. PBF Q4JAY2 Histidine--tRNA ligase 2.21e-14 1.20e-58 4.72e-33 0.7754
1. PBF Q31BR1 Histidine--tRNA ligase 0.00e+00 1.14e-60 2.53e-81 0.9103
1. PBF Q039A9 ATP phosphoribosyltransferase regulatory subunit 6.19e-10 3.61e-27 2.92e-09 0.6916
1. PBF B8I5U8 ATP phosphoribosyltransferase regulatory subunit 1.24e-13 2.89e-35 2.63e-16 0.7638
1. PBF Q32D48 Histidine--tRNA ligase 0.00e+00 4.32e-61 2.89e-84 0.9194
1. PBF Q9ZK27 Histidine--tRNA ligase 3.84e-13 1.61e-50 5.98e-19 0.7396
1. PBF A2RGY1 Histidine--tRNA ligase 0.00e+00 1.38e-62 1.29e-98 0.9552
1. PBF B2HN79 Histidine--tRNA ligase 0.00e+00 2.54e-69 3.23e-70 0.9279
1. PBF O66522 Histidine--tRNA ligase 0.00e+00 2.27e-56 1.88e-89 0.9221
1. PBF B2SEW9 Histidine--tRNA ligase 0.00e+00 1.17e-66 9.40e-87 0.9364
1. PBF B1JT91 Histidine--tRNA ligase 0.00e+00 9.54e-53 3.22e-80 0.9476
1. PBF A5GQA2 Histidine--tRNA ligase 0.00e+00 4.33e-57 1.58e-77 0.9316
1. PBF Q5FUR8 Histidine--tRNA ligase 0.00e+00 1.83e-62 2.04e-77 0.8961
1. PBF A5GTR3 ATP phosphoribosyltransferase regulatory subunit 5.90e-12 4.63e-31 1.15e-05 0.7395
1. PBF Q89DI2 Histidine--tRNA ligase 4.04e-11 5.38e-38 5.63e-09 0.7264
1. PBF A6Q371 Histidine--tRNA ligase 0.00e+00 2.24e-58 1.04e-71 0.9314
1. PBF Q1CS74 Histidine--tRNA ligase 4.33e-13 4.11e-50 9.13e-21 0.7439
1. PBF Q4QNH3 Histidine--tRNA ligase 0.00e+00 7.58e-61 4.80e-80 0.9389
1. PBF B1L097 Histidine--tRNA ligase 0.00e+00 1.53e-57 4.47e-89 0.9291
1. PBF P60908 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9265
1. PBF Q634E2 Histidine--tRNA ligase 2 0.00e+00 1.08e-56 1.51e-103 0.9441
1. PBF B8E1C1 Histidine--tRNA ligase 0.00e+00 1.53e-62 1.03e-92 0.9144
1. PBF B6J7Q5 Histidine--tRNA ligase 0.00e+00 3.07e-60 2.06e-79 0.9347
1. PBF B8HMM0 Histidine--tRNA ligase 0.00e+00 3.74e-57 1.29e-88 0.9507
1. PBF Q4ZYX6 ATP phosphoribosyltransferase regulatory subunit 9.15e-11 1.66e-23 9.22e-07 0.7076
1. PBF A8H246 Histidine--tRNA ligase 0.00e+00 1.11e-60 1.38e-82 0.9141
1. PBF A9KXK7 Histidine--tRNA ligase 0.00e+00 1.85e-60 2.43e-82 0.9242
1. PBF A1RHQ4 Histidine--tRNA ligase 0.00e+00 3.02e-61 7.51e-81 0.9315
1. PBF A5N1Y9 Histidine--tRNA ligase 0.00e+00 1.02e-63 6.42e-86 0.9224
1. PBF A6V0W1 Histidine--tRNA ligase 0.00e+00 6.16e-63 8.08e-75 0.9213
1. PBF B2IN41 Histidine--tRNA ligase 0.00e+00 1.40e-63 5.88e-102 0.9558
1. PBF C3NFX3 Histidine--tRNA ligase 0.00e+00 8.00e-59 3.70e-40 0.7925
1. PBF Q9A2P3 Histidine--tRNA ligase 4.89e-13 7.17e-38 3.19e-16 0.7218
1. PBF Q18DQ2 Histidine--tRNA ligase 4.55e-15 1.01e-54 3.47e-30 0.7779
1. PBF Q722Y1 ATP phosphoribosyltransferase regulatory subunit 5.93e-10 1.23e-30 1.23e-13 0.7065
1. PBF Q7N705 Histidine--tRNA ligase 0.00e+00 5.99e-62 2.22e-86 0.9521
1. PBF B6IZN1 Histidine--tRNA ligase 0.00e+00 9.06e-61 1.74e-80 0.9339
1. PBF Q17VP5 Histidine--tRNA ligase 5.60e-13 1.90e-49 7.82e-20 0.7432
1. PBF B9J9Y1 Histidine--tRNA ligase 1.96e-12 1.25e-35 6.03e-11 0.7442
1. PBF B1WVZ0 Histidine--tRNA ligase 0.00e+00 7.68e-54 4.98e-79 0.9465
1. PBF P60907 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 0.9339
1. PBF Q5HNS1 Histidine--tRNA ligase 0.00e+00 4.00e-64 5.41e-104 0.9521
1. PBF B8CXE6 Histidine--tRNA ligase 0.00e+00 2.80e-61 4.65e-103 0.9574
1. PBF A8AZV0 Histidine--tRNA ligase 0.00e+00 3.67e-60 1.98e-94 0.9559
1. PBF Q9HLX5 Histidine--tRNA ligase 1.22e-15 5.24e-58 4.91e-34 0.7902
1. PBF C3L9Q3 ATP phosphoribosyltransferase regulatory subunit 7.22e-15 1.13e-35 1.65e-24 0.7104
1. PBF C0PYN1 Histidine--tRNA ligase 0.00e+00 2.62e-62 2.40e-85 0.9413
1. PBF B6JN30 Histidine--tRNA ligase 7.17e-13 4.01e-50 1.65e-19 0.7526
1. PBF A1WMN6 ATP phosphoribosyltransferase regulatory subunit 1.01e-10 1.67e-20 1.77e-04 0.6753
1. PBF Q02147 ATP phosphoribosyltransferase regulatory subunit 3.49e-11 1.56e-03 2.52e-15 0.7112
1. PBF A0Q8F1 Histidine--tRNA ligase 0.00e+00 9.96e-67 3.64e-87 0.9381
1. PBF B5RCZ1 Histidine--tRNA ligase 0.00e+00 4.29e-63 6.75e-86 0.9448
1. PBF Q8PVB0 Histidine--tRNA ligase 6.00e-15 6.25e-52 1.44e-43 0.7813
1. PBF A3MK74 Histidine--tRNA ligase 0.00e+00 3.76e-51 9.88e-85 0.9431
1. PBF A4SP01 Histidine--tRNA ligase 0.00e+00 9.23e-64 2.27e-78 0.9248
1. PBF Q02YW4 ATP phosphoribosyltransferase regulatory subunit 2.08e-09 7.31e-03 3.39e-18 0.6862
1. PBF Q8ZCT6 Histidine--tRNA ligase 0.00e+00 1.23e-61 9.36e-89 0.9434
1. PBF Q98QM8 Histidine--tRNA ligase 0.00e+00 5.61e-55 2.41e-64 0.8885
1. PBF Q1IZB5 Histidine--tRNA ligase 0.00e+00 5.03e-57 1.34e-58 0.9117
1. PBF B7GFR0 Histidine--tRNA ligase 0.00e+00 6.14e-62 2.81e-103 0.9495
1. PBF Q5JIM2 Histidine--tRNA ligase 2.44e-15 5.19e-46 8.35e-46 0.8025
1. PBF A8FT71 Histidine--tRNA ligase 0.00e+00 3.15e-60 4.49e-85 0.9225
1. PBF A3NVX0 Histidine--tRNA ligase 0.00e+00 1.73e-51 1.90e-84 0.9432
1. PBF Q46L29 ATP phosphoribosyltransferase regulatory subunit 1.89e-11 3.98e-31 7.44e-08 0.7028
1. PBF B5YDT1 Histidine--tRNA ligase 0.00e+00 3.05e-66 9.06e-93 0.9174
1. PBF Q3MAV8 Histidine--tRNA ligase 1.30e-11 3.95e-44 1.45e-18 0.721
1. PBF Q833I1 Histidine--tRNA ligase 0.00e+00 1.11e-60 5.02e-94 0.9487
1. PBF C1CU26 Histidine--tRNA ligase 0.00e+00 6.57e-64 7.94e-103 0.9552
2. PF A2BVH0 Proline--tRNA ligase 3.30e-06 1.04e-03 NA 0.4987
2. PF B0BXB9 Proline--tRNA ligase 1.89e-07 3.08e-08 NA 0.4937
2. PF Q9Z851 Proline--tRNA ligase 2.53e-06 2.40e-04 NA 0.5138
2. PF A9IUL1 Proline--tRNA ligase 1.42e-07 6.91e-09 NA 0.4797
2. PF Q11JI8 Proline--tRNA ligase 1.49e-07 8.17e-10 NA 0.4977
2. PF B4EAH3 ATP phosphoribosyltransferase regulatory subunit 3.62e-10 2.04e-19 NA 0.6987
2. PF Q135Z6 Proline--tRNA ligase 5.32e-07 4.56e-09 NA 0.5046
2. PF A3NVW0 ATP phosphoribosyltransferase regulatory subunit 3.92e-10 8.08e-20 NA 0.6585
2. PF A7HY28 Proline--tRNA ligase 1.25e-07 3.22e-08 NA 0.4905
2. PF B0VL32 ATP phosphoribosyltransferase regulatory subunit 1.14e-08 2.26e-21 NA 0.6449
2. PF Q0BEX7 ATP phosphoribosyltransferase regulatory subunit 3.00e-10 3.23e-19 NA 0.6957
2. PF B0CLE9 Proline--tRNA ligase 2.40e-07 5.55e-09 NA 0.4988
2. PF B0SZ28 Proline--tRNA ligase 4.64e-08 9.63e-08 NA 0.5065
2. PF Q07NK2 Proline--tRNA ligase 5.23e-07 2.57e-08 NA 0.5105
2. PF Q13X39 ATP phosphoribosyltransferase regulatory subunit 1.03e-10 5.74e-20 NA 0.6847
2. PF Q606N7 ATP phosphoribosyltransferase regulatory subunit 4.59e-10 1.17e-19 NA 0.6644
2. PF Q0C1C5 Proline--tRNA ligase 4.45e-07 9.74e-08 NA 0.508
2. PF B2J707 Proline--tRNA ligase 1.18e-06 1.57e-03 NA 0.4962
2. PF A8I438 Proline--tRNA ligase 7.23e-08 2.56e-07 NA 0.4998
2. PF A1APU5 Proline--tRNA ligase 4.10e-06 1.09e-03 NA 0.4931
2. PF Q89KM8 Proline--tRNA ligase 5.20e-07 3.33e-08 NA 0.5041
2. PF Q5P7C3 ATP phosphoribosyltransferase regulatory subunit 2.78e-08 9.77e-21 NA 0.6761
2. PF B0B7W3 Proline--tRNA ligase 6.65e-07 1.47e-02 NA 0.4964
2. PF Q3ALR5 Proline--tRNA ligase 1.72e-05 5.71e-04 NA 0.4969
2. PF Q9HUM5 ATP phosphoribosyltransferase regulatory subunit 1.26e-10 1.05e-24 NA 0.7035
2. PF B9KLX3 Proline--tRNA ligase 2.54e-07 1.22e-06 NA 0.5143
2. PF Q5L6M5 Proline--tRNA ligase 1.71e-06 1.55e-03 NA 0.5145
2. PF Q2JSB6 Proline--tRNA ligase 1.98e-06 1.62e-02 NA 0.4948
2. PF B1ZA28 Proline--tRNA ligase 1.50e-07 1.21e-07 NA 0.5034
2. PF Q68WZ3 Proline--tRNA ligase 5.35e-08 3.34e-09 NA 0.4914
2. PF A5GSC0 Proline--tRNA ligase 7.10e-06 3.10e-02 NA 0.5047
2. PF Q3J807 ATP phosphoribosyltransferase regulatory subunit 1.39e-10 7.14e-23 NA 0.7064
2. PF Q47BS6 ATP phosphoribosyltransferase regulatory subunit 3.66e-10 1.25e-19 NA 0.6839
2. PF Q1H0Y5 ATP phosphoribosyltransferase regulatory subunit 9.22e-11 4.22e-21 NA 0.6748
2. PF Q3JRR3 ATP phosphoribosyltransferase regulatory subunit 4.80e-10 7.02e-20 NA 0.6567
2. PF Q2K9R4 Proline--tRNA ligase 1.32e-07 5.30e-09 NA 0.5048
2. PF Q3SL58 ATP phosphoribosyltransferase regulatory subunit 1.94e-10 9.83e-03 NA 0.7101
2. PF B1LUL8 Proline--tRNA ligase 1.45e-07 4.91e-08 NA 0.506
2. PF Q28TI5 Proline--tRNA ligase 9.82e-07 9.62e-09 NA 0.508
2. PF Q2YNE3 Proline--tRNA ligase 1.17e-07 6.02e-09 NA 0.4996
2. PF Q31C25 Proline--tRNA ligase 3.35e-05 7.42e-04 NA 0.5104
2. PF Q8YM83 Proline--tRNA ligase 1.02e-05 7.01e-03 NA 0.5038
2. PF A1TM36 ATP phosphoribosyltransferase regulatory subunit 1.22e-10 1.47e-20 NA 0.689
2. PF C3PNA1 Proline--tRNA ligase 1.49e-07 5.02e-08 NA 0.4942
2. PF Q6G3A4 Proline--tRNA ligase 4.30e-08 2.20e-08 NA 0.4966
2. PF A1USY3 Proline--tRNA ligase 6.75e-07 9.42e-08 NA 0.4998
2. PF Q2KYA6 ATP phosphoribosyltransferase regulatory subunit 1.91e-08 3.54e-21 NA 0.6697
2. PF A8G3M4 Proline--tRNA ligase 2.19e-05 1.67e-04 NA 0.4986
2. PF C5BRH1 ATP phosphoribosyltransferase regulatory subunit 3.08e-10 1.59e-18 NA 0.6794
2. PF A3NA43 ATP phosphoribosyltransferase regulatory subunit 4.97e-10 8.20e-20 NA 0.6613
2. PF Q1MRD0 Proline--tRNA ligase 9.70e-07 1.12e-04 NA 0.5008
2. PF Q1MIJ6 Proline--tRNA ligase 1.32e-07 4.11e-09 NA 0.5078
2. PF Q82V28 ATP phosphoribosyltransferase regulatory subunit 2.73e-11 2.05e-20 NA 0.6608
2. PF Q74D59 Proline--tRNA ligase 5.86e-06 9.55e-04 NA 0.4996
2. PF B7V202 ATP phosphoribosyltransferase regulatory subunit 1.14e-10 1.05e-24 NA 0.7067
2. PF A9MAJ9 Proline--tRNA ligase 2.44e-07 6.30e-09 NA 0.4997
2. PF A4VQN6 ATP phosphoribosyltransferase regulatory subunit 9.60e-11 1.36e-23 NA 0.7079
2. PF B1JAD0 ATP phosphoribosyltransferase regulatory subunit 1.61e-10 1.04e-22 NA 0.7035
2. PF Q116D3 Proline--tRNA ligase 1.36e-06 1.49e-02 NA 0.5017
2. PF Q46GR7 Proline--tRNA ligase 1.15e-05 2.14e-03 NA 0.523
2. PF A4JEN0 ATP phosphoribosyltransferase regulatory subunit 3.30e-10 3.13e-19 NA 0.6873
2. PF Q8UFV9 Proline--tRNA ligase 1.17e-07 1.60e-08 NA 0.5085
2. PF Q7V2H0 Proline--tRNA ligase 4.84e-06 2.27e-04 NA 0.5178
2. PF Q7U5D6 Proline--tRNA ligase 5.08e-05 8.59e-03 NA 0.5018
2. PF A8EZ51 Proline--tRNA ligase 6.72e-07 2.69e-08 NA 0.5041
2. PF B4RBZ9 Proline--tRNA ligase 3.72e-07 1.24e-07 NA 0.5042
2. PF Q8YGL8 Proline--tRNA ligase 6.46e-08 5.55e-09 NA 0.5012
2. PF B0BC28 Proline--tRNA ligase 7.06e-07 1.47e-02 NA 0.4965
2. PF Q1GFI1 Proline--tRNA ligase 3.89e-07 3.89e-08 NA 0.5163
2. PF A2C7N5 Proline--tRNA ligase 3.02e-05 2.72e-02 NA 0.5128
2. PF Q6FCS8 ATP phosphoribosyltransferase regulatory subunit 3.98e-09 6.26e-23 NA 0.6596
2. PF Q2SBC7 ATP phosphoribosyltransferase regulatory subunit 2.45e-08 7.98e-24 NA 0.6877
2. PF A9BED0 Proline--tRNA ligase 6.55e-05 2.35e-02 NA 0.5058
2. PF B7KPK1 Proline--tRNA ligase 1.35e-07 7.65e-08 NA 0.508
2. PF Q1BGW5 ATP phosphoribosyltransferase regulatory subunit 3.38e-10 1.32e-19 NA 0.6856
2. PF B7K9K1 Proline--tRNA ligase 7.74e-06 1.57e-03 NA 0.5073
2. PF A5W9S6 ATP phosphoribosyltransferase regulatory subunit 1.54e-10 1.27e-22 NA 0.6919
2. PF Q0I8J8 Proline--tRNA ligase 6.25e-05 2.49e-03 NA 0.5122
2. PF Q7VD75 Proline--tRNA ligase 7.16e-05 1.44e-02 NA 0.4903
2. PF Q8G197 Proline--tRNA ligase 1.44e-07 7.57e-09 NA 0.4965
2. PF Q88DD7 ATP phosphoribosyltransferase regulatory subunit 1.73e-10 1.27e-22 NA 0.701
2. PF C4K2D7 Proline--tRNA ligase 1.30e-07 2.69e-08 NA 0.4943
2. PF A8GN90 Proline--tRNA ligase 1.52e-07 9.96e-09 NA 0.4866
2. PF B8IZD1 Proline--tRNA ligase 1.76e-05 1.56e-04 NA 0.5016
2. PF B8HNJ7 Proline--tRNA ligase 1.50e-05 2.11e-02 NA 0.5066
2. PF B0KKZ1 ATP phosphoribosyltransferase regulatory subunit 1.37e-10 9.44e-23 NA 0.6925
2. PF B2S561 Proline--tRNA ligase 9.58e-08 6.02e-09 NA 0.4957
2. PF Q30Z93 Proline--tRNA ligase 1.46e-06 4.09e-03 NA 0.4889
2. PF B2JIU1 ATP phosphoribosyltransferase regulatory subunit 1.64e-09 2.36e-20 NA 0.6882
2. PF Q1QY22 ATP phosphoribosyltransferase regulatory subunit 7.66e-11 8.20e-20 NA 0.6805
2. PF Q3IZS9 Proline--tRNA ligase 2.23e-07 8.09e-07 NA 0.5143
2. PF C4XTD0 Proline--tRNA ligase 1.39e-06 3.32e-03 NA 0.5097
2. PF A2S2B2 ATP phosphoribosyltransferase regulatory subunit 3.96e-10 7.02e-20 NA 0.6597
2. PF Q6N5P6 Proline--tRNA ligase 5.44e-07 2.03e-08 NA 0.5036
2. PF Q7W6Q6 ATP phosphoribosyltransferase regulatory subunit 1.27e-09 1.47e-20 NA 0.6678
2. PF Q6FZX5 Proline--tRNA ligase 1.62e-07 3.93e-09 NA 0.5009
2. PF Q4KJ69 ATP phosphoribosyltransferase regulatory subunit 1.45e-10 9.43e-24 NA 0.6964
2. PF Q8DKT0 Proline--tRNA ligase 7.30e-06 4.64e-02 NA 0.5014
2. PF Q3AWR9 Proline--tRNA ligase 2.50e-06 7.70e-04 NA 0.497
2. PF C0RIF7 Proline--tRNA ligase 1.24e-07 5.55e-09 NA 0.4978
2. PF B6JH58 Proline--tRNA ligase 4.60e-07 1.66e-08 NA 0.5044
2. PF Q1LLK0 ATP phosphoribosyltransferase regulatory subunit 3.09e-10 1.37e-19 NA 0.6486
2. PF B1YR34 ATP phosphoribosyltransferase regulatory subunit 2.82e-10 3.23e-19 NA 0.6898
2. PF Q57DT1 Proline--tRNA ligase 2.46e-07 6.02e-09 NA 0.4986
2. PF Q215F8 Proline--tRNA ligase 5.28e-07 3.11e-09 NA 0.5048
2. PF B0ULM2 Proline--tRNA ligase 2.22e-07 3.81e-08 NA 0.4999
2. PF A5GJD3 Proline--tRNA ligase 1.87e-05 1.23e-03 NA 0.4921
2. PF B3R1J2 ATP phosphoribosyltransferase regulatory subunit 3.89e-10 3.33e-19 NA 0.6822
2. PF Q7VWM0 ATP phosphoribosyltransferase regulatory subunit 2.19e-08 1.31e-21 NA 0.6804
2. PF B5ZYN2 Proline--tRNA ligase 1.15e-07 2.35e-08 NA 0.5102
2. PF Q9ZDE7 Proline--tRNA ligase 1.98e-07 1.17e-08 NA 0.4985
2. PF B2U9V9 ATP phosphoribosyltransferase regulatory subunit 5.70e-09 1.86e-19 NA 0.6803
2. PF Q4ULX2 Proline--tRNA ligase 1.19e-07 3.30e-09 NA 0.5021
2. PF Q2JMD8 Proline--tRNA ligase 2.61e-06 3.56e-03 NA 0.5042
2. PF Q3SRG6 Proline--tRNA ligase 4.10e-07 3.34e-09 NA 0.5051
2. PF Q39FR9 ATP phosphoribosyltransferase regulatory subunit 4.40e-10 1.21e-19 NA 0.6868
2. PF A0L8I2 Proline--tRNA ligase 2.32e-06 2.88e-02 NA 0.5079
2. PF Q21HA7 ATP phosphoribosyltransferase regulatory subunit 2.99e-10 3.71e-19 NA 0.6701
2. PF A5V8U0 Proline--tRNA ligase 1.07e-07 2.23e-07 NA 0.5092
2. PF A2BPZ0 Proline--tRNA ligase 1.31e-04 7.52e-05 NA 0.5022
2. PF Q48NZ8 ATP phosphoribosyltransferase regulatory subunit 9.97e-11 2.56e-23 NA 0.6918
2. PF Q7WHP0 ATP phosphoribosyltransferase regulatory subunit 1.60e-09 1.47e-20 NA 0.6655
2. PF P36431 Proline--tRNA ligase 1.31e-06 1.33e-02 NA 0.4965
2. PF Q0AYJ4 Proline--tRNA ligase 7.60e-07 4.45e-03 NA 0.511
2. PF Q9PK01 Proline--tRNA ligase 2.00e-06 3.04e-03 NA 0.4963
2. PF B7K1H5 Proline--tRNA ligase 8.45e-06 4.94e-03 NA 0.4992
2. PF A4X5V6 Proline--tRNA ligase 5.42e-07 1.05e-03 NA 0.509
2. PF B0C230 Proline--tRNA ligase 4.86e-07 4.85e-03 NA 0.498
2. PF Q3KLW0 Proline--tRNA ligase 1.18e-06 1.20e-02 NA 0.5017
2. PF Q253K4 Proline--tRNA ligase 1.18e-06 2.66e-04 NA 0.5081
2. PF Q1QLA8 Proline--tRNA ligase 4.35e-07 5.00e-09 NA 0.5041
2. PF A1U4C1 ATP phosphoribosyltransferase regulatory subunit 8.40e-11 1.17e-21 NA 0.6681
2. PF Q7U6R1 ATP phosphoribosyltransferase regulatory subunit 1.37e-10 1.07e-28 NA 0.7292
2. PF A5VQ02 Proline--tRNA ligase 2.44e-07 8.49e-09 NA 0.5055
2. PF Q92I92 Proline--tRNA ligase 3.26e-08 5.02e-08 NA 0.493
2. PF Q62JX4 ATP phosphoribosyltransferase regulatory subunit 4.28e-10 7.02e-20 NA 0.6588
2. PF C3KDW7 ATP phosphoribosyltransferase regulatory subunit 1.09e-10 5.22e-23 NA 0.6975
2. PF A6VD52 ATP phosphoribosyltransferase regulatory subunit 1.40e-10 7.49e-25 NA 0.7032
2. PF Q3MAQ7 Proline--tRNA ligase 1.05e-05 1.20e-02 NA 0.5029
2. PF B3Q7L2 Proline--tRNA ligase 5.59e-07 1.86e-08 NA 0.4878
2. PF A3PMH0 Proline--tRNA ligase 8.16e-07 1.22e-06 NA 0.514
2. PF B2IDI9 Proline--tRNA ligase 7.25e-08 2.03e-08 NA 0.5001
2. PF A1V4J0 ATP phosphoribosyltransferase regulatory subunit 4.58e-10 7.02e-20 NA 0.6564
2. PF Q02F79 ATP phosphoribosyltransferase regulatory subunit 1.09e-10 1.05e-24 NA 0.7059
2. PF A1VE74 Proline--tRNA ligase 7.64e-07 3.21e-03 NA 0.4989
2. PF Q46ZJ2 ATP phosphoribosyltransferase regulatory subunit 4.86e-10 1.89e-19 NA 0.6867
2. PF Q1QD26 ATP phosphoribosyltransferase regulatory subunit 2.88e-08 1.38e-21 NA 0.6344
2. PF A6X1L5 Proline--tRNA ligase 1.20e-07 2.38e-09 NA 0.4997
2. PF Q63US3 ATP phosphoribosyltransferase regulatory subunit 4.64e-10 7.02e-20 NA 0.65
2. PF A4XPZ2 ATP phosphoribosyltransferase regulatory subunit 1.18e-10 2.10e-22 NA 0.7023
2. PF Q5N044 Proline--tRNA ligase 1.09e-05 9.34e-03 NA 0.5048
2. PF A1K3Z9 ATP phosphoribosyltransferase regulatory subunit 2.53e-08 1.40e-20 NA 0.6868
2. PF Q2SWD4 ATP phosphoribosyltransferase regulatory subunit 4.07e-10 6.50e-20 NA 0.6684
2. PF B3PW17 Proline--tRNA ligase 1.37e-07 1.02e-08 NA 0.5042
2. PF Q1I453 ATP phosphoribosyltransferase regulatory subunit 1.64e-10 9.60e-23 NA 0.6996
2. PF Q824A9 Proline--tRNA ligase 2.56e-06 1.72e-03 NA 0.5051
2. PF A9IK79 ATP phosphoribosyltransferase regulatory subunit 2.92e-10 4.56e-21 NA 0.665
2. PF Q3KIY5 ATP phosphoribosyltransferase regulatory subunit 1.17e-10 4.89e-23 NA 0.6983
2. PF A9W1L5 Proline--tRNA ligase 1.44e-07 9.95e-08 NA 0.5123
2. PF Q7NBP5 Proline--tRNA ligase 9.17e-07 3.50e-02 NA 0.5094
2. PF Q72CD8 Proline--tRNA ligase 1.10e-06 2.28e-03 NA 0.4917
2. PF A3PBN3 Proline--tRNA ligase 1.37e-04 7.10e-05 NA 0.5062
2. PF Q4FTX3 ATP phosphoribosyltransferase regulatory subunit 9.79e-09 5.61e-21 NA 0.6485
2. PF A7INT8 Proline--tRNA ligase 1.95e-07 1.28e-06 NA 0.5038
2. PF A2C0W8 Proline--tRNA ligase 4.20e-06 2.45e-03 NA 0.5143
2. PF C6BYX7 Proline--tRNA ligase 9.87e-06 1.17e-02 NA 0.4935
2. PF P73942 Proline--tRNA ligase 1.05e-05 1.57e-02 NA 0.5131
2. PF Q31LT0 Proline--tRNA ligase 1.19e-05 1.33e-02 NA 0.5039
2. PF Q3A6R6 Proline--tRNA ligase 2.20e-06 1.56e-03 NA 0.502
2. PF B1JT82 ATP phosphoribosyltransferase regulatory subunit 3.40e-10 9.00e-20 NA 0.689
2. PF Q2RU19 Proline--tRNA ligase 7.13e-08 4.21e-08 NA 0.5132
2. PF Q2IWW0 Proline--tRNA ligase 5.64e-07 6.16e-09 NA 0.5052
2. PF B0JTD7 Proline--tRNA ligase 1.08e-06 1.39e-03 NA 0.495
2. PF A8GRW1 Proline--tRNA ligase 9.20e-08 3.08e-08 NA 0.4929
3. BF A5VTT5 ATP phosphoribosyltransferase regulatory subunit 3.86e-07 NA 5.42e-06 0.5896
3. BF C0RKC8 ATP phosphoribosyltransferase regulatory subunit 3.67e-07 NA 5.33e-06 0.538
3. BF P64378 ATP phosphoribosyltransferase regulatory subunit 3.60e-07 NA 5.21e-06 0.5804
3. BF Q2YIH8 ATP phosphoribosyltransferase regulatory subunit 4.56e-07 NA 5.26e-06 0.5793
3. BF Q579Q7 ATP phosphoribosyltransferase regulatory subunit 4.42e-07 NA 5.26e-06 0.5795
3. BF B2SCY8 ATP phosphoribosyltransferase regulatory subunit 3.68e-07 NA 5.42e-06 0.5719
3. BF A9WXP4 ATP phosphoribosyltransferase regulatory subunit 3.94e-07 NA 5.33e-06 0.5864
3. BF Q03K76 ATP phosphoribosyltransferase regulatory subunit 2.85e-08 NA 2.20e-07 0.6864
3. BF A9MDU5 ATP phosphoribosyltransferase regulatory subunit 4.02e-07 NA 5.33e-06 0.591
3. BF P64377 ATP phosphoribosyltransferase regulatory subunit 3.64e-07 NA 5.21e-06 0.5461
4. PB Q5F938 Proline--tRNA ligase 2.85e-06 9.22e-04 0.017 NA
4. PB P12081 Histidine--tRNA ligase, cytoplasmic 8.01e-12 1.20e-18 1.75e-16 NA
4. PB Q2GK70 Proline--tRNA ligase 3.64e-07 1.73e-07 1.14e-04 NA
4. PB Q7WFN9 Proline--tRNA ligase 4.20e-06 1.09e-02 0.005 NA
4. PB Q61035 Histidine--tRNA ligase, cytoplasmic 1.11e-11 2.25e-18 6.73e-15 NA
4. PB Q0T815 Proline--tRNA ligase 3.39e-06 5.35e-04 3.61e-04 NA
4. PB A7Z968 ATP phosphoribosyltransferase regulatory subunit 8.33e-12 2.54e-30 1.08e-23 NA
4. PB Q7VTZ8 Proline--tRNA ligase 1.06e-05 1.18e-02 0.005 NA
4. PB Q0I4S8 Proline--tRNA ligase 1.29e-05 6.84e-04 0.001 NA
4. PB Q6E6B4 Probable histidine--tRNA ligase, cytoplasmic 2.30e-11 6.99e-40 1.85e-19 NA
4. PB Q5R4R2 Histidine--tRNA ligase, cytoplasmic 8.01e-12 7.25e-19 1.99e-16 NA
4. PB Q6ADR4 Histidine--tRNA ligase 1.92e-11 2.24e-40 1.45e-07 NA
4. PB A7I1R8 Proline--tRNA ligase 2.72e-06 2.49e-04 0.006 NA
4. PB Q2G1Z4 Proline--tRNA ligase 5.49e-06 1.09e-03 0.013 NA
4. PB Q30S93 Proline--tRNA ligase 9.12e-07 1.46e-08 0.006 NA
4. PB A6U7Z3 Proline--tRNA ligase 1.81e-07 7.23e-09 3.73e-04 NA
4. PB B1L8Y1 Proline--tRNA ligase 1.39e-05 1.47e-03 9.47e-05 NA
4. PB A6LJ40 Proline--tRNA ligase 6.89e-06 5.31e-04 3.95e-05 NA
4. PB P34183 Histidine--tRNA ligase 1.89e-12 6.41e-15 1.99e-18 NA
4. PB Q3ZXL5 ATP phosphoribosyltransferase regulatory subunit 1.36e-11 9.90e-39 4.88e-17 NA
4. PB B9KBD7 Proline--tRNA ligase 1.22e-05 1.02e-03 2.76e-05 NA
4. PB B7LHA4 Proline--tRNA ligase 1.07e-06 6.54e-04 3.43e-04 NA
4. PB A3DJE9 ATP phosphoribosyltransferase regulatory subunit 5.55e-14 4.20e-41 1.75e-19 NA
4. PB Q92QN2 Proline--tRNA ligase 1.22e-07 6.60e-09 0.030 NA
4. PB B7UJ96 Proline--tRNA ligase 3.41e-06 9.73e-04 0.002 NA
4. PB Q6GHH2 Proline--tRNA ligase 4.92e-06 1.98e-03 0.013 NA
4. PB Q8CXM7 ATP phosphoribosyltransferase regulatory subunit 5.18e-13 6.12e-34 2.97e-13 NA
4. PB B8FP16 ATP phosphoribosyltransferase regulatory subunit 1.10e-12 3.30e-25 5.93e-19 NA
4. PB E9QI36 Histidine--tRNA ligase 8.43e-12 2.06e-21 2.57e-13 NA
4. PB Q99UK9 Proline--tRNA ligase 4.98e-06 2.51e-03 0.014 NA
4. PB A1A7N8 Proline--tRNA ligase 1.10e-06 9.73e-04 0.002 NA
4. PB A7ZD35 Proline--tRNA ligase 1.61e-05 4.10e-05 1.48e-04 NA
4. PB Q5HGG8 Proline--tRNA ligase 5.00e-06 1.08e-03 0.013 NA
4. PB O66690 Proline--tRNA ligase 4.39e-06 3.61e-05 0.016 NA
4. PB A7H4J9 Proline--tRNA ligase 4.35e-06 1.63e-05 3.61e-04 NA
4. PB Q87VJ8 ATP phosphoribosyltransferase regulatory subunit 7.94e-11 3.40e-23 5.48e-06 NA
4. PB B7M1Z9 Proline--tRNA ligase 1.05e-06 5.35e-04 3.61e-04 NA
4. PB A4ISR8 ATP phosphoribosyltransferase regulatory subunit 2.90e-10 3.96e-30 8.40e-23 NA
4. PB B7LW79 Proline--tRNA ligase 1.05e-06 1.03e-03 0.002 NA
4. PB Q7A5Y3 Proline--tRNA ligase 5.03e-06 2.51e-03 0.014 NA
4. PB A6TL31 Proline--tRNA ligase 2.72e-06 3.34e-05 0.014 NA
4. PB Q5QW31 Proline--tRNA ligase 3.76e-06 1.72e-03 0.047 NA
4. PB Q55D12 Probable histidine--tRNA ligase, mitochondrial 0.00e+00 4.99e-20 8.45e-56 NA
4. PB Q5SM14 ATP phosphoribosyltransferase regulatory subunit 6.20e-10 2.65e-21 5.11e-08 NA
4. PB Q83MC8 Proline--tRNA ligase 1.12e-06 5.35e-04 3.61e-04 NA
4. PB A4W6T9 Proline--tRNA ligase 7.95e-07 4.26e-04 4.15e-04 NA
4. PB Q9CDT4 Proline--tRNA ligase 3.72e-06 4.71e-02 0.002 NA
4. PB B1XD64 Proline--tRNA ligase 1.06e-06 6.84e-04 3.98e-04 NA
4. PB P49590 Histidine--tRNA ligase, mitochondrial 1.79e-12 2.74e-14 1.74e-13 NA
4. PB B1MY62 Proline--tRNA ligase 1.21e-06 1.27e-04 6.44e-06 NA
4. PB A7ZHT6 Proline--tRNA ligase 3.17e-06 4.89e-04 4.34e-04 NA
4. PB Q5KVC4 ATP phosphoribosyltransferase regulatory subunit 3.78e-10 2.63e-30 1.31e-22 NA
4. PB Q0VRL1 Proline--tRNA ligase 4.64e-06 3.35e-03 0.005 NA
4. PB B1IQE6 Proline--tRNA ligase 3.31e-06 5.35e-04 3.61e-04 NA
4. PB A5FR32 ATP phosphoribosyltransferase regulatory subunit 1.30e-11 1.93e-40 1.00e-16 NA
4. PB Q58406 Histidine--tRNA ligase 1.33e-14 9.49e-50 1.66e-46 NA
4. PB P16659 Proline--tRNA ligase 4.66e-06 6.84e-04 3.98e-04 NA
4. PB C4V9J0 Probable histidine--tRNA ligase, cytoplasmic 7.60e-13 5.42e-41 6.11e-18 NA
4. PB B2VDZ9 Proline--tRNA ligase 4.71e-06 4.18e-04 0.006 NA
4. PB A5ISE7 Proline--tRNA ligase 5.04e-06 2.51e-03 0.014 NA
4. PB A7ZWE2 Proline--tRNA ligase 3.25e-06 5.35e-04 3.61e-04 NA
4. PB A7X1P3 Proline--tRNA ligase 2.97e-06 2.51e-03 0.014 NA
4. PB A5D7V9 Histidine--tRNA ligase, mitochondrial 1.94e-12 1.03e-13 7.01e-14 NA
4. PB O34459 ATP phosphoribosyltransferase regulatory subunit 3.71e-10 4.88e-32 1.99e-19 NA
4. PB Q7A120 Proline--tRNA ligase 4.98e-06 2.51e-03 0.014 NA
4. PB A1VYQ2 Proline--tRNA ligase 5.22e-06 2.59e-05 3.03e-04 NA
4. PB P07263 Histidine--tRNA ligase, mitochondrial 2.17e-11 1.27e-17 5.15e-14 NA
4. PB Q65EF7 ATP phosphoribosyltransferase regulatory subunit 2.24e-10 6.06e-30 1.33e-20 NA
4. PB P62360 ATP phosphoribosyltransferase regulatory subunit 6.56e-10 2.65e-21 5.11e-08 NA
4. PB A7GYU6 Proline--tRNA ligase 9.40e-06 1.89e-05 4.44e-06 NA
4. PB Q9CL72 Proline--tRNA ligase 2.28e-06 9.55e-04 0.005 NA
4. PB Q47Z50 Proline--tRNA ligase 2.25e-06 1.25e-03 0.001 NA
4. PB B1XU84 ATP phosphoribosyltransferase regulatory subunit 1.53e-08 9.29e-20 1.91e-05 NA
4. PB Q99KK9 Histidine--tRNA ligase, mitochondrial 2.22e-15 6.08e-13 7.30e-15 NA
4. PB Q8SRR3 Probable histidine--tRNA ligase, cytoplasmic 2.16e-12 2.53e-42 7.50e-19 NA
4. PB B5Z0H4 Proline--tRNA ligase 3.34e-06 6.66e-04 3.52e-04 NA
4. PB Q1RFZ4 Proline--tRNA ligase 3.16e-06 9.73e-04 0.002 NA
4. PB P70076 Histidine--tRNA ligase, cytoplasmic 7.58e-12 1.44e-14 5.45e-15 NA
4. PB B7MP55 Proline--tRNA ligase 3.16e-06 9.73e-04 0.002 NA
4. PB Q7L3T8 Probable proline--tRNA ligase, mitochondrial 5.09e-07 9.75e-03 4.13e-04 NA
4. PB Q8X8W2 Proline--tRNA ligase 1.77e-06 6.66e-04 3.52e-04 NA
4. PB Q5HVM3 Proline--tRNA ligase 3.57e-06 1.77e-05 3.28e-04 NA
4. PB Q9WYY4 Proline--tRNA ligase 1.18e-05 2.03e-03 3.44e-04 NA
4. PB B1LGZ7 Proline--tRNA ligase 1.05e-06 9.73e-04 0.002 NA
4. PB A9I4I5 Proline--tRNA ligase 4.28e-06 1.15e-02 0.010 NA
4. PB O82413 Histidine--tRNA ligase, chloroplastic/mitochondrial 1.11e-16 1.15e-12 4.38e-34 NA
4. PB Q890M2 Proline--tRNA ligase 6.08e-06 2.27e-04 8.48e-04 NA
4. PB B7NKX8 Proline--tRNA ligase 3.45e-06 9.73e-04 5.49e-04 NA
4. PB A6QGG3 Proline--tRNA ligase 5.56e-06 1.09e-03 0.013 NA
4. PB A1S4R2 Proline--tRNA ligase 3.90e-06 9.19e-03 1.17e-04 NA
4. PB C4ZRT7 Proline--tRNA ligase 3.04e-06 6.84e-04 3.98e-04 NA
4. PB Q2YXK5 Proline--tRNA ligase 2.62e-06 4.23e-03 0.015 NA
4. PB B8CW65 Proline--tRNA ligase 3.91e-06 2.25e-04 4.51e-05 NA
4. PB A1KUG4 Proline--tRNA ligase 6.93e-06 5.21e-04 0.041 NA
4. PB Q24QI7 ATP phosphoribosyltransferase regulatory subunit 2.51e-12 7.88e-26 5.07e-18 NA
4. PB O67223 ATP phosphoribosyltransferase regulatory subunit 1.86e-12 8.65e-41 1.76e-10 NA
4. PB A8Z3U3 Proline--tRNA ligase 4.99e-06 1.09e-03 0.013 NA
4. PB B7MBH6 Proline--tRNA ligase 3.33e-06 9.73e-04 0.002 NA
4. PB A8FHR5 ATP phosphoribosyltransferase regulatory subunit 2.36e-10 4.03e-32 4.46e-23 NA
4. PB A6T4Z7 Proline--tRNA ligase 8.90e-07 1.04e-03 0.003 NA
4. PB B6HZR3 Proline--tRNA ligase 2.83e-06 5.35e-04 3.61e-04 NA
4. PB O43011 Histidine--tRNA ligase, mitochondrial 1.27e-11 2.49e-15 8.54e-11 NA
4. PB Q2KI84 Histidine--tRNA ligase, cytoplasmic 1.14e-11 1.43e-18 2.47e-15 NA
4. PB Q3Z876 ATP phosphoribosyltransferase regulatory subunit 2.59e-12 5.99e-42 3.22e-17 NA
4. PB B2KCB2 Proline--tRNA ligase 4.13e-06 3.32e-04 0.009 NA
4. PB Q2GE40 Proline--tRNA ligase 9.94e-07 3.37e-08 0.013 NA
4. PB Q7W481 Proline--tRNA ligase 1.14e-05 1.30e-02 0.004 NA
4. PB Q8RIE2 Proline--tRNA ligase 3.33e-06 3.53e-03 3.24e-05 NA
4. PB A5IJQ9 Proline--tRNA ligase 1.19e-05 2.84e-03 3.13e-04 NA
4. PB Q5R5E5 Histidine--tRNA ligase, mitochondrial 3.66e-15 5.63e-14 2.44e-13 NA
4. PB A4G8R0 Proline--tRNA ligase 2.38e-06 7.01e-03 1.34e-04 NA
4. PB Q2RVD9 ATP phosphoribosyltransferase regulatory subunit 1.50e-09 2.86e-14 1.28e-05 NA
4. PB Q2FXU4 Histidine--tRNA ligase 0.00e+00 4.88e-63 3.31e-98 NA
4. PB A8FKW6 Proline--tRNA ligase 3.86e-06 2.22e-05 7.90e-04 NA
4. PB Q9JU09 Proline--tRNA ligase 5.52e-06 3.61e-04 0.043 NA
4. PB A7MI22 Proline--tRNA ligase 1.06e-06 3.96e-04 4.01e-05 NA
4. PB Q2W2D0 ATP phosphoribosyltransferase regulatory subunit 1.59e-09 8.89e-17 1.97e-07 NA
4. PB A6T2D1 Proline--tRNA ligase 9.32e-06 2.24e-02 3.53e-04 NA
4. PB Q39QK2 ATP phosphoribosyltransferase regulatory subunit 1.05e-12 6.20e-43 9.64e-20 NA
4. PB Q6A8J7 Histidine--tRNA ligase 1.09e-09 4.55e-47 5.10e-12 NA
4. PB A6VXT1 Proline--tRNA ligase 7.96e-06 1.13e-03 0.041 NA
4. PB Q3Z5G3 Proline--tRNA ligase 3.13e-06 5.35e-04 3.61e-04 NA
4. PB Q7MQS0 ATP phosphoribosyltransferase regulatory subunit 2.02e-08 4.95e-02 9.95e-08 NA
4. PB B5E3C8 Histidine--tRNA ligase NA 1.21e-62 3.43e-101 NA
4. PB Q0TLD7 Proline--tRNA ligase 4.54e-06 9.73e-04 0.002 NA
4. PB Q9PHX1 Proline--tRNA ligase 4.30e-06 2.57e-05 3.06e-04 NA
4. PB A6U182 Proline--tRNA ligase 5.04e-06 2.51e-03 0.014 NA
4. PB Q2FHH5 Proline--tRNA ligase 5.04e-06 1.09e-03 0.013 NA
4. PB Q9RUE3 ATP phosphoribosyltransferase regulatory subunit 2.72e-09 9.67e-19 1.65e-06 NA
4. PB B7N862 Proline--tRNA ligase 8.18e-07 6.36e-04 3.31e-04 NA
4. PB B0UWK9 Proline--tRNA ligase 1.21e-06 2.36e-04 0.001 NA
4. PB B7IFB6 Proline--tRNA ligase 3.26e-06 1.82e-04 7.47e-06 NA
4. PB Q7VHL1 ATP phosphoribosyltransferase regulatory subunit 6.49e-08 1.53e-03 0.002 NA
4. PB Q32JR3 Proline--tRNA ligase 4.35e-06 4.11e-04 3.71e-04 NA
4. PB Q86AS6 Histidine--tRNA ligase, cytoplasmic 6.62e-13 1.43e-27 1.32e-29 NA
4. PB Q73KJ8 Proline--tRNA ligase 9.74e-06 1.07e-04 0.010 NA
4. PB P9WFV5 Histidine--tRNA ligase 0.00e+00 4.00e-68 2.51e-71 NA
4. PB Q9JZ14 Proline--tRNA ligase 6.90e-06 5.55e-04 0.027 NA
4. PB C0QTI8 Proline--tRNA ligase 1.97e-06 5.38e-03 0.002 NA
4. PB B2U338 Proline--tRNA ligase 3.51e-06 5.35e-04 3.61e-04 NA
4. PB Q15WD6 Proline--tRNA ligase 1.01e-05 2.76e-03 3.67e-04 NA
4. PB B9KGB1 Proline--tRNA ligase 1.36e-05 5.03e-05 1.36e-05 NA
4. PB A4SYD2 ATP phosphoribosyltransferase regulatory subunit 1.51e-08 1.14e-19 2.56e-04 NA
4. PB B5Y1H7 Proline--tRNA ligase 3.88e-06 1.05e-03 0.003 NA
4. PB Q325U6 Proline--tRNA ligase 3.14e-06 5.35e-04 3.61e-04 NA
4. PB P60906 Histidine--tRNA ligase 0.00e+00 2.11e-61 2.71e-85 NA
4. PB C5D7P4 ATP phosphoribosyltransferase regulatory subunit 6.93e-12 8.53e-28 3.58e-21 NA
4. PB Q6G9V0 Proline--tRNA ligase 2.64e-06 3.18e-03 0.014 NA
4. PB Q8FKZ4 Proline--tRNA ligase 3.17e-06 9.73e-04 0.002 NA
4. PB Q2SD07 Proline--tRNA ligase 1.22e-05 1.78e-03 0.003 NA
4. PB A8ERT9 Proline--tRNA ligase 8.47e-06 4.38e-04 1.99e-05 NA
4. PB Q9KA71 Proline--tRNA ligase 4.46e-06 7.16e-04 9.28e-07 NA
5. P Q2YZB2 ATP phosphoribosyltransferase regulatory subunit 9.78e-06 9.34e-03 NA NA
5. P A7GRE9 Proline--tRNA ligase 1.02e-05 1.04e-04 NA NA
5. P A8H6J5 Proline--tRNA ligase 1.47e-05 1.83e-03 NA NA
5. P C0ZF57 Proline--tRNA ligase 2.00e-06 1.96e-03 NA NA
5. P Q4KH98 Proline--tRNA ligase 6.44e-06 1.78e-02 NA NA
5. P B8GND2 ATP phosphoribosyltransferase regulatory subunit 2.33e-11 2.83e-21 NA NA
5. P Q9ZMJ6 Proline--tRNA ligase 1.14e-06 3.29e-04 NA NA
5. P Q2J529 Proline--tRNA ligase 9.92e-07 1.60e-02 NA NA
5. P Q1I6D7 Proline--tRNA ligase 6.91e-06 8.96e-03 NA NA
5. P Q9KTM7 Proline--tRNA ligase 1.32e-06 2.99e-03 NA NA
5. P O27429 S-adenosylmethionine synthase 4.48e-01 1.97e-04 NA NA
5. P A1SZR1 Proline--tRNA ligase 3.24e-06 2.52e-04 NA NA
5. P A9AH05 ATP phosphoribosyltransferase regulatory subunit 3.73e-10 2.45e-19 NA NA
5. P P64379 ATP phosphoribosyltransferase regulatory subunit 9.69e-06 7.56e-03 NA NA
5. P A0KV13 Proline--tRNA ligase 3.88e-06 3.03e-02 NA NA
5. P Q48R89 Proline--tRNA ligase 9.09e-06 1.66e-02 NA NA
5. P Q2A4E9 Proline--tRNA ligase 1.22e-05 1.52e-04 NA NA
5. P P66768 Uncharacterized protein SPy_0538/M5005_Spy0445 1.92e-01 3.44e-03 NA NA
5. P Q8CFI5 Probable proline--tRNA ligase, mitochondrial 3.12e-08 1.82e-02 NA NA
5. P O59488 S-adenosylmethionine synthase 3.47e-01 5.07e-04 NA NA
5. P A0RHJ2 Proline--tRNA ligase 1 9.05e-06 3.89e-04 NA NA
5. P A7HKV2 Proline--tRNA ligase 3.53e-06 8.89e-04 NA NA
5. P B1JD82 Proline--tRNA ligase 5.84e-06 1.57e-02 NA NA
5. P C1B2Z4 Proline--tRNA ligase 1.86e-05 2.87e-04 NA NA
5. P A5F340 Proline--tRNA ligase 1.38e-06 2.99e-03 NA NA
5. P B5R5J8 Proline--tRNA ligase 3.32e-06 1.22e-03 NA NA
5. P Q8NP31 Proline--tRNA ligase 4.89e-06 1.08e-03 NA NA
5. P Q8PWS4 S-adenosylmethionine synthase 3.31e-01 3.20e-04 NA NA
5. P F8DT95 Proline--tRNA ligase 1.90e-07 7.56e-08 NA NA
5. P B7VIT2 Proline--tRNA ligase 8.44e-07 2.14e-03 NA NA
5. P B4SJ64 Proline--tRNA ligase 6.20e-06 6.83e-03 NA NA
5. P Q97CT6 S-adenosylmethionine synthase 2.66e-01 4.88e-05 NA NA
5. P Q9V1P7 S-adenosylmethionine synthase 3.37e-01 2.92e-04 NA NA
5. P Q31GN5 ATP phosphoribosyltransferase regulatory subunit 6.32e-11 2.16e-21 NA NA
5. P P0DJA8 Proline--tRNA ligase 1.94e-07 1.29e-07 NA NA
5. P Q81WL6 Proline--tRNA ligase 1 9.70e-06 3.89e-04 NA NA
5. P A6U565 ATP phosphoribosyltransferase regulatory subunit 1.16e-05 7.56e-03 NA NA
5. P A4J5Y2 Proline--tRNA ligase 2.86e-06 1.85e-03 NA NA
5. P Q7M8L1 Proline--tRNA ligase 5.38e-06 1.91e-03 NA NA
5. P Q7TXQ5 Proline--tRNA ligase 3.78e-06 6.08e-04 NA NA
5. P B7GWV6 Proline--tRNA ligase 1.14e-05 3.68e-03 NA NA
5. P C3MYC2 S-adenosylmethionine synthase 2.42e-01 3.86e-02 NA NA
5. P C0M9E6 Proline--tRNA ligase 7.93e-06 5.91e-03 NA NA
5. P C4KIY2 S-adenosylmethionine synthase 2.40e-01 3.86e-02 NA NA
5. P B2I7W6 Proline--tRNA ligase 1.53e-06 2.95e-04 NA NA
5. P B2SFQ6 Proline--tRNA ligase 1.29e-05 1.33e-04 NA NA
5. P Q2P7I5 Proline--tRNA ligase 4.82e-06 6.22e-03 NA NA
5. P B0BT03 Proline--tRNA ligase 2.91e-06 2.38e-03 NA NA
5. P Q9K013 ATP phosphoribosyltransferase regulatory subunit 5.95e-08 7.83e-20 NA NA
5. P Q7VRC8 Proline--tRNA ligase 2.89e-05 1.29e-04 NA NA
5. P C4K3K4 Proline--tRNA ligase 4.28e-06 1.70e-02 NA NA
5. P Q0K971 ATP phosphoribosyltransferase regulatory subunit 6.34e-10 1.11e-18 NA NA
5. P B8DG08 Proline--tRNA ligase 3.94e-06 5.48e-05 NA NA
5. P B5Y8J7 Proline--tRNA ligase 2.59e-06 2.64e-04 NA NA
5. P Q98KS5 Proline--tRNA ligase 2.05e-07 3.01e-09 NA NA
5. P C0QY98 Proline--tRNA ligase 1.15e-05 2.54e-04 NA NA
5. P A8FDC1 Proline--tRNA ligase 2.48e-06 1.51e-03 NA NA
5. P A9M3P6 ATP phosphoribosyltransferase regulatory subunit 4.48e-09 7.95e-20 NA NA
5. P C1L2M5 Proline--tRNA ligase 1.36e-06 2.80e-05 NA NA
5. P Q2LTR7 Proline--tRNA ligase 4.39e-07 3.81e-04 NA NA
5. P A2RNT2 Proline--tRNA ligase 3.96e-06 3.12e-02 NA NA
5. P P56124 Proline--tRNA ligase 8.15e-06 2.45e-04 NA NA
5. P Q18H49 S-adenosylmethionine synthase 4.72e-01 4.84e-04 NA NA
5. P A4TL66 Proline--tRNA ligase 7.83e-07 7.56e-04 NA NA
5. P Q8F148 Proline--tRNA ligase 7.79e-05 1.90e-03 NA NA
5. P A4QF01 Proline--tRNA ligase 4.70e-06 1.09e-03 NA NA
5. P C3N824 S-adenosylmethionine synthase 2.96e-01 3.86e-02 NA NA
5. P B2UCU9 Proline--tRNA ligase 6.73e-06 1.41e-02 NA NA
5. P B2S2A7 Proline--tRNA ligase 3.24e-06 5.38e-03 NA NA
5. P P43830 Proline--tRNA ligase 3.51e-06 1.33e-03 NA NA
5. P B9LZK1 Proline--tRNA ligase 3.98e-06 2.40e-03 NA NA
5. P C0MFA1 Proline--tRNA ligase 7.81e-06 6.83e-03 NA NA
5. P Q02IB8 Proline--tRNA ligase 8.92e-06 1.57e-02 NA NA
5. P Q88NK2 Proline--tRNA ligase 5.95e-06 6.95e-03 NA NA
5. P Q5FHL5 Proline--tRNA ligase 9.16e-08 2.05e-09 NA NA
5. P Q7CH25 Proline--tRNA ligase 3.44e-06 6.14e-04 NA NA
5. P Q0K6Q0 Proline--tRNA ligase 1.01e-05 1.41e-02 NA NA
5. P B2FMR5 Proline--tRNA ligase 1.04e-05 6.33e-03 NA NA
5. P P0DG55 Proline--tRNA ligase 8.52e-06 2.25e-02 NA NA
5. P A1TTD0 Proline--tRNA ligase 1.46e-05 2.30e-03 NA NA
5. P Q14GJ0 Proline--tRNA ligase 1.19e-05 1.07e-04 NA NA
5. P Q8TZW1 S-adenosylmethionine synthase 3.92e-01 1.10e-04 NA NA
5. P Q73GW6 Proline--tRNA ligase 8.49e-08 6.30e-09 NA NA
5. P B5BAQ2 Proline--tRNA ligase 9.04e-07 1.22e-03 NA NA
5. P B1YSV1 Proline--tRNA ligase 3.14e-06 1.42e-02 NA NA
5. P A1UER2 Proline--tRNA ligase 1.63e-05 5.26e-04 NA NA
5. P B3PDB6 ATP phosphoribosyltransferase regulatory subunit 1.63e-09 3.13e-18 NA NA
5. P Q5XD99 Uncharacterized protein M6_Spy0479 1.94e-01 3.44e-03 NA NA
5. P A6Q7Y7 Proline--tRNA ligase 2.24e-06 1.37e-04 NA NA
5. P Q5YSB9 Proline--tRNA ligase 3.07e-05 1.03e-03 NA NA
5. P A3MK64 ATP phosphoribosyltransferase regulatory subunit 4.92e-10 7.02e-20 NA NA
5. P Q0BSM0 Proline--tRNA ligase 3.44e-07 1.21e-07 NA NA
5. P A0K4B4 Proline--tRNA ligase 3.20e-06 5.57e-03 NA NA
5. P Q8ECI8 Proline--tRNA ligase 2.19e-06 2.61e-02 NA NA
5. P Q9KYR6 Proline--tRNA ligase 1.27e-05 4.83e-05 NA NA
5. P Q8CST7 Proline--tRNA ligase 7.86e-06 5.86e-04 NA NA
5. P Q0RBM4 Proline--tRNA ligase 9.71e-07 3.05e-02 NA NA
5. P Q89AN7 Proline--tRNA ligase 4.47e-06 1.03e-03 NA NA
5. P Q5ZXN7 Proline--tRNA ligase 6.12e-06 4.19e-03 NA NA
5. P Q5FUU9 Proline--tRNA ligase 7.64e-07 1.43e-10 NA NA
5. P B4TYF5 Proline--tRNA ligase 1.14e-06 1.15e-03 NA NA
5. P Q5F9J6 ATP phosphoribosyltransferase regulatory subunit 6.04e-08 1.50e-19 NA NA
5. P Q8PCS4 Proline--tRNA ligase 3.21e-06 1.01e-02 NA NA
5. P B7JJ97 Proline--tRNA ligase 9.65e-06 3.89e-04 NA NA
5. P B1H063 Proline--tRNA ligase 1.19e-05 2.89e-04 NA NA
5. P B0SDM9 Proline--tRNA ligase 1.60e-05 1.96e-04 NA NA
5. P B5EKH7 Proline--tRNA ligase 8.48e-07 1.10e-03 NA NA
5. P Q3SH24 Proline--tRNA ligase 1.61e-05 1.75e-03 NA NA
5. P A1KMI8 Proline--tRNA ligase 3.88e-06 6.08e-04 NA NA
5. P Q1CAK9 Proline--tRNA ligase 2.16e-06 6.14e-04 NA NA
5. P Q3IQF5 S-adenosylmethionine synthase 2.61e-01 5.35e-04 NA NA
5. P Q8G3N0 Proline--tRNA ligase 1.54e-05 2.05e-03 NA NA
5. P A9VT57 Proline--tRNA ligase 1.07e-05 3.06e-04 NA NA
5. P Q976F3 S-adenosylmethionine synthase 2.21e-01 4.83e-02 NA NA
5. P B8FR28 Proline--tRNA ligase 5.20e-06 7.29e-04 NA NA
5. P Q0AB94 Proline--tRNA ligase 5.00e-06 1.52e-03 NA NA
5. P Q5E719 Proline--tRNA ligase 1.01e-06 3.38e-04 NA NA
5. P C3PH25 Proline--tRNA ligase 3.27e-06 1.05e-03 NA NA
5. P A1U1F0 Proline--tRNA ligase 4.40e-06 6.66e-03 NA NA
5. P Q732Q0 Proline--tRNA ligase 1 1.03e-05 2.95e-04 NA NA
5. P B2JHD3 Proline--tRNA ligase 1.17e-05 5.47e-03 NA NA
5. P P0DF57 Uncharacterized protein SPs1471 1.93e-01 3.44e-03 NA NA
5. P A9BGA8 Proline--tRNA ligase 1.34e-05 2.44e-05 NA NA
5. P Q03FS9 Proline--tRNA ligase 6.43e-07 3.92e-04 NA NA
5. P Q18CD2 Proline--tRNA ligase 1 5.78e-06 7.67e-05 NA NA
5. P B4RK97 ATP phosphoribosyltransferase regulatory subunit 5.61e-08 1.75e-19 NA NA
5. P Q38W72 Proline--tRNA ligase 1.61e-06 1.99e-04 NA NA
5. P Q1QDK7 Proline--tRNA ligase 5.42e-06 1.37e-03 NA NA
5. P Q8TU57 S-adenosylmethionine synthase 5.19e-01 7.03e-04 NA NA
5. P B2G6V0 Proline--tRNA ligase 3.78e-06 3.47e-03 NA NA
5. P B4UGI0 Proline--tRNA ligase 2.48e-05 1.80e-04 NA NA
5. P B0K5F2 Proline--tRNA ligase 3.74e-06 2.76e-03 NA NA
5. P B8EDD0 Proline--tRNA ligase 1.22e-05 4.01e-02 NA NA
5. P Q2NRN0 Proline--tRNA ligase 2.57e-06 1.98e-03 NA NA
5. P A4IWT9 Proline--tRNA ligase 1.28e-05 1.18e-04 NA NA
5. P A4SJ23 Proline--tRNA ligase 1.97e-06 3.68e-03 NA NA
5. P A0QIY9 Proline--tRNA ligase 2.02e-05 7.22e-04 NA NA
5. P B8DNM5 Proline--tRNA ligase 4.16e-06 2.00e-03 NA NA
5. P A0K7S6 ATP phosphoribosyltransferase regulatory subunit 4.82e-10 1.32e-19 NA NA
5. P Q48FB4 Proline--tRNA ligase 8.97e-06 2.37e-02 NA NA
5. P Q58605 S-adenosylmethionine synthase 4.99e-01 6.27e-03 NA NA
5. P Q07ZH1 Proline--tRNA ligase 6.84e-06 1.18e-02 NA NA
5. P Q2FUT6 ATP phosphoribosyltransferase regulatory subunit 9.82e-06 1.16e-02 NA NA
5. P B2US70 Proline--tRNA ligase 3.92e-06 3.51e-04 NA NA
5. P A8YVR3 Proline--tRNA ligase 3.46e-06 8.89e-04 NA NA
5. P A3M8I1 Proline--tRNA ligase 1.16e-05 3.75e-03 NA NA
5. P Q88VK1 Proline--tRNA ligase 1.10e-06 9.99e-04 NA NA
5. P B5XIL5 Proline--tRNA ligase 8.95e-06 1.47e-02 NA NA
5. P Q7VKI5 Proline--tRNA ligase 3.26e-06 6.22e-03 NA NA
5. P A5VJD4 Proline--tRNA ligase 3.43e-06 3.47e-03 NA NA
5. P C3MW88 Proline--tRNA ligase 1.22e-08 1.42e-02 NA NA
5. P P57333 Proline--tRNA ligase 1.35e-06 8.50e-04 NA NA
5. P B1JVA5 Proline--tRNA ligase 3.11e-06 5.57e-03 NA NA
5. P B7J4Y9 Proline--tRNA ligase 9.23e-07 1.10e-03 NA NA
5. P Q049U9 Proline--tRNA ligase 4.93e-06 8.60e-05 NA NA
5. P P0CW62 S-adenosylmethionine synthase 3.18e-01 1.32e-02 NA NA
5. P Q9HM12 S-adenosylmethionine synthase 3.09e-01 5.12e-05 NA NA
5. P Q980S9 S-adenosylmethionine synthase 2.37e-01 3.23e-02 NA NA
5. P B9MPD7 Proline--tRNA ligase 4.04e-06 5.11e-04 NA NA
5. P Q2GG92 Proline--tRNA ligase 1.73e-06 7.61e-10 NA NA
5. P Q5LUD3 Proline--tRNA ligase 1.01e-07 3.52e-08 NA NA
5. P B4TK70 Proline--tRNA ligase 1.37e-06 1.22e-03 NA NA
5. P Q8TV85 S-adenosylmethionine synthase 2.86e-01 7.10e-04 NA NA
5. P B0KTK4 Proline--tRNA ligase 6.54e-06 1.04e-02 NA NA
5. P A0B742 S-adenosylmethionine synthase 4.26e-01 2.20e-03 NA NA
5. P B2SYU8 Proline--tRNA ligase 7.97e-06 1.69e-02 NA NA
5. P Q73VU8 Proline--tRNA ligase 1.71e-05 7.10e-04 NA NA
5. P Q17W62 Proline--tRNA ligase 1.58e-06 4.38e-04 NA NA
5. P Q5HBI6 Proline--tRNA ligase 8.74e-08 2.84e-09 NA NA
5. P Q5JF22 S-adenosylmethionine synthase 3.33e-01 3.48e-05 NA NA
5. P Q8Y7G2 Proline--tRNA ligase 9.40e-07 1.84e-05 NA NA
5. P Q1JEV3 Proline--tRNA ligase 8.34e-06 2.72e-02 NA NA
5. P B0U4A7 Proline--tRNA ligase 2.81e-06 1.83e-04 NA NA
5. P B8GWT1 Proline--tRNA ligase 1.82e-07 1.73e-07 NA NA
5. P A0QVM0 Proline--tRNA ligase 2.53e-05 1.17e-03 NA NA
5. P B7UXX6 Proline--tRNA ligase 1.07e-05 1.26e-02 NA NA
5. P Q4FM73 Proline--tRNA ligase 4.77e-07 2.13e-07 NA NA
5. P Q0SQC0 Proline--tRNA ligase 2.99e-06 3.78e-03 NA NA
5. P Q819Y4 Proline--tRNA ligase 1 4.90e-06 1.65e-04 NA NA
5. P Q3BP90 Proline--tRNA ligase 2.27e-06 2.70e-02 NA NA
5. P Q0AGN2 Proline--tRNA ligase 2.41e-06 4.68e-02 NA NA
5. P Q6L123 S-adenosylmethionine synthase 3.09e-01 1.28e-04 NA NA
5. P Q9Z5I7 Proline--tRNA ligase 9.43e-07 3.89e-02 NA NA
5. P A9N0U7 Proline--tRNA ligase 6.80e-06 1.22e-03 NA NA
5. P Q6NGM7 Proline--tRNA ligase 1.97e-05 2.64e-04 NA NA
5. P A9KGU5 Proline--tRNA ligase 1.67e-06 7.37e-03 NA NA
5. P A6VHQ4 S-adenosylmethionine synthase 3.10e-01 3.95e-03 NA NA
5. P A2S5R3 Proline--tRNA ligase 3.90e-06 1.66e-02 NA NA
5. P A4YVI0 Proline--tRNA ligase 7.21e-07 2.81e-08 NA NA
5. P A1T7H2 Proline--tRNA ligase 2.87e-06 2.84e-04 NA NA
5. P Q6LN48 Proline--tRNA ligase 3.60e-06 5.02e-04 NA NA
5. P Q04F81 Proline--tRNA ligase 1.95e-06 4.81e-03 NA NA
5. P A1VK86 Proline--tRNA ligase 1.24e-05 9.47e-04 NA NA
5. P B8EP84 Proline--tRNA ligase 4.57e-07 1.16e-07 NA NA
5. P B7I854 Proline--tRNA ligase 1.28e-05 3.68e-03 NA NA
5. P B0V4Y6 Proline--tRNA ligase 1.07e-05 3.68e-03 NA NA
5. P Q1CUR4 Proline--tRNA ligase 1.62e-05 2.71e-04 NA NA
5. P Q97ED5 Proline--tRNA ligase 1.79e-06 5.12e-05 NA NA
5. P B2GKS1 Proline--tRNA ligase 4.09e-06 4.98e-03 NA NA
5. P A5UDZ4 Proline--tRNA ligase 4.53e-06 2.13e-03 NA NA
5. P Q74IS2 Proline--tRNA ligase 6.68e-06 8.58e-04 NA NA
5. P Q5H4Q7 Proline--tRNA ligase 8.88e-07 6.22e-03 NA NA
5. P Q8U0G2 Glycine--tRNA ligase 1.31e-05 5.57e-03 NA NA
5. P A1RI33 Proline--tRNA ligase 2.14e-06 2.55e-02 NA NA
5. P Q0BMT1 Proline--tRNA ligase 1.23e-05 1.52e-04 NA NA
5. P Q053M7 Proline--tRNA ligase 5.06e-06 2.67e-03 NA NA
5. P C3NET8 Proline--tRNA ligase 8.54e-09 1.93e-02 NA NA
5. P O31755 Proline--tRNA ligase 4.58e-06 7.38e-05 NA NA
5. P Q31GQ3 Proline--tRNA ligase 3.04e-06 5.97e-04 NA NA
5. P Q46CW6 S-adenosylmethionine synthase 2.88e-01 3.51e-04 NA NA
5. P B2GBM5 Proline--tRNA ligase 5.07e-06 2.07e-03 NA NA
5. P B1XYW5 Proline--tRNA ligase 4.04e-06 5.20e-03 NA NA
5. P Q82UZ8 Proline--tRNA ligase 6.76e-06 2.63e-02 NA NA
5. P Q63QM5 Proline--tRNA ligase 4.85e-06 1.66e-02 NA NA
5. P B4U8B2 Proline--tRNA ligase 1.07e-06 2.49e-03 NA NA
5. P Q49X48 Proline--tRNA ligase 1.04e-05 3.23e-04 NA NA
5. P Q3JNG4 Proline--tRNA ligase 7.66e-06 1.66e-02 NA NA
5. P A4JBC2 Proline--tRNA ligase 3.35e-06 5.47e-03 NA NA
5. P B1KNR3 Proline--tRNA ligase 3.52e-06 1.48e-03 NA NA
5. P B8GPP4 Proline--tRNA ligase 8.32e-06 8.73e-03 NA NA
5. P C6A317 Glycine--tRNA ligase 1.27e-05 1.33e-02 NA NA
5. P B2SPG9 Proline--tRNA ligase 5.25e-07 6.22e-03 NA NA
5. P Q46X21 Proline--tRNA ligase 4.63e-06 4.53e-03 NA NA
5. P Q8CTV2 ATP phosphoribosyltransferase regulatory subunit 4.03e-06 1.23e-03 NA NA
5. P Q8PGP9 Proline--tRNA ligase 2.22e-06 2.88e-02 NA NA
5. P Q5L0J4 Proline--tRNA ligase 4.74e-06 1.59e-04 NA NA
5. P B1XT38 Proline--tRNA ligase 9.50e-06 6.83e-03 NA NA
5. P A5EK68 Proline--tRNA ligase 6.70e-07 2.81e-08 NA NA
5. P Q4L5W5 Proline--tRNA ligase 9.65e-06 3.96e-04 NA NA
5. P Q47RV7 Proline--tRNA ligase 2.33e-05 1.09e-03 NA NA
5. P A4WPJ3 Proline--tRNA ligase 7.74e-07 6.41e-07 NA NA
5. P Q2YBX1 ATP phosphoribosyltransferase regulatory subunit 2.06e-11 5.67e-22 NA NA
5. P A0KPA5 Proline--tRNA ligase 1.76e-06 2.94e-03 NA NA
5. P A9MPG5 Proline--tRNA ligase 1.11e-06 1.22e-03 NA NA
5. P O30186 S-adenosylmethionine synthase 2.95e-01 6.84e-05 NA NA
5. P B8IUW4 Proline--tRNA ligase 1.25e-07 1.18e-08 NA NA
5. P Q8Y020 ATP phosphoribosyltransferase regulatory subunit 2.96e-10 1.16e-17 NA NA
5. P B8DTM3 Proline--tRNA ligase 4.34e-05 2.32e-03 NA NA
5. P Q0BIH4 Proline--tRNA ligase 4.43e-06 6.60e-03 NA NA
5. P A9AI56 Proline--tRNA ligase 3.16e-06 1.25e-02 NA NA
5. P Q7NHL0 Proline--tRNA ligase 2.09e-05 1.52e-02 NA NA
5. P Q7CR62 Proline--tRNA ligase 2.99e-06 1.22e-03 NA NA
5. P A4XHN7 Proline--tRNA ligase 4.66e-06 3.48e-04 NA NA
5. P A4IMD1 Proline--tRNA ligase 2.14e-06 1.52e-04 NA NA
5. P A1V0N6 Proline--tRNA ligase 7.72e-06 1.66e-02 NA NA
5. P B6YUL1 S-adenosylmethionine synthase 3.81e-01 1.08e-04 NA NA
5. P B8F7C2 Proline--tRNA ligase 4.04e-06 1.74e-03 NA NA
5. P Q7VFF0 Proline--tRNA ligase 1.73e-05 3.33e-02 NA NA
5. P Q0S235 Proline--tRNA ligase 1 1.36e-05 2.52e-04 NA NA
5. P B1AJ93 Proline--tRNA ligase 1.42e-06 1.81e-03 NA NA
5. P C3NF87 S-adenosylmethionine synthase 2.94e-01 3.39e-02 NA NA
5. P Q9HQ73 S-adenosylmethionine synthase 2.77e-01 1.68e-02 NA NA
5. P A4G0T1 S-adenosylmethionine synthase 3.06e-01 7.56e-03 NA NA
5. P Q5FJN0 Proline--tRNA ligase 3.80e-06 5.16e-04 NA NA
5. P A6UTK4 Proline--tRNA ligase 1.42e-08 1.90e-02 NA NA
5. P A5IGL5 Proline--tRNA ligase 3.95e-06 3.81e-03 NA NA
5. P A1K976 Proline--tRNA ligase 5.48e-06 8.97e-04 NA NA
5. P Q8R7S9 Proline--tRNA ligase 2.66e-06 2.84e-03 NA NA
5. P C3MJ04 S-adenosylmethionine synthase 2.40e-01 3.86e-02 NA NA
5. P B8J9M0 Proline--tRNA ligase 2.31e-05 1.31e-04 NA NA
5. P A8LYE7 Proline--tRNA ligase 2.68e-06 1.49e-03 NA NA
5. P Q2IGK6 Proline--tRNA ligase 1 2.25e-05 3.64e-04 NA NA
5. P A7NB07 Proline--tRNA ligase 1.20e-05 1.52e-04 NA NA
5. P Q1JJW2 Proline--tRNA ligase 8.85e-06 1.64e-02 NA NA
5. P Q4JV46 Proline--tRNA ligase 4.36e-06 2.66e-04 NA NA
5. P C0R3N5 Proline--tRNA ligase 8.62e-08 2.02e-09 NA NA
5. P B2JZ09 Proline--tRNA ligase 2.56e-06 9.82e-04 NA NA
5. P Q83F67 Proline--tRNA ligase 1.46e-06 3.91e-03 NA NA
5. P B0TNJ5 Proline--tRNA ligase 5.21e-06 1.33e-03 NA NA
5. P Q720A3 Proline--tRNA ligase 1.32e-06 3.09e-05 NA NA
5. P B7HLF2 Proline--tRNA ligase 1.10e-05 2.95e-04 NA NA
5. P Q21YZ5 Proline--tRNA ligase 6.41e-06 2.32e-03 NA NA
5. P Q4FUL6 Proline--tRNA ligase 5.28e-06 5.35e-04 NA NA
5. P Q1LIQ4 Proline--tRNA ligase 9.45e-06 3.32e-03 NA NA
5. P B1VGB6 Proline--tRNA ligase 2.49e-05 3.45e-04 NA NA
5. P A6QKG8 ATP phosphoribosyltransferase regulatory subunit 1.20e-05 1.16e-02 NA NA
5. P Q038L9 Proline--tRNA ligase 1.47e-06 1.45e-03 NA NA
5. P Q83HI1 Proline--tRNA ligase 3.51e-05 4.12e-03 NA NA
5. P A5D2U6 Proline--tRNA ligase 4.00e-06 1.48e-04 NA NA
5. P C3P5M1 Proline--tRNA ligase 9.85e-06 3.89e-04 NA NA
5. P A1SLL4 Proline--tRNA ligase 1.83e-05 9.05e-04 NA NA
5. P A4XRQ7 Proline--tRNA ligase 8.46e-06 5.57e-03 NA NA
5. P Q99XY4 Proline--tRNA ligase 8.35e-06 1.93e-02 NA NA
5. P Q5M7W7 Probable proline--tRNA ligase, mitochondrial 3.06e-08 4.57e-03 NA NA
5. P B9ME00 Proline--tRNA ligase 1.37e-05 1.07e-02 NA NA
5. P Q0TMM3 Proline--tRNA ligase 2.94e-06 4.77e-03 NA NA
5. P A9BP65 Proline--tRNA ligase 2.35e-05 8.23e-03 NA NA
5. P P0DF56 Uncharacterized protein SpyM3_0382 1.88e-01 3.44e-03 NA NA
5. P A0Q7N3 Proline--tRNA ligase 1.11e-05 1.03e-04 NA NA
5. P B2SXS0 ATP phosphoribosyltransferase regulatory subunit 1.14e-09 4.99e-20 NA NA
5. P B2V6W5 Proline--tRNA ligase 2.51e-06 3.41e-03 NA NA
5. P Q72U06 Proline--tRNA ligase 1.14e-05 3.26e-04 NA NA
5. P B8D937 Proline--tRNA ligase 1.71e-06 8.50e-04 NA NA
5. P Q1BAA0 Proline--tRNA ligase 2.06e-06 5.26e-04 NA NA
5. P Q9A6Z5 Proline--tRNA ligase 6.60e-08 1.73e-07 NA NA
5. P Q9PQ38 Proline--tRNA ligase 1.60e-06 1.81e-03 NA NA
5. P A2SD40 Proline--tRNA ligase 9.06e-06 2.47e-02 NA NA
5. P B5ZBT9 Proline--tRNA ligase 1.65e-06 5.11e-03 NA NA
5. P Q3Z9I5 Proline--tRNA ligase 4.49e-06 2.22e-05 NA NA
5. P Q9I502 Proline--tRNA ligase 1.23e-05 1.26e-02 NA NA
5. P A4SVA7 Proline--tRNA ligase 1.70e-05 6.27e-03 NA NA
5. P A5UHN3 Proline--tRNA ligase 3.23e-06 9.82e-04 NA NA
5. P B0R5A8 S-adenosylmethionine synthase 3.94e-01 1.68e-02 NA NA
5. P Q6AEX8 Proline--tRNA ligase 9.67e-06 6.42e-04 NA NA
5. P B1MD96 Proline--tRNA ligase 1.44e-05 2.05e-04 NA NA
5. P Q7N8M7 Proline--tRNA ligase 1.53e-06 1.90e-03 NA NA
5. P Q044C3 Proline--tRNA ligase 4.59e-06 2.99e-03 NA NA
5. P A4VNB4 Proline--tRNA ligase 9.62e-06 1.70e-02 NA NA
5. P Q8XHQ4 Proline--tRNA ligase 2.96e-06 3.29e-03 NA NA
5. P Q6D1B9 Proline--tRNA ligase 2.53e-06 1.55e-04 NA NA
5. P Q8ZYP7 S-adenosylmethionine synthase 2.04e-01 1.20e-03 NA NA
5. P A0JUT1 Proline--tRNA ligase 2.65e-05 5.20e-03 NA NA
5. P Q5HKN6 ATP phosphoribosyltransferase regulatory subunit 3.18e-06 2.86e-03 NA NA
5. P Q8XVL4 Proline--tRNA ligase 5.55e-06 4.08e-02 NA NA
5. P Q168E6 Proline--tRNA ligase 1.45e-07 1.73e-07 NA NA
5. P B9EBE4 Proline--tRNA ligase 2.30e-06 7.19e-03 NA NA
5. P Q9YBK2 S-adenosylmethionine synthase 2.52e-01 4.25e-02 NA NA
5. P Q0HWU6 Proline--tRNA ligase 3.73e-06 2.06e-02 NA NA
5. P Q9PG57 Proline--tRNA ligase 1.65e-06 2.36e-04 NA NA
5. P Q46G28 Proline--tRNA ligase 1.85e-08 3.73e-02 NA NA
5. P B5FBD6 Proline--tRNA ligase 2.02e-06 4.84e-04 NA NA
5. P A3QG64 Proline--tRNA ligase 1.49e-05 5.26e-04 NA NA
5. P C1F3P3 Proline--tRNA ligase 2.49e-06 3.35e-03 NA NA
5. P Q21MA8 Proline--tRNA ligase 6.66e-06 4.85e-03 NA NA
5. P C3L7A8 Proline--tRNA ligase 2.23e-06 3.89e-04 NA NA
5. P Q2KVA0 Proline--tRNA ligase 4.27e-06 2.81e-02 NA NA
5. P Q8DBH9 Proline--tRNA ligase 5.18e-06 1.01e-03 NA NA
5. P Q6G5Z5 ATP phosphoribosyltransferase regulatory subunit 1.00e-05 7.56e-03 NA NA
5. P B5YKW0 Proline--tRNA ligase 3.02e-06 5.27e-05 NA NA
5. P Q1H497 Proline--tRNA ligase 4.10e-06 6.66e-04 NA NA
5. P C1DRG4 Proline--tRNA ligase 9.29e-06 1.03e-02 NA NA
5. P Q3KH16 Proline--tRNA ligase 4.71e-06 2.72e-02 NA NA
5. P A4Y8F6 Proline--tRNA ligase 1.88e-06 2.41e-02 NA NA
5. P A0RNT1 Proline--tRNA ligase 4.56e-06 5.92e-05 NA NA
5. P Q1QVL8 Proline--tRNA ligase 8.52e-06 5.86e-04 NA NA
5. P Q03QS8 Proline--tRNA ligase 7.09e-07 4.46e-04 NA NA
5. P A5EXK9 Proline--tRNA ligase 9.85e-06 2.69e-03 NA NA
5. P Q5NF37 Proline--tRNA ligase 1.18e-05 1.07e-04 NA NA
5. P A7FFJ4 Proline--tRNA ligase 8.64e-07 6.66e-04 NA NA
5. P Q92C35 Proline--tRNA ligase 4.61e-06 1.73e-05 NA NA
5. P A3MY01 S-adenosylmethionine synthase 2.40e-01 1.37e-02 NA NA
5. P Q2YBW3 Proline--tRNA ligase 3.77e-06 6.17e-03 NA NA
5. P A9B562 Proline--tRNA ligase 1.79e-06 8.68e-05 NA NA
5. P A8MD44 S-adenosylmethionine synthase 2.54e-01 3.42e-02 NA NA
5. P A7I771 S-adenosylmethionine synthase 4.01e-01 5.02e-04 NA NA
5. P Q83GR4 Proline--tRNA ligase 7.29e-05 9.58e-03 NA NA
5. P A9R371 Proline--tRNA ligase 9.37e-07 6.14e-04 NA NA
5. P Q5WFT6 Proline--tRNA ligase 9.61e-07 3.96e-04 NA NA
5. P A4G4L1 ATP phosphoribosyltransferase regulatory subunit 6.49e-09 4.07e-20 NA NA
5. P A6LPP0 Proline--tRNA ligase 2.09e-06 5.97e-04 NA NA
5. P Q493B4 Proline--tRNA ligase 1.79e-05 3.89e-04 NA NA
5. P P07178 Histidine--tRNA ligase, cytoplasmic 7.45e-12 1.36e-20 NA NA
5. P Q5V2S5 S-adenosylmethionine synthase 1.92e-01 3.15e-03 NA NA
5. P P66770 Uncharacterized protein spyM18_0604 1.81e-01 3.44e-03 NA NA
5. P A0LV31 Proline--tRNA ligase 6.49e-06 7.31e-03 NA NA
5. P Q1WUG0 Proline--tRNA ligase 1.20e-06 1.42e-03 NA NA
5. P Q65JJ1 Proline--tRNA ligase 2.20e-06 7.10e-04 NA NA
5. P Q5PAZ5 Proline--tRNA ligase 1.04e-06 6.41e-07 NA NA
5. P A1R508 Proline--tRNA ligase 2.25e-05 1.47e-03 NA NA
5. P Q1CFH2 Proline--tRNA ligase 3.52e-06 6.14e-04 NA NA
5. P B0RZJ0 Proline--tRNA ligase 2.45e-06 4.53e-03 NA NA
5. P Q0HKJ4 Proline--tRNA ligase 1.30e-05 1.82e-02 NA NA
5. P C6DDF6 Proline--tRNA ligase 3.24e-06 1.50e-04 NA NA
5. P A1KT70 ATP phosphoribosyltransferase regulatory subunit 5.89e-08 1.12e-19 NA NA
5. P A8F3T2 Proline--tRNA ligase 2.03e-06 3.61e-04 NA NA
5. P Q62GV8 Proline--tRNA ligase 5.11e-06 1.43e-02 NA NA
5. P Q1LSM8 Proline--tRNA ligase 1.27e-06 3.79e-05 NA NA
5. P Q87MC3 Proline--tRNA ligase 1.13e-06 7.25e-03 NA NA
5. P C4KHU5 Proline--tRNA ligase 1.31e-08 1.88e-02 NA NA
5. P A6UQS6 S-adenosylmethionine synthase 3.52e-01 8.30e-03 NA NA
5. P P64381 ATP phosphoribosyltransferase regulatory subunit 1.19e-05 7.56e-03 NA NA
5. P O26708 Proline--tRNA ligase 1.30e-06 3.67e-02 NA NA
5. P A2RGI4 Proline--tRNA ligase 8.86e-06 1.85e-02 NA NA
5. P A8Z5I0 ATP phosphoribosyltransferase regulatory subunit 1.10e-05 1.16e-02 NA NA
5. P B1HQZ9 Proline--tRNA ligase 6.41e-06 1.03e-04 NA NA
5. P A6Q3S4 Proline--tRNA ligase 5.76e-06 2.47e-05 NA NA
5. P C0Q6L7 Proline--tRNA ligase 9.41e-07 8.20e-04 NA NA
5. P Q5HPS8 Proline--tRNA ligase 8.16e-06 5.86e-04 NA NA
5. P C1DLQ7 ATP phosphoribosyltransferase regulatory subunit 6.72e-11 7.71e-24 NA NA
5. P Q8DSJ9 Proline--tRNA ligase 3.98e-06 2.45e-02 NA NA
5. P Q6GDC4 ATP phosphoribosyltransferase regulatory subunit 1.12e-05 1.53e-02 NA NA
5. P A6UU75 S-adenosylmethionine synthase 2.33e-01 4.30e-03 NA NA
5. P B0TXX4 Proline--tRNA ligase 3.28e-06 1.48e-04 NA NA
5. P A5WDG2 Proline--tRNA ligase 2.15e-06 5.86e-04 NA NA
5. P P78600 Proline--tRNA ligase, cytoplasmic 2.40e-05 7.82e-05 NA NA
5. P Q04U64 Proline--tRNA ligase 3.53e-05 4.30e-03 NA NA
5. P Q5X756 Proline--tRNA ligase 7.08e-06 4.98e-03 NA NA
5. P C6E496 Proline--tRNA ligase 9.09e-07 2.99e-03 NA NA
5. P Q1BZD6 Proline--tRNA ligase 3.29e-06 6.60e-03 NA NA
5. P A3DJL6 Proline--tRNA ligase 1.79e-06 1.27e-04 NA NA
5. P Q667L4 Proline--tRNA ligase 1.41e-05 9.82e-04 NA NA
5. P Q3YSD4 Proline--tRNA ligase 2.68e-08 2.89e-10 NA NA
5. P Q7MIE5 Proline--tRNA ligase 4.87e-06 8.97e-04 NA NA
5. P A7H7J7 Proline--tRNA ligase 3.41e-05 4.38e-04 NA NA
5. P A6WQB8 Proline--tRNA ligase 1.26e-05 3.53e-02 NA NA
5. P Q5WYK5 Proline--tRNA ligase 8.65e-06 3.26e-03 NA NA
5. P P26498 S-adenosylmethionine synthase 3.28e-01 1.45e-04 NA NA
5. P Q1J4L9 Proline--tRNA ligase 8.62e-06 1.47e-02 NA NA
5. P B9DTD1 Proline--tRNA ligase 9.39e-06 6.95e-03 NA NA
5. P C3LTC5 Proline--tRNA ligase 4.02e-06 2.99e-03 NA NA
5. P Q5P7T1 Proline--tRNA ligase 6.85e-06 1.68e-03 NA NA
5. P B2TIF5 Proline--tRNA ligase 5.29e-06 4.03e-04 NA NA
5. P Q12FA3 Proline--tRNA ligase 2.19e-05 1.33e-03 NA NA
5. P P0CW63 S-adenosylmethionine synthase 4.31e-01 5.29e-03 NA NA
5. P B0THP0 Proline--tRNA ligase 3.07e-06 1.91e-03 NA NA
5. P Q82K46 Proline--tRNA ligase 1 1.81e-05 1.21e-03 NA NA
5. P Q2FDI1 ATP phosphoribosyltransferase regulatory subunit 1.18e-05 1.16e-02 NA NA
5. P A1W4B3 Proline--tRNA ligase 1.50e-05 1.07e-02 NA NA
5. P A5UMW7 S-adenosylmethionine synthase 2.51e-01 7.07e-03 NA NA
5. P C5CXW9 Proline--tRNA ligase 1.65e-05 3.04e-03 NA NA
5. P Q8FP97 Proline--tRNA ligase 5.99e-06 7.29e-04 NA NA
5. P Q2RJN1 Proline--tRNA ligase 2.69e-06 6.01e-03 NA NA
5. P B4E5W6 Proline--tRNA ligase 3.98e-06 8.44e-03 NA NA
5. P Q4UQN5 Proline--tRNA ligase 2.64e-06 1.01e-02 NA NA
5. P A0AIC0 Proline--tRNA ligase 2.63e-06 1.77e-05 NA NA
5. P A1AW17 Proline--tRNA ligase 1.98e-06 4.54e-04 NA NA
5. P C5BPN9 Proline--tRNA ligase 4.33e-06 8.35e-04 NA NA
5. P C3NGV6 Proline--tRNA ligase 1.24e-08 1.93e-02 NA NA
5. P Q3AB89 Proline--tRNA ligase 9.23e-07 7.22e-04 NA NA
5. P Q2FN14 S-adenosylmethionine synthase 3.90e-01 4.10e-05 NA NA
5. P B0SM58 Proline--tRNA ligase 1.54e-05 1.96e-04 NA NA
5. P C3N6D0 Proline--tRNA ligase 1.24e-08 1.42e-02 NA NA
5. P C5CFP9 Proline--tRNA ligase 3.67e-06 3.68e-04 NA NA
5. P Q1G9P3 Proline--tRNA ligase 5.23e-06 1.00e-04 NA NA
5. P P0DG54 Proline--tRNA ligase 7.93e-06 2.25e-02 NA NA
5. P C1DD53 ATP phosphoribosyltransferase regulatory subunit 1.87e-09 2.17e-22 NA NA
5. P A1WUX1 Proline--tRNA ligase 7.29e-06 1.10e-03 NA NA
5. P B7IUH7 Proline--tRNA ligase 1.03e-05 3.51e-04 NA NA
5. P B5EIT9 Proline--tRNA ligase 3.25e-06 3.15e-03 NA NA
5. P A3MR95 Proline--tRNA ligase 7.57e-06 1.66e-02 NA NA
5. P B9IVA8 Proline--tRNA ligase 9.28e-06 2.64e-04 NA NA
5. P B5F8V6 Proline--tRNA ligase 3.16e-06 1.10e-03 NA NA
5. P Q3ZZD0 Proline--tRNA ligase 3.62e-06 2.62e-05 NA NA
5. P C5C9S6 Proline--tRNA ligase 2.19e-05 1.22e-02 NA NA
5. P A3NDS2 Proline--tRNA ligase 7.44e-06 1.44e-02 NA NA
5. P P9WFT9 Proline--tRNA ligase 2.92e-06 5.60e-04 NA NA
5. P A0LHQ7 Proline--tRNA ligase 1.77e-05 1.38e-04 NA NA
5. P A5VZT5 Proline--tRNA ligase 8.19e-06 9.66e-03 NA NA
5. P Q2SZF6 Proline--tRNA ligase 7.81e-06 2.22e-02 NA NA
5. P B0RDZ1 Proline--tRNA ligase 2.44e-06 6.66e-04 NA NA
5. P O74765 Probable proline--tRNA ligase, mitochondrial 1.18e-07 1.21e-07 NA NA
5. P P9WFT8 Proline--tRNA ligase 2.18e-06 5.60e-04 NA NA
5. P A7N1W0 Proline--tRNA ligase 3.36e-06 3.62e-03 NA NA
5. P Q6FE23 Proline--tRNA ligase 9.59e-06 7.82e-03 NA NA
5. P Q7P0J3 Proline--tRNA ligase 1.63e-06 1.10e-03 NA NA
5. P Q1J9R3 Proline--tRNA ligase 8.51e-06 1.64e-02 NA NA
5. P Q4QMG5 Proline--tRNA ligase 2.88e-06 7.91e-04 NA NA
5. P Q8E362 Proline--tRNA ligase 3.47e-06 4.64e-02 NA NA
5. P Q02VZ7 Proline--tRNA ligase 3.53e-06 2.90e-02 NA NA
5. P B9LA07 Proline--tRNA ligase 8.95e-06 3.68e-04 NA NA
5. P B7HDU2 Proline--tRNA ligase 9.94e-06 1.90e-04 NA NA
5. P Q87Y24 Proline--tRNA ligase 6.34e-06 2.59e-02 NA NA
5. P P64380 ATP phosphoribosyltransferase regulatory subunit 1.00e-05 7.56e-03 NA NA
5. P B3R894 Proline--tRNA ligase 7.43e-06 2.89e-03 NA NA
5. P A5FS84 Proline--tRNA ligase 3.66e-06 1.06e-05 NA NA
5. P Q12WC8 S-adenosylmethionine synthase 4.38e-01 5.70e-05 NA NA
5. P A6VKR5 Proline--tRNA ligase 4.03e-06 5.50e-04 NA NA
5. P Q5PD80 Proline--tRNA ligase 1.81e-06 1.22e-03 NA NA
5. P P07236 Threonine--tRNA ligase, mitochondrial 3.35e-13 4.49e-03 NA NA
5. P B6JKG9 Proline--tRNA ligase 1.47e-05 3.23e-04 NA NA
5. P Q4ZWM2 Proline--tRNA ligase 8.81e-06 1.54e-02 NA NA
5. P B6EHZ8 Proline--tRNA ligase 1.94e-06 2.69e-03 NA NA
5. P A8AL94 Proline--tRNA ligase 3.35e-06 7.29e-04 NA NA
5. P C5B780 Proline--tRNA ligase 2.25e-06 4.67e-04 NA NA
5. P A3N3C6 Proline--tRNA ligase 4.04e-06 4.34e-03 NA NA
5. P O59235 Glycine--tRNA ligase 2.26e-06 8.73e-03 NA NA
5. P B1JQI5 Proline--tRNA ligase 3.01e-06 6.66e-04 NA NA
5. P B5FJ42 Proline--tRNA ligase 1.27e-06 1.22e-03 NA NA
5. P Q87B25 Proline--tRNA ligase 5.12e-06 2.95e-04 NA NA
5. P B5R434 Proline--tRNA ligase 1.12e-06 1.22e-03 NA NA
5. P Q12L53 Proline--tRNA ligase 4.62e-06 7.96e-03 NA NA
5. P C4LBX6 Proline--tRNA ligase 7.74e-06 7.29e-04 NA NA
5. P O83195 Proline--tRNA ligase 8.96e-06 5.38e-03 NA NA
5. P A1B1L0 Proline--tRNA ligase 3.78e-07 1.51e-07 NA NA
5. P Q9YDW0 Threonine--tRNA ligase catalytic subunit 7.03e-12 2.59e-05 NA NA
5. P O67275 Probable S-adenosylmethionine synthase 3.20e-01 7.24e-05 NA NA
5. P C5A4B7 S-adenosylmethionine synthase 3.43e-01 5.86e-04 NA NA
5. P Q39VY6 Proline--tRNA ligase 1.30e-06 4.34e-03 NA NA
5. P C0ZY88 Proline--tRNA ligase 4.39e-06 7.03e-04 NA NA
5. P C1EP43 Proline--tRNA ligase 9.84e-06 3.89e-04 NA NA
5. P Q636K7 Proline--tRNA ligase 1 2.26e-06 3.48e-04 NA NA
5. P Q24UG7 Proline--tRNA ligase 2.78e-06 1.07e-03 NA NA
5. P Q47ID0 Proline--tRNA ligase 3.19e-06 2.49e-03 NA NA
5. P Q13U19 Proline--tRNA ligase 6.09e-06 2.06e-02 NA NA
5. P B5ZA05 Proline--tRNA ligase 1.24e-05 6.91e-04 NA NA
5. P C3MZQ1 S-adenosylmethionine synthase 2.10e-01 3.86e-02 NA NA
5. P B0KCH5 Proline--tRNA ligase 3.85e-06 3.65e-03 NA NA
5. P Q4JAL1 S-adenosylmethionine synthase 2.82e-01 4.18e-02 NA NA
5. P Q8NZB4 Proline--tRNA ligase 8.38e-06 2.51e-02 NA NA
5. P A9N9Z2 Proline--tRNA ligase 4.22e-06 7.31e-03 NA NA
5. P A6W7Y5 Proline--tRNA ligase 1.06e-05 1.13e-03 NA NA
5. P B1VYP2 Proline--tRNA ligase 2.03e-05 3.06e-05 NA NA
5. P Q5HCL7 ATP phosphoribosyltransferase regulatory subunit 5.89e-06 1.16e-02 NA NA
5. P A8LQU6 Proline--tRNA ligase 6.98e-07 1.25e-07 NA NA
5. P B3GZ82 Proline--tRNA ligase 2.93e-06 1.80e-03 NA NA
5. P B4F249 Proline--tRNA ligase 4.46e-06 1.80e-03 NA NA
5. P Q9JV26 ATP phosphoribosyltransferase regulatory subunit 6.42e-08 1.78e-19 NA NA
5. P Q831W7 Proline--tRNA ligase 2.60e-06 9.64e-04 NA NA
5. P A1RSD7 S-adenosylmethionine synthase 2.14e-01 2.72e-03 NA NA
5. P B0VRW9 Proline--tRNA ligase 9.38e-06 1.53e-03 NA NA
5. P B4RV73 Proline--tRNA ligase 1.80e-06 1.55e-03 NA NA
5. P A1WKI1 Proline--tRNA ligase 7.03e-06 1.32e-03 NA NA
5. P B2UY89 Proline--tRNA ligase 2.13e-06 3.75e-04 NA NA
5. P A5FX26 Proline--tRNA ligase 5.67e-07 5.08e-08 NA NA
5. P B8ZRT2 Proline--tRNA ligase 7.31e-07 3.89e-02 NA NA
5. P A6VA16 Proline--tRNA ligase 9.07e-06 2.09e-02 NA NA
5. P Q8D1V9 Proline--tRNA ligase 4.42e-06 4.47e-05 NA NA
5. P Q5X9U7 Proline--tRNA ligase 9.41e-06 1.85e-02 NA NA
5. P Q03YC4 Proline--tRNA ligase 1.97e-07 2.30e-05 NA NA
5. P A3NZI6 Proline--tRNA ligase 4.88e-06 1.66e-02 NA NA
5. P B2HY33 Proline--tRNA ligase 9.94e-06 3.75e-03 NA NA
5. P Q9X0D3 ATP phosphoribosyltransferase regulatory subunit 3.25e-05 1.87e-02 NA NA
5. P A1JP53 Proline--tRNA ligase 7.77e-07 2.45e-03 NA NA
5. P C5D9C3 Proline--tRNA ligase 7.71e-06 1.64e-04 NA NA
5. P A3D6H7 Proline--tRNA ligase 1.22e-05 4.64e-02 NA NA
5. P A9A923 S-adenosylmethionine synthase 3.72e-01 9.50e-03 NA NA
5. P B0RVJ2 Proline--tRNA ligase 1.02e-05 8.09e-03 NA NA
5. P B1YC36 S-adenosylmethionine synthase 2.38e-01 2.47e-02 NA NA
5. P Q57T14 Proline--tRNA ligase 8.95e-07 8.81e-04 NA NA
5. P Q8K9S2 Proline--tRNA ligase 1.00e-05 4.98e-04 NA NA
5. P A0PQB8 Proline--tRNA ligase 7.14e-06 3.23e-04 NA NA
5. P A8GIB4 Proline--tRNA ligase 4.16e-06 7.69e-03 NA NA
5. P Q5GTK5 Proline--tRNA ligase 1.15e-07 1.17e-08 NA NA
5. P C5A1H0 Glycine--tRNA ligase 2.07e-06 2.59e-02 NA NA
5. P Q6HEZ6 Proline--tRNA ligase 1 9.74e-06 4.18e-04 NA NA
5. P Q8DXD8 Proline--tRNA ligase 4.05e-06 4.32e-02 NA NA
5. P B4SV24 Proline--tRNA ligase 1.62e-06 1.10e-03 NA NA
5. P Q6A7L9 Proline--tRNA ligase 1.77e-06 6.89e-03 NA NA
5. P Q1IST4 Proline--tRNA ligase 5.45e-06 3.23e-03 NA NA
5. P Q0APX0 Proline--tRNA ligase 1.77e-07 7.82e-08 NA NA
5. P A5CSZ7 Proline--tRNA ligase 7.74e-06 8.35e-04 NA NA
5. P B8D7E1 Proline--tRNA ligase 1.86e-06 8.50e-04 NA NA
5. P Q65QU0 Proline--tRNA ligase 4.20e-06 1.90e-03 NA NA
5. P Q3JZ37 Proline--tRNA ligase 4.61e-06 4.35e-02 NA NA
5. P Q2NEB3 S-adenosylmethionine synthase 5.49e-01 3.98e-03 NA NA
5. P Q9V176 Glycine--tRNA ligase 1.28e-05 4.53e-03 NA NA
5. P Q7NS97 ATP phosphoribosyltransferase regulatory subunit 3.55e-09 8.88e-21 NA NA
5. P B1I2J1 Proline--tRNA ligase 1.14e-06 2.36e-03 NA NA
5. P A7Z4S8 Proline--tRNA ligase 1.36e-06 1.62e-04 NA NA
5. P A7X771 ATP phosphoribosyltransferase regulatory subunit 1.03e-05 7.56e-03 NA NA
5. P Q3JCN7 Proline--tRNA ligase 1.76e-06 1.31e-02 NA NA
5. P C3MQL0 Proline--tRNA ligase 1.22e-08 1.93e-02 NA NA
5. P B1YI68 Proline--tRNA ligase 7.72e-06 1.72e-04 NA NA
5. P Q5JID8 Glycine--tRNA ligase 2.40e-06 3.28e-02 NA NA
5. P Q8XEY9 Proline--tRNA ligase 4.86e-06 1.22e-03 NA NA
5. P B3E1X5 Proline--tRNA ligase 4.22e-06 1.20e-03 NA NA
5. P A5CX68 Proline--tRNA ligase 8.15e-07 1.59e-04 NA NA
6. F Q4A5S0 Proline--tRNA ligase 6.18e-07 NA NA 0.4706
6. F A1RSR6 Proline--tRNA ligase 2.57e-08 NA NA 0.5093
6. F Q6AZG6 Phenylalanine--tRNA ligase alpha subunit A 5.12e-03 NA NA 0.4544
6. F A3MV50 Proline--tRNA ligase 1.79e-08 NA NA 0.5018
6. F B1XP53 Proline--tRNA ligase 8.73e-06 NA NA 0.493
6. F Q82JV8 Proline--tRNA ligase 2 1.15e-06 NA NA 0.5074
6. F Q8XJ76 Phenylalanine--tRNA ligase beta subunit 6.06e-02 NA NA 0.478
6. F Q891T8 Phenylalanine--tRNA ligase beta subunit 1.06e-01 NA NA 0.5117
6. F A8MLB3 Proline--tRNA ligase 6.21e-07 NA NA 0.5155
6. F Q98R27 Proline--tRNA ligase 5.03e-06 NA NA 0.515
6. F Q8ZVQ9 Proline--tRNA ligase 2.68e-08 NA NA 0.5142
6. F A6L2I3 Phenylalanine--tRNA ligase alpha subunit 3.22e-03 NA NA 0.4769
6. F Q67QF2 Phenylalanine--tRNA ligase beta subunit 6.07e-02 NA NA 0.4793
6. F A4WJ22 Proline--tRNA ligase 1.72e-08 NA NA 0.5067
6. F C6BRH1 Threonine--tRNA ligase 5.10e-11 NA NA 0.5672
6. F Q3ZZD3 Phenylalanine--tRNA ligase alpha subunit 5.79e-04 NA NA 0.4893
6. F O28664 Proline--tRNA ligase 4.65e-08 NA NA 0.4962
6. F Q7TUU4 Proline--tRNA ligase 2.55e-05 NA NA 0.4975
6. F B1Y963 Proline--tRNA ligase 1.96e-08 NA NA 0.5067
6. F Q2LR26 Phenylalanine--tRNA ligase beta subunit 3.39e-02 NA NA 0.4884
6. F Q97GL0 Phenylalanine--tRNA ligase beta subunit 8.25e-02 NA NA 0.3867
6. F Q828C6 Phenylalanine--tRNA ligase beta subunit 5.16e-02 NA NA 0.464
6. F A8MC04 Proline--tRNA ligase 3.85e-08 NA NA 0.5089
6. F Q9HL99 Threonine--tRNA ligase 8.86e-11 NA NA 0.5753
6. F Q6MT17 Phenylalanine--tRNA ligase alpha subunit 8.36e-04 NA NA 0.4625
6. F Q74D04 Threonine--tRNA ligase 1.10e-10 NA NA 0.5844
6. F A2BLF3 Threonine--tRNA ligase 9.75e-07 NA NA 0.5601
6. F Q6F165 Phenylalanine--tRNA ligase alpha subunit 2.23e-03 NA NA 0.4605
6. F O88055 Phenylalanine--tRNA ligase alpha subunit 2.55e-03 NA NA 0.4741
6. F Q2SSA0 Phenylalanine--tRNA ligase alpha subunit 2.29e-03 NA NA 0.485
6. F C4XL11 Threonine--tRNA ligase 2.30e-10 NA NA 0.5648
6. F Q7SYV0 Phenylalanine--tRNA ligase alpha subunit B 5.23e-03 NA NA 0.4512
6. F A5FS95 Phenylalanine--tRNA ligase alpha subunit 1.00e-03 NA NA 0.4651
7. B Q987S9 ATP phosphoribosyltransferase regulatory subunit 8.19e-08 NA 0.002 NA
7. B B9J9Y2 ATP phosphoribosyltransferase regulatory subunit 7.16e-08 NA 0.003 NA
7. B B9KAN7 Threonine--tRNA ligase 1.08e-10 NA 0.014 NA
7. B B8ZKT3 Proline--tRNA ligase 8.78e-06 NA 0.001 NA
7. B A6U6I1 ATP phosphoribosyltransferase regulatory subunit 3.90e-08 NA 1.34e-05 NA
7. B P93422 Histidine--tRNA ligase, cytoplasmic 7.84e-10 NA 4.56e-23 NA
7. B Q04MI4 Proline--tRNA ligase 6.18e-06 NA 8.00e-04 NA
7. B Q8EPF3 Threonine--tRNA ligase 3.70e-11 NA 0.025 NA
7. B C1CIE5 Proline--tRNA ligase 7.05e-06 NA 0.001 NA
7. B P46220 Putative histidine--tRNA ligase (Fragment) 7.47e-14 NA 2.52e-20 NA
7. B Q8UHK2 ATP phosphoribosyltransferase regulatory subunit 1.05e-07 NA 0.001 NA
7. B Q3IGT7 Proline--tRNA ligase 2.29e-06 NA 0.023 NA
7. B C3MGT3 ATP phosphoribosyltransferase regulatory subunit 6.71e-08 NA 1.23e-04 NA
7. B F4IYF8 Histidine--tRNA ligase, cytoplasmic 4.21e-09 NA 3.90e-22 NA
7. B Q2YBS6 Threonine--tRNA ligase 4.85e-11 NA 0.015 NA
7. B B1I8Z1 Proline--tRNA ligase 7.82e-06 NA 0.001 NA
7. B Q11LA1 ATP phosphoribosyltransferase regulatory subunit 3.90e-07 NA 2.22e-05 NA
7. B Q2KC03 ATP phosphoribosyltransferase regulatory subunit 2.08e-08 NA 0.020 NA
7. B B5E6T8 Proline--tRNA ligase 6.30e-06 NA 0.001 NA
7. B C1CC55 Proline--tRNA ligase 7.17e-06 NA 0.001 NA
7. B B2ISI9 Proline--tRNA ligase 6.66e-06 NA 7.33e-04 NA
7. B C1CB39 Proline--tRNA ligase 7.42e-06 NA 3.69e-04 NA
7. B Q8DRB0 Proline--tRNA ligase 6.16e-06 NA 8.00e-04 NA
7. B A5IJ45 Threonine--tRNA ligase 7.34e-11 NA 0.044 NA
7. B Q97SR1 Proline--tRNA ligase 7.64e-06 NA 0.001 NA
7. B C1CPD8 Proline--tRNA ligase 6.41e-06 NA 0.001 NA
7. B Q6M9L0 Threonine--tRNA ligase 1.63e-10 NA 1.21e-04 NA